Mon Mar 25 16:28:05 UTC 2024 I: starting to build milib/trixie/armhf on jenkins on '2024-03-25 16:27' Mon Mar 25 16:28:05 UTC 2024 I: The jenkins build log is/was available at https://jenkins.debian.net/userContent/reproducible/debian/build_service/armhf_32/11865/console.log Mon Mar 25 16:28:05 UTC 2024 I: Downloading source for trixie/milib=2.2.0+dfsg-1 --2024-03-25 16:28:05-- http://deb.debian.org/debian/pool/main/m/milib/milib_2.2.0%2bdfsg-1.dsc Connecting to 78.137.99.97:3128... connected. Proxy request sent, awaiting response... 200 OK Length: 2321 (2.3K) [text/prs.lines.tag] Saving to: ‘milib_2.2.0+dfsg-1.dsc’ 0K .. 100% 343M=0s 2024-03-25 16:28:05 (343 MB/s) - ‘milib_2.2.0+dfsg-1.dsc’ saved [2321/2321] Mon Mar 25 16:28:05 UTC 2024 I: milib_2.2.0+dfsg-1.dsc -----BEGIN PGP SIGNED MESSAGE----- Hash: SHA512 Format: 3.0 (quilt) Source: milib Binary: libmilib-java Architecture: all Version: 2.2.0+dfsg-1 Maintainer: Debian Med Packaging Team Uploaders: Steffen Moeller , Pierre Gruet Homepage: https://milaboratory.com/ Standards-Version: 4.6.2 Vcs-Browser: https://salsa.debian.org/med-team/milib Vcs-Git: https://salsa.debian.org/med-team/milib.git Build-Depends: debhelper-compat (= 13), default-jdk, gradle-debian-helper, javahelper, maven-repo-helper Build-Depends-Indep: junit4 , libcommons-compress-java, libcommons-io-java, libcommons-math3-java, libguava-java, libjackson2-annotations-java, libjackson2-core-java, libjackson2-databind-java, libjcommander-java, liblz4-java, libmockito-java , libredberry-pipe-java, libtrove3-java Package-List: libmilib-java deb java optional arch=all Checksums-Sha1: 8bdc2c9f5b41fb8f019e40aa92319f8f44cf53b0 297272 milib_2.2.0+dfsg.orig.tar.xz 8679f47ef3b51a7903c90aec7b1cc0f03d5519ba 7164 milib_2.2.0+dfsg-1.debian.tar.xz Checksums-Sha256: fcb526a82893ed03e0e2ee03fc903068ab0e1ba3756882fde5772570d925bea8 297272 milib_2.2.0+dfsg.orig.tar.xz 3580819348a335020267872364231b07d94acc187fe8f8d1e725cd435ca99da0 7164 milib_2.2.0+dfsg-1.debian.tar.xz Files: 0f3366106ffc38854a4ecb1291948b37 297272 milib_2.2.0+dfsg.orig.tar.xz 1ccdc6feb357479034ab0802e1ec790f 7164 milib_2.2.0+dfsg-1.debian.tar.xz -----BEGIN PGP SIGNATURE----- iQIzBAEBCgAdFiEEM8soQxPpC9J9y0UjYAMWptwndHYFAmOu8MEACgkQYAMWptwn dHb8exAAgNgcLCIp51bVmOXq+5+TMCGtZH0+gUjZYfnhqvzgRcVtjsY4KyVRaxvv 43ldjF+xJOnapBdgG9Yk/JwyooGIk3L7x2d2fSflxqfvCqjRqCWC7EZ43FDESdWx +Xb48U+1t5rW6ucA+GIGuaI3/wL8UTxm9O/ZCdk0zdFoUFeNHOEMPw8/Fysy7z6U gCg2TbPTfrgsnGbTCv9pHqT7/FE8cMNLbd5P61acd/Afa1qym01RxcUlMcGqOS4R 4gf49LshEB1ftRu4XjE9ka6S9svWWxPFK3Qq6qM8otWcsn91BJEsRx7qo0iY/cw6 JoALJr/kq/3QXIiP4a2A6WuP5l53xrNyLZ8E5B95JZnDw887seHibv0BMvKIAxEG GGvsIhd3qWMHSfu5IQckXkg+Vl6spdb82shQpkUOUy7+Nshnplw5Vn5KQ2Ll39j/ sNZpLsb1IMaagRQVp57cFgFCPyHgbTnuHMMhUZJ7n6W7Gqb3bkFDjdKtJnrcSB7i Dltz0RpNUNRmCzfzKNRWORRMQ1CD2cUD8CZK7yqdoSv5S6cGGsMIHuAT2pY4vA6N FE/usfcq76Eghl8xO6XLFLIJxrVSM8iBXQ4TTmA+oUf+ESZ0yb09OwwuEh60MWLM 8CiI7eUUWryGLXgJtjZZkcEFj9qxSblrje70pr9KGmDoWFQQ2R8= =eoDq -----END PGP SIGNATURE----- Mon Mar 25 16:28:05 UTC 2024 I: Checking whether the package is not for us Mon Mar 25 16:28:05 UTC 2024 I: Starting 1st build on remote node virt64c-armhf-rb.debian.net. Mon Mar 25 16:28:05 UTC 2024 I: Preparing to do remote build '1' on virt64c-armhf-rb.debian.net. Mon Mar 25 16:43:54 UTC 2024 I: Deleting $TMPDIR on virt64c-armhf-rb.debian.net. I: pbuilder: network access will be disabled during build I: Current time: Mon Mar 25 04:28:12 -12 2024 I: pbuilder-time-stamp: 1711384092 I: Building the build Environment I: extracting base tarball [/var/cache/pbuilder/trixie-reproducible-base.tgz] I: copying local configuration W: --override-config is not set; not updating apt.conf Read the manpage for details. I: mounting /proc filesystem I: mounting /sys filesystem I: creating /{dev,run}/shm I: mounting /dev/pts filesystem I: redirecting /dev/ptmx to /dev/pts/ptmx I: policy-rc.d already exists I: Copying source file I: copying [milib_2.2.0+dfsg-1.dsc] I: copying [./milib_2.2.0+dfsg.orig.tar.xz] I: copying [./milib_2.2.0+dfsg-1.debian.tar.xz] I: Extracting source gpgv: Signature made Fri Dec 30 14:08:01 2022 gpgv: using RSA key 33CB284313E90BD27DCB4523600316A6DC277476 gpgv: Can't check signature: No public key dpkg-source: warning: cannot verify inline signature for ./milib_2.2.0+dfsg-1.dsc: no acceptable signature found dpkg-source: info: extracting milib in milib-2.2.0+dfsg dpkg-source: info: unpacking milib_2.2.0+dfsg.orig.tar.xz dpkg-source: info: unpacking milib_2.2.0+dfsg-1.debian.tar.xz dpkg-source: info: using patch list from debian/patches/series dpkg-source: info: applying build_gradle.patch dpkg-source: info: applying guava_interface.patch dpkg-source: info: applying deactivate_test_reading_build_properties.patch dpkg-source: info: applying flaky_test.patch I: Not using root during the build. I: Installing the build-deps I: user script /srv/workspace/pbuilder/12854/tmp/hooks/D02_print_environment starting I: set BUILDDIR='/build/reproducible-path' BUILDUSERGECOS='first user,first room,first work-phone,first home-phone,first other' BUILDUSERNAME='pbuilder1' BUILD_ARCH='armhf' DEBIAN_FRONTEND='noninteractive' DEB_BUILD_OPTIONS='buildinfo=+all reproducible=+all parallel=3 ' DISTRIBUTION='trixie' HOME='/root' HOST_ARCH='armhf' IFS=' ' INVOCATION_ID='7b6f1b089d87407fbc976876bbdc280c' LANG='C' LANGUAGE='en_US:en' LC_ALL='C' MAIL='/var/mail/root' OPTIND='1' PATH='/usr/sbin:/usr/bin:/sbin:/bin:/usr/games' PBCURRENTCOMMANDLINEOPERATION='build' PBUILDER_OPERATION='build' PBUILDER_PKGDATADIR='/usr/share/pbuilder' PBUILDER_PKGLIBDIR='/usr/lib/pbuilder' PBUILDER_SYSCONFDIR='/etc' PPID='12854' PS1='# ' PS2='> ' PS4='+ ' PWD='/' SHELL='/bin/bash' SHLVL='2' SUDO_COMMAND='/usr/bin/timeout -k 18.1h 18h /usr/bin/ionice -c 3 /usr/bin/nice /usr/sbin/pbuilder --build --configfile /srv/reproducible-results/rbuild-debian/r-b-build.Xe9poXtK/pbuilderrc_j9vu --distribution trixie --hookdir /etc/pbuilder/first-build-hooks --debbuildopts -b --basetgz /var/cache/pbuilder/trixie-reproducible-base.tgz --buildresult /srv/reproducible-results/rbuild-debian/r-b-build.Xe9poXtK/b1 --logfile b1/build.log milib_2.2.0+dfsg-1.dsc' SUDO_GID='113' SUDO_UID='107' SUDO_USER='jenkins' TERM='unknown' TZ='/usr/share/zoneinfo/Etc/GMT+12' USER='root' _='/usr/bin/systemd-run' http_proxy='http://10.0.0.15:3142/' I: uname -a Linux virt64c 6.1.0-18-arm64 #1 SMP Debian 6.1.76-1 (2024-02-01) aarch64 GNU/Linux I: ls -l /bin lrwxrwxrwx 1 root root 7 Mar 25 11:26 /bin -> usr/bin I: user script /srv/workspace/pbuilder/12854/tmp/hooks/D02_print_environment finished -> Attempting to satisfy build-dependencies -> Creating pbuilder-satisfydepends-dummy package Package: pbuilder-satisfydepends-dummy Version: 0.invalid.0 Architecture: armhf Maintainer: Debian Pbuilder Team Description: Dummy package to satisfy dependencies with aptitude - created by pbuilder This package was created automatically by pbuilder to satisfy the build-dependencies of the package being currently built. Depends: debhelper-compat (= 13), default-jdk, gradle-debian-helper, javahelper, maven-repo-helper, junit4, libcommons-compress-java, libcommons-io-java, libcommons-math3-java, libguava-java, libjackson2-annotations-java, libjackson2-core-java, libjackson2-databind-java, libjcommander-java, liblz4-java, libmockito-java, libredberry-pipe-java, libtrove3-java dpkg-deb: building package 'pbuilder-satisfydepends-dummy' in '/tmp/satisfydepends-aptitude/pbuilder-satisfydepends-dummy.deb'. Selecting previously unselected package pbuilder-satisfydepends-dummy. (Reading database ... 19577 files and directories currently installed.) Preparing to unpack .../pbuilder-satisfydepends-dummy.deb ... Unpacking pbuilder-satisfydepends-dummy (0.invalid.0) ... dpkg: pbuilder-satisfydepends-dummy: dependency problems, but configuring anyway as you requested: pbuilder-satisfydepends-dummy depends on debhelper-compat (= 13); however: Package debhelper-compat is not installed. pbuilder-satisfydepends-dummy depends on default-jdk; however: Package default-jdk is not installed. pbuilder-satisfydepends-dummy depends on gradle-debian-helper; however: Package gradle-debian-helper is not installed. pbuilder-satisfydepends-dummy depends on javahelper; however: Package javahelper is not installed. pbuilder-satisfydepends-dummy depends on maven-repo-helper; however: Package maven-repo-helper is not installed. pbuilder-satisfydepends-dummy depends on junit4; however: Package junit4 is not installed. pbuilder-satisfydepends-dummy depends on libcommons-compress-java; however: Package libcommons-compress-java is not installed. pbuilder-satisfydepends-dummy depends on libcommons-io-java; however: Package libcommons-io-java is not installed. pbuilder-satisfydepends-dummy depends on libcommons-math3-java; however: Package libcommons-math3-java is not installed. pbuilder-satisfydepends-dummy depends on libguava-java; however: Package libguava-java is not installed. pbuilder-satisfydepends-dummy depends on libjackson2-annotations-java; however: Package libjackson2-annotations-java is not installed. pbuilder-satisfydepends-dummy depends on libjackson2-core-java; however: Package libjackson2-core-java is not installed. pbuilder-satisfydepends-dummy depends on libjackson2-databind-java; however: Package libjackson2-databind-java is not installed. pbuilder-satisfydepends-dummy depends on libjcommander-java; however: Package libjcommander-java is not installed. pbuilder-satisfydepends-dummy depends on liblz4-java; however: Package liblz4-java is not installed. pbuilder-satisfydepends-dummy depends on libmockito-java; however: Package libmockito-java is not installed. pbuilder-satisfydepends-dummy depends on libredberry-pipe-java; however: Package libredberry-pipe-java is not installed. pbuilder-satisfydepends-dummy depends on libtrove3-java; however: Package libtrove3-java is not installed. Setting up pbuilder-satisfydepends-dummy (0.invalid.0) ... Reading package lists... Building dependency tree... Reading state information... Initializing package states... Writing extended state information... Building tag database... pbuilder-satisfydepends-dummy is already installed at the requested version (0.invalid.0) pbuilder-satisfydepends-dummy is already installed at the requested version (0.invalid.0) The following NEW packages will be installed: adwaita-icon-theme{a} ant{a} ant-optional{a} antlr{a} at-spi2-common{a} autoconf{a} automake{a} autopoint{a} autotools-dev{a} binfmt-support{a} bnd{a} bsdextrautils{a} ca-certificates{a} ca-certificates-java{a} dctrl-tools{a} debhelper{a} default-jdk{a} default-jdk-headless{a} default-jre{a} default-jre-headless{a} devscripts{a} dh-autoreconf{a} dh-strip-nondeterminism{a} dirmngr{a} dwz{a} fastjar{a} file{a} fontconfig{a} fontconfig-config{a} fonts-dejavu-core{a} fonts-dejavu-mono{a} gettext{a} gettext-base{a} gnupg{a} gnupg-l10n{a} gnupg-utils{a} gpg{a} gpg-agent{a} gpg-wks-client{a} gpg-wks-server{a} gpgconf{a} gpgsm{a} gradle{a} gradle-debian-helper{a} groff-base{a} groovy{a} gtk-update-icon-cache{a} hicolor-icon-theme{a} intltool-debian{a} ivy{a} jarwrapper{a} java-common{a} java-wrappers{a} javahelper{a} junit4{a} libantlr-java{a} libaopalliance-java{a} libapache-pom-java{a} libarchive-zip-perl{a} libasm-java{a} libasound2{a} libasound2-data{a} libassuan0{a} libatinject-jsr330-api-java{a} libatk1.0-0{a} libavahi-client3{a} libavahi-common-data{a} libavahi-common3{a} libb-hooks-op-check-perl{a} libbcel-java{a} libbcpg-java{a} libbcprov-java{a} libbrotli1{a} libbsd0{a} libbsf-java{a} libbsh-java{a} libbyte-buddy-java{a} libcairo2{a} libcdi-api-java{a} libclass-method-modifiers-perl{a} libclass-xsaccessor-perl{a} libclone-perl{a} libcommons-cli-java{a} libcommons-codec-java{a} libcommons-collections3-java{a} libcommons-compress-java{a} libcommons-io-java{a} libcommons-lang-java{a} libcommons-lang3-java{a} libcommons-logging-java{a} libcommons-math3-java{a} libcommons-parent-java{a} libcups2{a} libdatrie1{a} libdbus-1-3{a} libdd-plist-java{a} libdebhelper-perl{a} libdeflate0{a} libdevel-callchecker-perl{a} libdom4j-java{a} libdrm-amdgpu1{a} libdrm-common{a} libdrm-nouveau2{a} libdrm-radeon1{a} libdrm2{a} libdynaloader-functions-perl{a} libeclipse-jdt-annotation-java{a} libedit2{a} libel-api-java{a} libelf1{a} libencode-locale-perl{a} liberror-prone-java{a} libexpat1{a} libfelix-framework-java{a} libfelix-gogo-runtime-java{a} libfelix-resolver-java{a} libfile-dirlist-perl{a} libfile-homedir-perl{a} libfile-listing-perl{a} libfile-stripnondeterminism-perl{a} libfile-touch-perl{a} libfile-which-perl{a} libfindbugs-java{a} libfontconfig1{a} libfreetype6{a} libfribidi0{a} libgdk-pixbuf-2.0-0{a} libgdk-pixbuf2.0-common{a} libgeronimo-annotation-1.3-spec-java{a} libgeronimo-interceptor-3.0-spec-java{a} libgif7{a} libgl1{a} libgl1-mesa-dri{a} libglapi-mesa{a} libglib2.0-0{a} libglvnd0{a} libglx-mesa0{a} libglx0{a} libgoogle-gson-java{a} libgradle-core-java{a} libgradle-plugins-java{a} libgraphite2-3{a} libgtk2.0-0{a} libgtk2.0-common{a} libguava-java{a} libguice-java{a} libhamcrest-java{a} libharfbuzz0b{a} libhawtjni-runtime-java{a} libhtml-parser-perl{a} libhtml-tagset-perl{a} libhtml-tree-perl{a} libhttp-cookies-perl{a} libhttp-date-perl{a} libhttp-message-perl{a} libhttp-negotiate-perl{a} libhttpclient-java{a} libhttpcore-java{a} libicu72{a} libimport-into-perl{a} libio-html-perl{a} libio-pty-perl{a} libio-socket-ssl-perl{a} libipc-run-perl{a} libjackson2-annotations-java{a} libjackson2-core-java{a} libjackson2-databind-java{a} libjansi-java{a} libjansi-native-java{a} libjansi1-java{a} libjarjar-java{a} libjatl-java{a} libjavaewah-java{a} libjaxen-java{a} libjbig0{a} libjcifs-java{a} libjcip-annotations-java{a} libjcommander-java{a} libjetty9-java{a} libjformatstring-java{a} libjgit-java{a} libjline2-java{a} libjna-java{a} libjna-jni{a} libjpeg62-turbo{a} libjs-jquery{a} libjsch-java{a} libjsoup-java{a} libjsp-api-java{a} libjsr305-java{a} libjzlib-java{a} libkryo-java{a} libksba8{a} liblcms2-2{a} libldap-2.5-0{a} liblerc4{a} libllvm17{a} liblogback-java{a} liblwp-mediatypes-perl{a} liblwp-protocol-https-perl{a} liblz4-java{a} liblz4-jni{a} libmagic-mgc{a} libmagic1{a} libmaven-parent-java{a} libmaven-resolver-java{a} libmaven-shared-utils-java{a} libmaven3-core-java{a} libminlog-java{a} libmockito-java{a} libmodule-runtime-perl{a} libmoo-perl{a} libnative-platform-java{a} libnative-platform-jni{a} libnekohtml-java{a} libnet-http-perl{a} libnet-ssleay-perl{a} libnpth0{a} libnspr4{a} libnss3{a} libobjenesis-java{a} libosgi-annotation-java{a} libosgi-compendium-java{a} libosgi-core-java{a} libpango-1.0-0{a} libpangocairo-1.0-0{a} libpangoft2-1.0-0{a} libparams-classify-perl{a} libpcsclite1{a} libpipeline1{a} libpixman-1-0{a} libplexus-cipher-java{a} libplexus-classworlds-java{a} libplexus-component-annotations-java{a} libplexus-container-default-java{a} libplexus-interpolation-java{a} libplexus-sec-dispatcher-java{a} libplexus-utils2-java{a} libpng16-16{a} libpolyglot-maven-java{a} libpython3-stdlib{a} libpython3.11-minimal{a} libpython3.11-stdlib{a} libqdox-java{a} libreadline8{a} libredberry-pipe-java{a} libreflectasm-java{a} librhino-java{a} librole-tiny-perl{a} libsasl2-2{a} libsasl2-modules-db{a} libsensors-config{a} libsensors5{a} libservlet-api-java{a} libsharpyuv0{a} libsimple-http-java{a} libsisu-inject-java{a} libsisu-plexus-java{a} libslf4j-java{a} libsub-override-perl{a} libsub-quote-perl{a} libthai-data{a} libthai0{a} libtiff6{a} libtimedate-perl{a} libtool{a} libtrove3-java{a} libtry-tiny-perl{a} libuchardet0{a} liburi-perl{a} libvulkan1{a} libwagon-file-java{a} libwagon-http-java{a} libwagon-provider-api-java{a} libwebp7{a} libwebsocket-api-java{a} libwww-perl{a} libwww-robotrules-perl{a} libx11-6{a} libx11-data{a} libx11-xcb1{a} libxau6{a} libxbean-reflect-java{a} libxcb-dri2-0{a} libxcb-dri3-0{a} libxcb-glx0{a} libxcb-present0{a} libxcb-randr0{a} libxcb-render0{a} libxcb-shm0{a} libxcb-sync1{a} libxcb-xfixes0{a} libxcb1{a} libxcomposite1{a} libxcursor1{a} libxdamage1{a} libxdmcp6{a} libxerces2-java{a} libxext6{a} libxfixes3{a} libxi6{a} libxinerama1{a} libxml-commons-external-java{a} libxml-commons-resolver1.1-java{a} libxml2{a} libxpp3-java{a} libxrandr2{a} libxrender1{a} libxshmfence1{a} libxstream-java{a} libxtst6{a} libxxf86vm1{a} libxz-java{a} libyaml-snake-java{a} libz3-4{a} m4{a} man-db{a} maven-repo-helper{a} media-types{a} netbase{a} openjdk-17-jdk{a} openjdk-17-jdk-headless{a} openjdk-17-jre{a} openjdk-17-jre-headless{a} openssl{a} patchutils{a} perl-openssl-defaults{a} pinentry-curses{a} po-debconf{a} python3{a} python3-minimal{a} python3.11{a} python3.11-minimal{a} readline-common{a} sensible-utils{a} shared-mime-info{a} testng{a} tzdata{a} unzip{a} wdiff{a} x11-common{a} The following packages are RECOMMENDED but will NOT be installed: alsa-topology-conf alsa-ucm-conf curl dbus debian-keyring dput dput-ng dupload equivs fonts-dejavu-extra javascript-common libarchive-cpio-perl libatk-wrapper-java-jni libbindex-java libdata-dump-perl libdistro-info-perl libgail-common libgdk-pixbuf2.0-bin libgit-wrapper-perl libgitlab-api-v4-perl libglib2.0-data libgpars-groovy-java libgtk2.0-bin libhtml-form-perl libhtml-format-perl libhttp-daemon-perl libio-compress-brotli-perl libjson-perl libldap-common liblist-compare-perl libltdl-dev libmail-sendmail-perl libmailtools-perl libnamespace-clean-perl libreflectasm-java-doc librsvg2-common libsasl2-modules libsoap-lite-perl libstring-shellquote-perl libxstring-perl libxt-dev licensecheck lintian lynx mesa-vulkan-drivers pristine-tar python3-apt python3-debian python3-magic python3-requests python3-unidiff python3-xdg strace wget xdg-user-dirs 0 packages upgraded, 341 newly installed, 0 to remove and 0 not upgraded. Need to get 291 MB of archives. After unpacking 717 MB will be used. Writing extended state information... Get: 1 http://deb.debian.org/debian trixie/main armhf libpipeline1 armhf 1.5.7-1+b2 [33.4 kB] Get: 2 http://deb.debian.org/debian trixie/main armhf binfmt-support armhf 2.2.2-6 [55.2 kB] Get: 3 http://deb.debian.org/debian trixie/main armhf libpython3.11-minimal armhf 3.11.8-1 [802 kB] Get: 4 http://deb.debian.org/debian trixie/main armhf libexpat1 armhf 2.5.0-2+b2 [80.2 kB] Get: 5 http://deb.debian.org/debian trixie/main armhf python3.11-minimal armhf 3.11.8-1 [1707 kB] Get: 6 http://deb.debian.org/debian trixie/main armhf python3-minimal armhf 3.11.6-1 [26.2 kB] Get: 7 http://deb.debian.org/debian trixie/main armhf media-types all 10.1.0 [26.9 kB] Get: 8 http://deb.debian.org/debian trixie/main armhf netbase all 6.4 [12.8 kB] Get: 9 http://deb.debian.org/debian trixie/main armhf tzdata all 2024a-1 [255 kB] Get: 10 http://deb.debian.org/debian trixie/main armhf readline-common all 8.2-3 [69.1 kB] Get: 11 http://deb.debian.org/debian trixie/main armhf libreadline8 armhf 8.2-3+b1 [144 kB] Get: 12 http://deb.debian.org/debian trixie/main armhf libpython3.11-stdlib armhf 3.11.8-1 [1709 kB] Get: 13 http://deb.debian.org/debian trixie/main armhf python3.11 armhf 3.11.8-1 [597 kB] Get: 14 http://deb.debian.org/debian trixie/main armhf libpython3-stdlib armhf 3.11.6-1 [9224 B] Get: 15 http://deb.debian.org/debian trixie/main armhf python3 armhf 3.11.6-1 [26.2 kB] Get: 16 http://deb.debian.org/debian trixie/main armhf sensible-utils all 0.0.22 [22.4 kB] Get: 17 http://deb.debian.org/debian trixie/main armhf openssl armhf 3.1.5-1 [1208 kB] Get: 18 http://deb.debian.org/debian trixie/main armhf ca-certificates all 20240203 [158 kB] Get: 19 http://deb.debian.org/debian trixie/main armhf libmagic-mgc armhf 1:5.45-2+b1 [314 kB] Get: 20 http://deb.debian.org/debian trixie/main armhf libmagic1 armhf 1:5.45-2+b1 [97.9 kB] Get: 21 http://deb.debian.org/debian trixie/main armhf file armhf 1:5.45-2+b1 [42.2 kB] Get: 22 http://deb.debian.org/debian trixie/main armhf gettext-base armhf 0.21-14+b1 [157 kB] Get: 23 http://deb.debian.org/debian trixie/main armhf libuchardet0 armhf 0.0.8-1+b1 [65.7 kB] Get: 24 http://deb.debian.org/debian trixie/main armhf groff-base armhf 1.23.0-3 [1088 kB] Get: 25 http://deb.debian.org/debian trixie/main armhf bsdextrautils armhf 2.39.3-6 [81.2 kB] Get: 26 http://deb.debian.org/debian trixie/main armhf man-db armhf 2.12.0-3 [1367 kB] Get: 27 http://deb.debian.org/debian trixie/main armhf libgdk-pixbuf2.0-common all 2.42.10+dfsg-3 [307 kB] Get: 28 http://deb.debian.org/debian trixie/main armhf libglib2.0-0 armhf 2.78.4-1 [1281 kB] Get: 29 http://deb.debian.org/debian trixie/main armhf libicu72 armhf 72.1-4+b1 [9070 kB] Get: 30 http://deb.debian.org/debian trixie/main armhf libxml2 armhf 2.9.14+dfsg-1.3+b2 [599 kB] Get: 31 http://deb.debian.org/debian trixie/main armhf shared-mime-info armhf 2.4-1 [746 kB] Get: 32 http://deb.debian.org/debian trixie/main armhf libjpeg62-turbo armhf 1:2.1.5-2+b2 [143 kB] Get: 33 http://deb.debian.org/debian trixie/main armhf libpng16-16 armhf 1.6.43-1 [262 kB] Get: 34 http://deb.debian.org/debian trixie/main armhf libdeflate0 armhf 1.19-1 [39.1 kB] Get: 35 http://deb.debian.org/debian trixie/main armhf libjbig0 armhf 2.1-6.1+b1 [27.3 kB] Get: 36 http://deb.debian.org/debian trixie/main armhf liblerc4 armhf 4.0.0+ds-4+b1 [137 kB] Get: 37 http://deb.debian.org/debian trixie/main armhf libsharpyuv0 armhf 1.3.2-0.4 [105 kB] Get: 38 http://deb.debian.org/debian trixie/main armhf libwebp7 armhf 1.3.2-0.4 [261 kB] Get: 39 http://deb.debian.org/debian trixie/main armhf libtiff6 armhf 4.5.1+git230720-4 [301 kB] Get: 40 http://deb.debian.org/debian trixie/main armhf libgdk-pixbuf-2.0-0 armhf 2.42.10+dfsg-3+b1 [124 kB] Get: 41 http://deb.debian.org/debian trixie/main armhf gtk-update-icon-cache armhf 3.24.41-1 [44.6 kB] Get: 42 http://deb.debian.org/debian trixie/main armhf hicolor-icon-theme all 0.17-2 [11.4 kB] Get: 43 http://deb.debian.org/debian trixie/main armhf adwaita-icon-theme all 46.0-1 [614 kB] Get: 44 http://deb.debian.org/debian trixie/main armhf ca-certificates-java all 20240118 [11.6 kB] Get: 45 http://deb.debian.org/debian trixie/main armhf java-common all 0.75 [6640 B] Get: 46 http://deb.debian.org/debian trixie/main armhf libavahi-common-data armhf 0.8-13+b1 [111 kB] Get: 47 http://deb.debian.org/debian trixie/main armhf libavahi-common3 armhf 0.8-13+b1 [40.1 kB] Get: 48 http://deb.debian.org/debian trixie/main armhf libdbus-1-3 armhf 1.14.10-4 [180 kB] Get: 49 http://deb.debian.org/debian trixie/main armhf libavahi-client3 armhf 0.8-13+b1 [43.4 kB] Get: 50 http://deb.debian.org/debian trixie/main armhf libcups2 armhf 2.4.7-1+b1 [212 kB] Get: 51 http://deb.debian.org/debian trixie/main armhf liblcms2-2 armhf 2.14-2+b1 [126 kB] Get: 52 http://deb.debian.org/debian trixie/main armhf libbrotli1 armhf 1.1.0-2+b3 [284 kB] Get: 53 http://deb.debian.org/debian trixie/main armhf libfreetype6 armhf 2.13.2+dfsg-1+b1 [371 kB] Get: 54 http://deb.debian.org/debian trixie/main armhf fonts-dejavu-mono all 2.37-8 [489 kB] Get: 55 http://deb.debian.org/debian trixie/main armhf fonts-dejavu-core all 2.37-8 [840 kB] Get: 56 http://deb.debian.org/debian trixie/main armhf fontconfig-config armhf 2.15.0-1.1 [317 kB] Get: 57 http://deb.debian.org/debian trixie/main armhf libfontconfig1 armhf 2.15.0-1.1 [370 kB] Get: 58 http://deb.debian.org/debian trixie/main armhf libnspr4 armhf 2:4.35-1.1+b1 [87.2 kB] Get: 59 http://deb.debian.org/debian trixie/main armhf libnss3 armhf 2:3.99-1 [1220 kB] Get: 60 http://deb.debian.org/debian trixie/main armhf libasound2-data all 1.2.10-3 [20.7 kB] Get: 61 http://deb.debian.org/debian trixie/main armhf libasound2 armhf 1.2.10-3 [316 kB] Get: 62 http://deb.debian.org/debian trixie/main armhf libgraphite2-3 armhf 1.3.14-2 [63.2 kB] Get: 63 http://deb.debian.org/debian trixie/main armhf libharfbuzz0b armhf 8.3.0-2 [2155 kB] Get: 64 http://deb.debian.org/debian trixie/main armhf libpcsclite1 armhf 2.0.1-1+b1 [47.8 kB] Get: 65 http://deb.debian.org/debian trixie/main armhf openjdk-17-jre-headless armhf 17.0.10+7-1 [38.2 MB] Get: 66 http://deb.debian.org/debian trixie/main armhf default-jre-headless armhf 2:1.17-75 [3068 B] Get: 67 http://deb.debian.org/debian trixie/main armhf ant all 1.10.14-1 [2162 kB] Get: 68 http://deb.debian.org/debian trixie/main armhf ant-optional all 1.10.14-1 [455 kB] Get: 69 http://deb.debian.org/debian trixie/main armhf libantlr-java all 2.7.7+dfsg-13 [458 kB] Get: 70 http://deb.debian.org/debian trixie/main armhf antlr all 2.7.7+dfsg-13 [8272 B] Get: 71 http://deb.debian.org/debian trixie/main armhf at-spi2-common all 2.50.0-1 [163 kB] Get: 72 http://deb.debian.org/debian trixie/main armhf m4 armhf 1.4.19-4 [264 kB] Get: 73 http://deb.debian.org/debian trixie/main armhf autoconf all 2.71-3 [332 kB] Get: 74 http://deb.debian.org/debian trixie/main armhf autotools-dev all 20220109.1 [51.6 kB] Get: 75 http://deb.debian.org/debian trixie/main armhf automake all 1:1.16.5-1.3 [823 kB] Get: 76 http://deb.debian.org/debian trixie/main armhf autopoint all 0.21-14 [496 kB] Get: 77 http://deb.debian.org/debian trixie/main armhf unzip armhf 6.0-28 [152 kB] Get: 78 http://deb.debian.org/debian trixie/main armhf java-wrappers all 0.4 [8916 B] Get: 79 http://deb.debian.org/debian trixie/main armhf libhamcrest-java all 2.2-2 [121 kB] Get: 80 http://deb.debian.org/debian trixie/main armhf junit4 all 4.13.2-4 [349 kB] Get: 81 http://deb.debian.org/debian trixie/main armhf libfelix-framework-java all 4.6.1-2.1 [569 kB] Get: 82 http://deb.debian.org/debian trixie/main armhf libfelix-gogo-runtime-java all 0.16.2-1.1 [114 kB] Get: 83 http://deb.debian.org/debian trixie/main armhf libosgi-annotation-java all 8.1.0-1 [9436 B] Get: 84 http://deb.debian.org/debian trixie/main armhf libosgi-core-java all 8.0.0-2 [182 kB] Get: 85 http://deb.debian.org/debian trixie/main armhf libfelix-resolver-java all 1.16.0-1 [180 kB] Get: 86 http://deb.debian.org/debian trixie/main armhf libhawtjni-runtime-java all 1.18-1 [36.3 kB] Get: 87 http://deb.debian.org/debian trixie/main armhf libjansi-native-java all 1.8-2 [26.0 kB] Get: 88 http://deb.debian.org/debian trixie/main armhf libjansi1-java all 1.18-3 [66.5 kB] Get: 89 http://deb.debian.org/debian trixie/main armhf libjline2-java all 2.14.6-5 [151 kB] Get: 90 http://deb.debian.org/debian trixie/main armhf libosgi-compendium-java all 7.0.0-1 [477 kB] Get: 91 http://deb.debian.org/debian trixie/main armhf libslf4j-java all 1.7.32-1 [144 kB] Get: 92 http://deb.debian.org/debian trixie/main armhf libxz-java all 1.9-1 [143 kB] Get: 93 http://deb.debian.org/debian trixie/main armhf libyaml-snake-java all 1.33-2 [321 kB] Get: 94 http://deb.debian.org/debian trixie/main armhf bnd all 5.0.1-5 [10.1 MB] Get: 95 http://deb.debian.org/debian trixie/main armhf dctrl-tools armhf 2.24-3 [96.0 kB] Get: 96 http://deb.debian.org/debian trixie/main armhf libdebhelper-perl all 13.14.1 [85.6 kB] Get: 97 http://deb.debian.org/debian trixie/main armhf libtool all 2.4.7-7 [517 kB] Get: 98 http://deb.debian.org/debian trixie/main armhf dh-autoreconf all 20 [17.1 kB] Get: 99 http://deb.debian.org/debian trixie/main armhf libarchive-zip-perl all 1.68-1 [104 kB] Get: 100 http://deb.debian.org/debian trixie/main armhf libsub-override-perl all 0.10-1 [10.6 kB] Get: 101 http://deb.debian.org/debian trixie/main armhf libfile-stripnondeterminism-perl all 1.13.1-1 [19.4 kB] Get: 102 http://deb.debian.org/debian trixie/main armhf dh-strip-nondeterminism all 1.13.1-1 [8620 B] Get: 103 http://deb.debian.org/debian trixie/main armhf libelf1 armhf 0.190-1+b1 [171 kB] Get: 104 http://deb.debian.org/debian trixie/main armhf dwz armhf 0.15-1 [101 kB] Get: 105 http://deb.debian.org/debian trixie/main armhf gettext armhf 0.21-14+b1 [1230 kB] Get: 106 http://deb.debian.org/debian trixie/main armhf intltool-debian all 0.35.0+20060710.6 [22.9 kB] Get: 107 http://deb.debian.org/debian trixie/main armhf po-debconf all 1.0.21+nmu1 [248 kB] Get: 108 http://deb.debian.org/debian trixie/main armhf debhelper all 13.14.1 [890 kB] Get: 109 http://deb.debian.org/debian trixie/main armhf libgtk2.0-common all 2.24.33-3 [2659 kB] Get: 110 http://deb.debian.org/debian trixie/main armhf libatk1.0-0 armhf 2.50.0-1+b1 [43.3 kB] Get: 111 http://deb.debian.org/debian trixie/main armhf libpixman-1-0 armhf 0.42.2-1+b1 [476 kB] Get: 112 http://deb.debian.org/debian trixie/main armhf libxau6 armhf 1:1.0.9-1 [19.0 kB] Get: 113 http://deb.debian.org/debian trixie/main armhf libbsd0 armhf 0.12.2-1 [127 kB] Get: 114 http://deb.debian.org/debian trixie/main armhf libxdmcp6 armhf 1:1.1.2-3 [24.9 kB] Get: 115 http://deb.debian.org/debian trixie/main armhf libxcb1 armhf 1.15-1 [140 kB] Get: 116 http://deb.debian.org/debian trixie/main armhf libx11-data all 2:1.8.7-1 [328 kB] Get: 117 http://deb.debian.org/debian trixie/main armhf libx11-6 armhf 2:1.8.7-1 [735 kB] Get: 118 http://deb.debian.org/debian trixie/main armhf libxcb-render0 armhf 1.15-1 [114 kB] Get: 119 http://deb.debian.org/debian trixie/main armhf libxcb-shm0 armhf 1.15-1 [106 kB] Get: 120 http://deb.debian.org/debian trixie/main armhf libxext6 armhf 2:1.3.4-1+b1 [47.8 kB] Get: 121 http://deb.debian.org/debian trixie/main armhf libxrender1 armhf 1:0.9.10-1.1 [30.1 kB] Get: 122 http://deb.debian.org/debian trixie/main armhf libcairo2 armhf 1.18.0-1+b1 [441 kB] Get: 123 http://deb.debian.org/debian trixie/main armhf fontconfig armhf 2.15.0-1.1 [461 kB] Get: 124 http://deb.debian.org/debian trixie/main armhf libfribidi0 armhf 1.0.13-3+b1 [69.4 kB] Get: 125 http://deb.debian.org/debian trixie/main armhf libthai-data all 0.1.29-2 [168 kB] Get: 126 http://deb.debian.org/debian trixie/main armhf libdatrie1 armhf 0.2.13-3 [34.4 kB] Get: 127 http://deb.debian.org/debian trixie/main armhf libthai0 armhf 0.1.29-2 [45.8 kB] Get: 128 http://deb.debian.org/debian trixie/main armhf libpango-1.0-0 armhf 1.52.0+ds-1 [192 kB] Get: 129 http://deb.debian.org/debian trixie/main armhf libpangoft2-1.0-0 armhf 1.52.0+ds-1 [41.8 kB] Get: 130 http://deb.debian.org/debian trixie/main armhf libpangocairo-1.0-0 armhf 1.52.0+ds-1 [31.2 kB] Get: 131 http://deb.debian.org/debian trixie/main armhf libxcomposite1 armhf 1:0.4.5-1 [16.1 kB] Get: 132 http://deb.debian.org/debian trixie/main armhf libxfixes3 armhf 1:6.0.0-2 [21.1 kB] Get: 133 http://deb.debian.org/debian trixie/main armhf libxcursor1 armhf 1:1.2.1-1 [37.9 kB] Get: 134 http://deb.debian.org/debian trixie/main armhf libxdamage1 armhf 1:1.1.6-1 [14.6 kB] Get: 135 http://deb.debian.org/debian trixie/main armhf libxi6 armhf 2:1.8.1-1 [73.8 kB] Get: 136 http://deb.debian.org/debian trixie/main armhf libxinerama1 armhf 2:1.1.4-3 [17.4 kB] Get: 137 http://deb.debian.org/debian trixie/main armhf libxrandr2 armhf 2:1.5.4-1 [33.0 kB] Get: 138 http://deb.debian.org/debian trixie/main armhf libgtk2.0-0 armhf 2.24.33-3 [1555 kB] Get: 139 http://deb.debian.org/debian trixie/main armhf libglvnd0 armhf 1.7.0-1 [52.3 kB] Get: 140 http://deb.debian.org/debian trixie/main armhf libdrm-common all 2.4.120-2 [7688 B] Get: 141 http://deb.debian.org/debian trixie/main armhf libdrm2 armhf 2.4.120-2 [33.8 kB] Get: 142 http://deb.debian.org/debian trixie/main armhf libglapi-mesa armhf 23.3.5-1 [42.5 kB] Get: 143 http://deb.debian.org/debian trixie/main armhf libx11-xcb1 armhf 2:1.8.7-1 [231 kB] Get: 144 http://deb.debian.org/debian trixie/main armhf libxcb-dri2-0 armhf 1.15-1 [107 kB] Get: 145 http://deb.debian.org/debian trixie/main armhf libxcb-dri3-0 armhf 1.15-1 [107 kB] Get: 146 http://deb.debian.org/debian trixie/main armhf libxcb-glx0 armhf 1.15-1 [120 kB] Get: 147 http://deb.debian.org/debian trixie/main armhf libxcb-present0 armhf 1.15-1 [105 kB] Get: 148 http://deb.debian.org/debian trixie/main armhf libxcb-randr0 armhf 1.15-1 [116 kB] Get: 149 http://deb.debian.org/debian trixie/main armhf libxcb-sync1 armhf 1.15-1 [108 kB] Get: 150 http://deb.debian.org/debian trixie/main armhf libxcb-xfixes0 armhf 1.15-1 [110 kB] Get: 151 http://deb.debian.org/debian trixie/main armhf libxshmfence1 armhf 1.3-1 [8592 B] Get: 152 http://deb.debian.org/debian trixie/main armhf libxxf86vm1 armhf 1:1.1.4-1+b2 [20.2 kB] Get: 153 http://deb.debian.org/debian trixie/main armhf libvulkan1 armhf 1.3.275.0-1 [109 kB] Get: 154 http://deb.debian.org/debian trixie/main armhf libdrm-amdgpu1 armhf 2.4.120-2 [20.0 kB] Get: 155 http://deb.debian.org/debian trixie/main armhf libdrm-nouveau2 armhf 2.4.120-2 [16.9 kB] Get: 156 http://deb.debian.org/debian trixie/main armhf libdrm-radeon1 armhf 2.4.120-2 [19.5 kB] Get: 157 http://deb.debian.org/debian trixie/main armhf libedit2 armhf 3.1-20230828-1 [76.8 kB] Get: 158 http://deb.debian.org/debian trixie/main armhf libz3-4 armhf 4.8.12-3.1+b2 [6324 kB] Get: 159 http://deb.debian.org/debian trixie/main armhf libllvm17 armhf 1:17.0.6-5 [21.6 MB] Get: 160 http://deb.debian.org/debian trixie/main armhf libsensors-config all 1:3.6.0-9 [14.6 kB] Get: 161 http://deb.debian.org/debian trixie/main armhf libsensors5 armhf 1:3.6.0-9 [31.9 kB] Get: 162 http://deb.debian.org/debian trixie/main armhf libgl1-mesa-dri armhf 23.3.5-1 [6405 kB] Get: 163 http://deb.debian.org/debian trixie/main armhf libglx-mesa0 armhf 23.3.5-1 [130 kB] Get: 164 http://deb.debian.org/debian trixie/main armhf libglx0 armhf 1.7.0-1 [32.2 kB] Get: 165 http://deb.debian.org/debian trixie/main armhf libgl1 armhf 1.7.0-1 [90.8 kB] Get: 166 http://deb.debian.org/debian trixie/main armhf libgif7 armhf 5.2.2-1 [41.2 kB] Get: 167 http://deb.debian.org/debian trixie/main armhf x11-common all 1:7.7+23 [252 kB] Get: 168 http://deb.debian.org/debian trixie/main armhf libxtst6 armhf 2:1.2.3-1.1 [26.2 kB] Get: 169 http://deb.debian.org/debian trixie/main armhf openjdk-17-jre armhf 17.0.10+7-1 [163 kB] Get: 170 http://deb.debian.org/debian trixie/main armhf default-jre armhf 2:1.17-75 [1056 B] Get: 171 http://deb.debian.org/debian trixie/main armhf openjdk-17-jdk-headless armhf 17.0.10+7-1 [67.4 MB] Get: 172 http://deb.debian.org/debian trixie/main armhf default-jdk-headless armhf 2:1.17-75 [1108 B] Get: 173 http://deb.debian.org/debian trixie/main armhf openjdk-17-jdk armhf 17.0.10+7-1 [2361 kB] Get: 174 http://deb.debian.org/debian trixie/main armhf default-jdk armhf 2:1.17-75 [1068 B] Get: 175 http://deb.debian.org/debian trixie/main armhf libassuan0 armhf 2.5.6-1 [43.3 kB] Get: 176 http://deb.debian.org/debian trixie/main armhf gpgconf armhf 2.2.40-1.1+b1 [547 kB] Get: 177 http://deb.debian.org/debian trixie/main armhf libksba8 armhf 1.6.6-1 [112 kB] Get: 178 http://deb.debian.org/debian trixie/main armhf libsasl2-modules-db armhf 2.1.28+dfsg1-4+b1 [18.2 kB] Get: 179 http://deb.debian.org/debian trixie/main armhf libsasl2-2 armhf 2.1.28+dfsg1-4+b1 [50.1 kB] Get: 180 http://deb.debian.org/debian trixie/main armhf libldap-2.5-0 armhf 2.5.13+dfsg-5+b3 [158 kB] Get: 181 http://deb.debian.org/debian trixie/main armhf libnpth0 armhf 1.6-3+b1 [16.9 kB] Get: 182 http://deb.debian.org/debian trixie/main armhf dirmngr armhf 2.2.40-1.1+b1 [750 kB] Get: 183 http://deb.debian.org/debian trixie/main armhf gnupg-l10n all 2.2.40-1.1 [1093 kB] Get: 184 http://deb.debian.org/debian trixie/main armhf gnupg-utils armhf 2.2.40-1.1+b1 [853 kB] Get: 185 http://deb.debian.org/debian trixie/main armhf gpg armhf 2.2.40-1.1+b1 [886 kB] Get: 186 http://deb.debian.org/debian trixie/main armhf pinentry-curses armhf 1.2.1-3 [73.8 kB] Get: 187 http://deb.debian.org/debian trixie/main armhf gpg-agent armhf 2.2.40-1.1+b1 [653 kB] Get: 188 http://deb.debian.org/debian trixie/main armhf gpg-wks-client armhf 2.2.40-1.1+b1 [525 kB] Get: 189 http://deb.debian.org/debian trixie/main armhf gpg-wks-server armhf 2.2.40-1.1+b1 [518 kB] Get: 190 http://deb.debian.org/debian trixie/main armhf gpgsm armhf 2.2.40-1.1+b1 [638 kB] Get: 191 http://deb.debian.org/debian trixie/main armhf gnupg all 2.2.40-1.1 [846 kB] Get: 192 http://deb.debian.org/debian trixie/main armhf libfile-dirlist-perl all 0.05-3 [7600 B] Get: 193 http://deb.debian.org/debian trixie/main armhf libfile-which-perl all 1.27-2 [15.1 kB] Get: 194 http://deb.debian.org/debian trixie/main armhf libfile-homedir-perl all 1.006-2 [42.4 kB] Get: 195 http://deb.debian.org/debian trixie/main armhf libfile-touch-perl all 0.12-2 [8816 B] Get: 196 http://deb.debian.org/debian trixie/main armhf libio-pty-perl armhf 1:1.20-1 [33.7 kB] Get: 197 http://deb.debian.org/debian trixie/main armhf libipc-run-perl all 20231003.0-1 [102 kB] Get: 198 http://deb.debian.org/debian trixie/main armhf libclass-method-modifiers-perl all 2.15-1 [18.0 kB] Get: 199 http://deb.debian.org/debian trixie/main armhf libclass-xsaccessor-perl armhf 1.19-4+b2 [35.3 kB] Get: 200 http://deb.debian.org/debian trixie/main armhf libb-hooks-op-check-perl armhf 0.22-2+b2 [10.3 kB] Get: 201 http://deb.debian.org/debian trixie/main armhf libdynaloader-functions-perl all 0.003-3 [12.7 kB] Get: 202 http://deb.debian.org/debian trixie/main armhf libdevel-callchecker-perl armhf 0.008-2+b1 [14.9 kB] Get: 203 http://deb.debian.org/debian trixie/main armhf libparams-classify-perl armhf 0.015-2+b2 [21.3 kB] Get: 204 http://deb.debian.org/debian trixie/main armhf libmodule-runtime-perl all 0.016-2 [19.6 kB] Get: 205 http://deb.debian.org/debian trixie/main armhf libimport-into-perl all 1.002005-2 [11.3 kB] Get: 206 http://deb.debian.org/debian trixie/main armhf librole-tiny-perl all 2.002004-1 [21.4 kB] Get: 207 http://deb.debian.org/debian trixie/main armhf libsub-quote-perl all 2.006008-1 [21.8 kB] Get: 208 http://deb.debian.org/debian trixie/main armhf libmoo-perl all 2.005005-1 [58.0 kB] Get: 209 http://deb.debian.org/debian trixie/main armhf libencode-locale-perl all 1.05-3 [12.9 kB] Get: 210 http://deb.debian.org/debian trixie/main armhf libtimedate-perl all 2.3300-2 [39.3 kB] Get: 211 http://deb.debian.org/debian trixie/main armhf libhttp-date-perl all 6.06-1 [10.7 kB] Get: 212 http://deb.debian.org/debian trixie/main armhf libfile-listing-perl all 6.16-1 [12.4 kB] Get: 213 http://deb.debian.org/debian trixie/main armhf libhtml-tagset-perl all 3.24-1 [14.7 kB] Get: 214 http://deb.debian.org/debian trixie/main armhf liburi-perl all 5.27-1 [98.4 kB] Get: 215 http://deb.debian.org/debian trixie/main armhf libhtml-parser-perl armhf 3.81-1+b1 [95.8 kB] Get: 216 http://deb.debian.org/debian trixie/main armhf libhtml-tree-perl all 5.07-3 [211 kB] Get: 217 http://deb.debian.org/debian trixie/main armhf libclone-perl armhf 0.46-1+b1 [13.2 kB] Get: 218 http://deb.debian.org/debian trixie/main armhf libio-html-perl all 1.004-3 [16.2 kB] Get: 219 http://deb.debian.org/debian trixie/main armhf liblwp-mediatypes-perl all 6.04-2 [20.2 kB] Get: 220 http://deb.debian.org/debian trixie/main armhf libhttp-message-perl all 6.45-1 [82.0 kB] Get: 221 http://deb.debian.org/debian trixie/main armhf libhttp-cookies-perl all 6.11-1 [19.1 kB] Get: 222 http://deb.debian.org/debian trixie/main armhf libhttp-negotiate-perl all 6.01-2 [13.1 kB] Get: 223 http://deb.debian.org/debian trixie/main armhf perl-openssl-defaults armhf 7+b1 [7916 B] Get: 224 http://deb.debian.org/debian trixie/main armhf libnet-ssleay-perl armhf 1.94-1 [318 kB] Get: 225 http://deb.debian.org/debian trixie/main armhf libio-socket-ssl-perl all 2.085-1 [218 kB] Get: 226 http://deb.debian.org/debian trixie/main armhf libnet-http-perl all 6.23-1 [23.9 kB] Get: 227 http://deb.debian.org/debian trixie/main armhf liblwp-protocol-https-perl all 6.14-1 [10.8 kB] Get: 228 http://deb.debian.org/debian trixie/main armhf libtry-tiny-perl all 0.31-2 [22.6 kB] Get: 229 http://deb.debian.org/debian trixie/main armhf libwww-robotrules-perl all 6.02-1 [12.9 kB] Get: 230 http://deb.debian.org/debian trixie/main armhf libwww-perl all 6.77-1 [183 kB] Get: 231 http://deb.debian.org/debian trixie/main armhf patchutils armhf 0.4.2-1 [72.5 kB] Get: 232 http://deb.debian.org/debian trixie/main armhf wdiff armhf 1.2.2-6 [118 kB] Get: 233 http://deb.debian.org/debian trixie/main armhf devscripts all 2.23.7 [1068 kB] Get: 234 http://deb.debian.org/debian trixie/main armhf fastjar armhf 2:0.98-7 [43.9 kB] Get: 235 http://deb.debian.org/debian trixie/main armhf ivy all 2.5.2-1 [1295 kB] Get: 236 http://deb.debian.org/debian trixie/main armhf libasm-java all 9.5-1 [387 kB] Get: 237 http://deb.debian.org/debian trixie/main armhf libbsf-java all 1:2.4.0-8 [76.3 kB] Get: 238 http://deb.debian.org/debian trixie/main armhf libcommons-cli-java all 1.6.0-1 [60.4 kB] Get: 239 http://deb.debian.org/debian trixie/main armhf libapache-pom-java all 29-2 [5276 B] Get: 240 http://deb.debian.org/debian trixie/main armhf libcommons-parent-java all 56-1 [10.8 kB] Get: 241 http://deb.debian.org/debian trixie/main armhf libcommons-logging-java all 1.3.0-1 [68.6 kB] Get: 242 http://deb.debian.org/debian trixie/main armhf libjansi-java all 2.4.1-2 [100 kB] Get: 243 http://deb.debian.org/debian trixie/main armhf libjsp-api-java all 2.3.4-3 [53.7 kB] Get: 244 http://deb.debian.org/debian trixie/main armhf libqdox-java all 1.12.1-3 [172 kB] Get: 245 http://deb.debian.org/debian trixie/main armhf libservlet-api-java all 4.0.1-2 [81.0 kB] Get: 246 http://deb.debian.org/debian trixie/main armhf libxpp3-java all 1.1.4c-3 [292 kB] Get: 247 http://deb.debian.org/debian trixie/main armhf libxstream-java all 1.4.20-1 [565 kB] Get: 248 http://deb.debian.org/debian trixie/main armhf groovy all 2.4.21-10 [12.8 MB] Get: 249 http://deb.debian.org/debian trixie/main armhf libatinject-jsr330-api-java all 1.0+ds1-5 [5312 B] Get: 250 http://deb.debian.org/debian trixie/main armhf libcommons-collections3-java all 3.2.2-3 [530 kB] Get: 251 http://deb.debian.org/debian trixie/main armhf libcommons-compress-java all 1.25.0-1 [635 kB] Get: 252 http://deb.debian.org/debian trixie/main armhf libcommons-io-java all 2.11.0-2 [319 kB] Get: 253 http://deb.debian.org/debian trixie/main armhf libcommons-lang-java all 2.6-10 [273 kB] Get: 254 http://deb.debian.org/debian trixie/main armhf liberror-prone-java all 2.18.0-1 [22.5 kB] Get: 255 http://deb.debian.org/debian trixie/main armhf libjsr305-java all 0.1~+svn49-11 [26.9 kB] Get: 256 http://deb.debian.org/debian trixie/main armhf libguava-java all 32.0.1-1 [2708 kB] Get: 257 http://deb.debian.org/debian trixie/main armhf libcommons-codec-java all 1.16.0-1 [297 kB] Get: 258 http://deb.debian.org/debian trixie/main armhf libhttpcore-java all 4.4.16-1 [636 kB] Get: 259 http://deb.debian.org/debian trixie/main armhf libhttpclient-java all 4.5.14-1 [1247 kB] Get: 260 http://deb.debian.org/debian trixie/main armhf libjarjar-java all 1.4+svn142-12 [205 kB] Get: 261 http://deb.debian.org/debian trixie/main armhf libjcip-annotations-java all 20060626-6 [11.8 kB] Get: 262 http://deb.debian.org/debian trixie/main armhf libjna-jni armhf 5.14.0-1 [60.1 kB] Get: 263 http://deb.debian.org/debian trixie/main armhf libjna-java all 5.14.0-1 [237 kB] Get: 264 http://deb.debian.org/debian trixie/main armhf libjzlib-java all 1.1.3-3 [79.4 kB] Get: 265 http://deb.debian.org/debian trixie/main armhf libjsch-java all 0.1.55-1 [298 kB] Get: 266 http://deb.debian.org/debian trixie/main armhf libminlog-java all 1.3.0-1.1 [7928 B] Get: 267 http://deb.debian.org/debian trixie/main armhf libobjenesis-java all 3.3-3 [41.3 kB] Get: 268 http://deb.debian.org/debian trixie/main armhf libreflectasm-java all 1.11.9+dfsg-4 [25.0 kB] Get: 269 http://deb.debian.org/debian trixie/main armhf libkryo-java all 2.20-7 [158 kB] Get: 270 http://deb.debian.org/debian trixie/main armhf liblogback-java all 1:1.2.11-5 [701 kB] Get: 271 http://deb.debian.org/debian trixie/main armhf libnative-platform-jni armhf 0.14-6 [10.2 kB] Get: 272 http://deb.debian.org/debian trixie/main armhf libnative-platform-java all 0.14-6 [69.8 kB] Get: 273 http://deb.debian.org/debian trixie/main armhf libxml-commons-external-java all 1.4.01-6 [240 kB] Get: 274 http://deb.debian.org/debian trixie/main armhf libxml-commons-resolver1.1-java all 1.2-11 [98.3 kB] Get: 275 http://deb.debian.org/debian trixie/main armhf libxerces2-java all 2.12.2-1 [1440 kB] Get: 276 http://deb.debian.org/debian trixie/main armhf libnekohtml-java all 1.9.22.noko2-0.1 [125 kB] Get: 277 http://deb.debian.org/debian trixie/main armhf libxbean-reflect-java all 4.5-8 [133 kB] Get: 278 http://deb.debian.org/debian trixie/main armhf libgradle-core-java all 4.4.1-20 [4293 kB] Get: 279 http://deb.debian.org/debian trixie/main armhf libbcprov-java all 1.77-1 [5300 kB] Get: 280 http://deb.debian.org/debian trixie/main armhf libbcpg-java all 1.77-1 [428 kB] Get: 281 http://deb.debian.org/debian trixie/main armhf libbsh-java all 2.0b4-20 [291 kB] Get: 282 http://deb.debian.org/debian trixie/main armhf libdd-plist-java all 1.20-1.1 [72.6 kB] Get: 283 http://deb.debian.org/debian trixie/main armhf libjaxen-java all 1.1.6-4 [214 kB] Get: 284 http://deb.debian.org/debian trixie/main armhf libdom4j-java all 2.1.4-1 [312 kB] Get: 285 http://deb.debian.org/debian trixie/main armhf libbcel-java all 6.5.0-2 [634 kB] Get: 286 http://deb.debian.org/debian trixie/main armhf libjformatstring-java all 0.10~20131207-2.1 [34.5 kB] Get: 287 http://deb.debian.org/debian trixie/main armhf libfindbugs-java all 3.1.0~preview2-3 [3502 kB] Get: 288 http://deb.debian.org/debian trixie/main armhf libgoogle-gson-java all 2.10.1-1 [262 kB] Get: 289 http://deb.debian.org/debian trixie/main armhf libaopalliance-java all 20070526-7 [8572 B] Get: 290 http://deb.debian.org/debian trixie/main armhf libguice-java all 4.2.3-2 [1435 kB] Get: 291 http://deb.debian.org/debian trixie/main armhf libjatl-java all 0.2.3-1.1 [29.0 kB] Get: 292 http://deb.debian.org/debian trixie/main armhf libjcifs-java all 1.3.19-2 [394 kB] Get: 293 http://deb.debian.org/debian trixie/main armhf libeclipse-jdt-annotation-java all 2.2.700+eclipse4.26-2 [25.3 kB] Get: 294 http://deb.debian.org/debian trixie/main armhf libjavaewah-java all 1.2.3-1 [159 kB] Get: 295 http://deb.debian.org/debian trixie/main armhf libel-api-java all 3.0.0-3 [64.9 kB] Get: 296 http://deb.debian.org/debian trixie/main armhf libwebsocket-api-java all 1.1-2 [40.1 kB] Get: 297 http://deb.debian.org/debian trixie/main armhf libjetty9-java all 9.4.53-1 [2982 kB] Get: 298 http://deb.debian.org/debian trixie/main armhf libjgit-java all 4.11.9-2 [2534 kB] Get: 299 http://deb.debian.org/debian trixie/main armhf libjs-jquery all 3.6.1+dfsg+~3.5.14-1 [326 kB] Get: 300 http://deb.debian.org/debian trixie/main armhf libcommons-lang3-java all 3.14.0-1 [621 kB] Get: 301 http://deb.debian.org/debian trixie/main armhf libplexus-utils2-java all 3.4.2-1 [258 kB] Get: 302 http://deb.debian.org/debian trixie/main armhf libwagon-provider-api-java all 3.5.3-1 [48.2 kB] Get: 303 http://deb.debian.org/debian trixie/main armhf libmaven-resolver-java all 1.6.3-1 [548 kB] Get: 304 http://deb.debian.org/debian trixie/main armhf libgeronimo-annotation-1.3-spec-java all 1.3-1 [11.1 kB] Get: 305 http://deb.debian.org/debian trixie/main armhf libmaven-parent-java all 35-1 [6140 B] Get: 306 http://deb.debian.org/debian trixie/main armhf libmaven-shared-utils-java all 3.3.4-1 [138 kB] Get: 307 http://deb.debian.org/debian trixie/main armhf libplexus-cipher-java all 2.0-1 [14.9 kB] Get: 308 http://deb.debian.org/debian trixie/main armhf libplexus-classworlds-java all 2.7.0-1 [50.6 kB] Get: 309 http://deb.debian.org/debian trixie/main armhf libplexus-component-annotations-java all 2.1.1-1 [7660 B] Get: 310 http://deb.debian.org/debian trixie/main armhf libplexus-interpolation-java all 1.26-1 [76.8 kB] Get: 311 http://deb.debian.org/debian trixie/main armhf libplexus-sec-dispatcher-java all 2.0-3 [28.3 kB] Get: 312 http://deb.debian.org/debian trixie/main armhf libgeronimo-interceptor-3.0-spec-java all 1.0.1-4 [8484 B] Get: 313 http://deb.debian.org/debian trixie/main armhf libcdi-api-java all 1.2-3 [54.3 kB] Get: 314 http://deb.debian.org/debian trixie/main armhf libsisu-inject-java all 0.3.4-2 [347 kB] Get: 315 http://deb.debian.org/debian trixie/main armhf libsisu-plexus-java all 0.3.4-3 [181 kB] Get: 316 http://deb.debian.org/debian trixie/main armhf libmaven3-core-java all 3.8.7-2 [1573 kB] Get: 317 http://deb.debian.org/debian trixie/main armhf libplexus-container-default-java all 2.1.1-1 [193 kB] Get: 318 http://deb.debian.org/debian trixie/main armhf libpolyglot-maven-java all 0.8~tobrien+git20120905-10 [74.9 kB] Get: 319 http://deb.debian.org/debian trixie/main armhf librhino-java all 1.7.14-2.1 [1357 kB] Get: 320 http://deb.debian.org/debian trixie/main armhf libsimple-http-java all 4.1.21-1.1 [211 kB] Get: 321 http://deb.debian.org/debian trixie/main armhf libwagon-file-java all 3.5.3-1 [8388 B] Get: 322 http://deb.debian.org/debian trixie/main armhf libjsoup-java all 1.15.3-1 [431 kB] Get: 323 http://deb.debian.org/debian trixie/main armhf libwagon-http-java all 3.5.3-1 [49.5 kB] Get: 324 http://deb.debian.org/debian trixie/main armhf libjcommander-java all 1.71-4 [73.0 kB] Get: 325 http://deb.debian.org/debian trixie/main armhf testng all 6.9.12-4 [795 kB] Get: 326 http://deb.debian.org/debian trixie/main armhf libgradle-plugins-java all 4.4.1-20 [5206 kB] Get: 327 http://deb.debian.org/debian trixie/main armhf gradle all 4.4.1-20 [398 kB] Get: 328 http://deb.debian.org/debian trixie/main armhf maven-repo-helper all 1.11 [142 kB] Get: 329 http://deb.debian.org/debian trixie/main armhf gradle-debian-helper all 2.4 [24.5 kB] Get: 330 http://deb.debian.org/debian trixie/main armhf jarwrapper all 0.79 [10.1 kB] Get: 331 http://deb.debian.org/debian trixie/main armhf javahelper all 0.79 [84.6 kB] Get: 332 http://deb.debian.org/debian trixie/main armhf libbyte-buddy-java all 1.12.23-1 [4471 kB] Get: 333 http://deb.debian.org/debian trixie/main armhf libcommons-math3-java all 3.6.1-3 [2018 kB] Get: 334 http://deb.debian.org/debian trixie/main armhf libjackson2-annotations-java all 2.14.0-1 [68.8 kB] Get: 335 http://deb.debian.org/debian trixie/main armhf libjackson2-core-java all 2.14.1-1 [447 kB] Get: 336 http://deb.debian.org/debian trixie/main armhf libjackson2-databind-java all 2.14.0-1 [1584 kB] Get: 337 http://deb.debian.org/debian trixie/main armhf liblz4-jni armhf 1.8.0-4 [9672 B] Get: 338 http://deb.debian.org/debian trixie/main armhf liblz4-java all 1.8.0-4 [116 kB] Get: 339 http://deb.debian.org/debian trixie/main armhf libmockito-java all 2.23.0-2 [479 kB] Get: 340 http://deb.debian.org/debian trixie/main armhf libredberry-pipe-java all 1.0.0~alpha0-3 [62.7 kB] Get: 341 http://deb.debian.org/debian trixie/main armhf libtrove3-java all 3.0.3-5 [2146 kB] Fetched 291 MB in 7s (42.5 MB/s) debconf: delaying package configuration, since apt-utils is not installed Selecting previously unselected package libpipeline1:armhf. (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 19577 files and directories currently installed.) Preparing to unpack .../libpipeline1_1.5.7-1+b2_armhf.deb ... Unpacking libpipeline1:armhf (1.5.7-1+b2) ... Selecting previously unselected package binfmt-support. Preparing to unpack .../binfmt-support_2.2.2-6_armhf.deb ... Unpacking binfmt-support (2.2.2-6) ... Selecting previously unselected package libpython3.11-minimal:armhf. Preparing to unpack .../libpython3.11-minimal_3.11.8-1_armhf.deb ... Unpacking libpython3.11-minimal:armhf (3.11.8-1) ... Selecting previously unselected package libexpat1:armhf. Preparing to unpack .../libexpat1_2.5.0-2+b2_armhf.deb ... Unpacking libexpat1:armhf (2.5.0-2+b2) ... Selecting previously unselected package python3.11-minimal. Preparing to unpack .../python3.11-minimal_3.11.8-1_armhf.deb ... Unpacking python3.11-minimal (3.11.8-1) ... Setting up libpython3.11-minimal:armhf (3.11.8-1) ... Setting up libexpat1:armhf (2.5.0-2+b2) ... Setting up python3.11-minimal (3.11.8-1) ... Selecting previously unselected package python3-minimal. (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 19918 files and directories currently installed.) Preparing to unpack .../0-python3-minimal_3.11.6-1_armhf.deb ... Unpacking python3-minimal (3.11.6-1) ... Selecting previously unselected package media-types. Preparing to unpack .../1-media-types_10.1.0_all.deb ... Unpacking media-types (10.1.0) ... Selecting previously unselected package netbase. Preparing to unpack .../2-netbase_6.4_all.deb ... Unpacking netbase (6.4) ... Selecting previously unselected package tzdata. Preparing to unpack .../3-tzdata_2024a-1_all.deb ... Unpacking tzdata (2024a-1) ... Selecting previously unselected package readline-common. Preparing to unpack .../4-readline-common_8.2-3_all.deb ... Unpacking readline-common (8.2-3) ... Selecting previously unselected package libreadline8:armhf. Preparing to unpack .../5-libreadline8_8.2-3+b1_armhf.deb ... Unpacking libreadline8:armhf (8.2-3+b1) ... Selecting previously unselected package libpython3.11-stdlib:armhf. Preparing to unpack .../6-libpython3.11-stdlib_3.11.8-1_armhf.deb ... Unpacking libpython3.11-stdlib:armhf (3.11.8-1) ... Selecting previously unselected package python3.11. Preparing to unpack .../7-python3.11_3.11.8-1_armhf.deb ... Unpacking python3.11 (3.11.8-1) ... Selecting previously unselected package libpython3-stdlib:armhf. Preparing to unpack .../8-libpython3-stdlib_3.11.6-1_armhf.deb ... Unpacking libpython3-stdlib:armhf (3.11.6-1) ... Setting up python3-minimal (3.11.6-1) ... Selecting previously unselected package python3. (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 20906 files and directories currently installed.) Preparing to unpack .../000-python3_3.11.6-1_armhf.deb ... Unpacking python3 (3.11.6-1) ... Selecting previously unselected package sensible-utils. Preparing to unpack .../001-sensible-utils_0.0.22_all.deb ... Unpacking sensible-utils (0.0.22) ... Selecting previously unselected package openssl. Preparing to unpack .../002-openssl_3.1.5-1_armhf.deb ... Unpacking openssl (3.1.5-1) ... Selecting previously unselected package ca-certificates. Preparing to unpack .../003-ca-certificates_20240203_all.deb ... Unpacking ca-certificates (20240203) ... Selecting previously unselected package libmagic-mgc. Preparing to unpack .../004-libmagic-mgc_1%3a5.45-2+b1_armhf.deb ... Unpacking libmagic-mgc (1:5.45-2+b1) ... Selecting previously unselected package libmagic1:armhf. Preparing to unpack .../005-libmagic1_1%3a5.45-2+b1_armhf.deb ... Unpacking libmagic1:armhf (1:5.45-2+b1) ... Selecting previously unselected package file. Preparing to unpack .../006-file_1%3a5.45-2+b1_armhf.deb ... Unpacking file (1:5.45-2+b1) ... Selecting previously unselected package gettext-base. Preparing to unpack .../007-gettext-base_0.21-14+b1_armhf.deb ... Unpacking gettext-base (0.21-14+b1) ... Selecting previously unselected package libuchardet0:armhf. Preparing to unpack .../008-libuchardet0_0.0.8-1+b1_armhf.deb ... Unpacking libuchardet0:armhf (0.0.8-1+b1) ... Selecting previously unselected package groff-base. Preparing to unpack .../009-groff-base_1.23.0-3_armhf.deb ... Unpacking groff-base (1.23.0-3) ... Selecting previously unselected package bsdextrautils. Preparing to unpack .../010-bsdextrautils_2.39.3-6_armhf.deb ... Unpacking bsdextrautils (2.39.3-6) ... Selecting previously unselected package man-db. Preparing to unpack .../011-man-db_2.12.0-3_armhf.deb ... Unpacking man-db (2.12.0-3) ... Selecting previously unselected package libgdk-pixbuf2.0-common. Preparing to unpack .../012-libgdk-pixbuf2.0-common_2.42.10+dfsg-3_all.deb ... Unpacking libgdk-pixbuf2.0-common (2.42.10+dfsg-3) ... Selecting previously unselected package libglib2.0-0:armhf. Preparing to unpack .../013-libglib2.0-0_2.78.4-1_armhf.deb ... Unpacking libglib2.0-0:armhf (2.78.4-1) ... Selecting previously unselected package libicu72:armhf. Preparing to unpack .../014-libicu72_72.1-4+b1_armhf.deb ... Unpacking libicu72:armhf (72.1-4+b1) ... Selecting previously unselected package libxml2:armhf. Preparing to unpack .../015-libxml2_2.9.14+dfsg-1.3+b2_armhf.deb ... Unpacking libxml2:armhf (2.9.14+dfsg-1.3+b2) ... Selecting previously unselected package shared-mime-info. Preparing to unpack .../016-shared-mime-info_2.4-1_armhf.deb ... Unpacking shared-mime-info (2.4-1) ... Selecting previously unselected package libjpeg62-turbo:armhf. Preparing to unpack .../017-libjpeg62-turbo_1%3a2.1.5-2+b2_armhf.deb ... Unpacking libjpeg62-turbo:armhf (1:2.1.5-2+b2) ... Selecting previously unselected package libpng16-16:armhf. Preparing to unpack .../018-libpng16-16_1.6.43-1_armhf.deb ... Unpacking libpng16-16:armhf (1.6.43-1) ... Selecting previously unselected package libdeflate0:armhf. Preparing to unpack .../019-libdeflate0_1.19-1_armhf.deb ... Unpacking libdeflate0:armhf (1.19-1) ... Selecting previously unselected package libjbig0:armhf. Preparing to unpack .../020-libjbig0_2.1-6.1+b1_armhf.deb ... Unpacking libjbig0:armhf (2.1-6.1+b1) ... Selecting previously unselected package liblerc4:armhf. Preparing to unpack .../021-liblerc4_4.0.0+ds-4+b1_armhf.deb ... Unpacking liblerc4:armhf (4.0.0+ds-4+b1) ... Selecting previously unselected package libsharpyuv0:armhf. Preparing to unpack .../022-libsharpyuv0_1.3.2-0.4_armhf.deb ... Unpacking libsharpyuv0:armhf (1.3.2-0.4) ... Selecting previously unselected package libwebp7:armhf. Preparing to unpack .../023-libwebp7_1.3.2-0.4_armhf.deb ... Unpacking libwebp7:armhf (1.3.2-0.4) ... Selecting previously unselected package libtiff6:armhf. Preparing to unpack .../024-libtiff6_4.5.1+git230720-4_armhf.deb ... Unpacking libtiff6:armhf (4.5.1+git230720-4) ... Selecting previously unselected package libgdk-pixbuf-2.0-0:armhf. Preparing to unpack .../025-libgdk-pixbuf-2.0-0_2.42.10+dfsg-3+b1_armhf.deb ... Unpacking libgdk-pixbuf-2.0-0:armhf (2.42.10+dfsg-3+b1) ... Selecting previously unselected package gtk-update-icon-cache. Preparing to unpack .../026-gtk-update-icon-cache_3.24.41-1_armhf.deb ... Unpacking gtk-update-icon-cache (3.24.41-1) ... Selecting previously unselected package hicolor-icon-theme. Preparing to unpack .../027-hicolor-icon-theme_0.17-2_all.deb ... Unpacking hicolor-icon-theme (0.17-2) ... Selecting previously unselected package adwaita-icon-theme. Preparing to unpack .../028-adwaita-icon-theme_46.0-1_all.deb ... Unpacking adwaita-icon-theme (46.0-1) ... Selecting previously unselected package ca-certificates-java. Preparing to unpack .../029-ca-certificates-java_20240118_all.deb ... Unpacking ca-certificates-java (20240118) ... Selecting previously unselected package java-common. Preparing to unpack .../030-java-common_0.75_all.deb ... Unpacking java-common (0.75) ... Selecting previously unselected package libavahi-common-data:armhf. Preparing to unpack .../031-libavahi-common-data_0.8-13+b1_armhf.deb ... Unpacking libavahi-common-data:armhf (0.8-13+b1) ... Selecting previously unselected package libavahi-common3:armhf. Preparing to unpack .../032-libavahi-common3_0.8-13+b1_armhf.deb ... Unpacking libavahi-common3:armhf (0.8-13+b1) ... Selecting previously unselected package libdbus-1-3:armhf. Preparing to unpack .../033-libdbus-1-3_1.14.10-4_armhf.deb ... Unpacking libdbus-1-3:armhf (1.14.10-4) ... Selecting previously unselected package libavahi-client3:armhf. Preparing to unpack .../034-libavahi-client3_0.8-13+b1_armhf.deb ... Unpacking libavahi-client3:armhf (0.8-13+b1) ... Selecting previously unselected package libcups2:armhf. Preparing to unpack .../035-libcups2_2.4.7-1+b1_armhf.deb ... Unpacking libcups2:armhf (2.4.7-1+b1) ... Selecting previously unselected package liblcms2-2:armhf. Preparing to unpack .../036-liblcms2-2_2.14-2+b1_armhf.deb ... Unpacking liblcms2-2:armhf (2.14-2+b1) ... Selecting previously unselected package libbrotli1:armhf. Preparing to unpack .../037-libbrotli1_1.1.0-2+b3_armhf.deb ... Unpacking libbrotli1:armhf (1.1.0-2+b3) ... Selecting previously unselected package libfreetype6:armhf. Preparing to unpack .../038-libfreetype6_2.13.2+dfsg-1+b1_armhf.deb ... Unpacking libfreetype6:armhf (2.13.2+dfsg-1+b1) ... Selecting previously unselected package fonts-dejavu-mono. Preparing to unpack .../039-fonts-dejavu-mono_2.37-8_all.deb ... Unpacking fonts-dejavu-mono (2.37-8) ... Selecting previously unselected package fonts-dejavu-core. Preparing to unpack .../040-fonts-dejavu-core_2.37-8_all.deb ... Unpacking fonts-dejavu-core (2.37-8) ... Selecting previously unselected package fontconfig-config. Preparing to unpack .../041-fontconfig-config_2.15.0-1.1_armhf.deb ... Unpacking fontconfig-config (2.15.0-1.1) ... Selecting previously unselected package libfontconfig1:armhf. Preparing to unpack .../042-libfontconfig1_2.15.0-1.1_armhf.deb ... Unpacking libfontconfig1:armhf (2.15.0-1.1) ... Selecting previously unselected package libnspr4:armhf. Preparing to unpack .../043-libnspr4_2%3a4.35-1.1+b1_armhf.deb ... Unpacking libnspr4:armhf (2:4.35-1.1+b1) ... Selecting previously unselected package libnss3:armhf. Preparing to unpack .../044-libnss3_2%3a3.99-1_armhf.deb ... Unpacking libnss3:armhf (2:3.99-1) ... Selecting previously unselected package libasound2-data. Preparing to unpack .../045-libasound2-data_1.2.10-3_all.deb ... Unpacking libasound2-data (1.2.10-3) ... Selecting previously unselected package libasound2:armhf. Preparing to unpack .../046-libasound2_1.2.10-3_armhf.deb ... Unpacking libasound2:armhf (1.2.10-3) ... Selecting previously unselected package libgraphite2-3:armhf. Preparing to unpack .../047-libgraphite2-3_1.3.14-2_armhf.deb ... Unpacking libgraphite2-3:armhf (1.3.14-2) ... Selecting previously unselected package libharfbuzz0b:armhf. Preparing to unpack .../048-libharfbuzz0b_8.3.0-2_armhf.deb ... Unpacking libharfbuzz0b:armhf (8.3.0-2) ... Selecting previously unselected package libpcsclite1:armhf. Preparing to unpack .../049-libpcsclite1_2.0.1-1+b1_armhf.deb ... Unpacking libpcsclite1:armhf (2.0.1-1+b1) ... Selecting previously unselected package openjdk-17-jre-headless:armhf. Preparing to unpack .../050-openjdk-17-jre-headless_17.0.10+7-1_armhf.deb ... Unpacking openjdk-17-jre-headless:armhf (17.0.10+7-1) ... Selecting previously unselected package default-jre-headless. Preparing to unpack .../051-default-jre-headless_2%3a1.17-75_armhf.deb ... Unpacking default-jre-headless (2:1.17-75) ... Selecting previously unselected package ant. Preparing to unpack .../052-ant_1.10.14-1_all.deb ... Unpacking ant (1.10.14-1) ... Selecting previously unselected package ant-optional. Preparing to unpack .../053-ant-optional_1.10.14-1_all.deb ... Unpacking ant-optional (1.10.14-1) ... Selecting previously unselected package libantlr-java. Preparing to unpack .../054-libantlr-java_2.7.7+dfsg-13_all.deb ... Unpacking libantlr-java (2.7.7+dfsg-13) ... Selecting previously unselected package antlr. Preparing to unpack .../055-antlr_2.7.7+dfsg-13_all.deb ... Unpacking antlr (2.7.7+dfsg-13) ... Selecting previously unselected package at-spi2-common. Preparing to unpack .../056-at-spi2-common_2.50.0-1_all.deb ... Unpacking at-spi2-common (2.50.0-1) ... Selecting previously unselected package m4. Preparing to unpack .../057-m4_1.4.19-4_armhf.deb ... Unpacking m4 (1.4.19-4) ... Selecting previously unselected package autoconf. Preparing to unpack .../058-autoconf_2.71-3_all.deb ... Unpacking autoconf (2.71-3) ... Selecting previously unselected package autotools-dev. Preparing to unpack .../059-autotools-dev_20220109.1_all.deb ... Unpacking autotools-dev (20220109.1) ... Selecting previously unselected package automake. Preparing to unpack .../060-automake_1%3a1.16.5-1.3_all.deb ... Unpacking automake (1:1.16.5-1.3) ... Selecting previously unselected package autopoint. Preparing to unpack .../061-autopoint_0.21-14_all.deb ... Unpacking autopoint (0.21-14) ... Selecting previously unselected package unzip. Preparing to unpack .../062-unzip_6.0-28_armhf.deb ... Unpacking unzip (6.0-28) ... Selecting previously unselected package java-wrappers. Preparing to unpack .../063-java-wrappers_0.4_all.deb ... Unpacking java-wrappers (0.4) ... Selecting previously unselected package libhamcrest-java. Preparing to unpack .../064-libhamcrest-java_2.2-2_all.deb ... Unpacking libhamcrest-java (2.2-2) ... Selecting previously unselected package junit4. Preparing to unpack .../065-junit4_4.13.2-4_all.deb ... Unpacking junit4 (4.13.2-4) ... Selecting previously unselected package libfelix-framework-java. Preparing to unpack .../066-libfelix-framework-java_4.6.1-2.1_all.deb ... Unpacking libfelix-framework-java (4.6.1-2.1) ... Selecting previously unselected package libfelix-gogo-runtime-java. Preparing to unpack .../067-libfelix-gogo-runtime-java_0.16.2-1.1_all.deb ... Unpacking libfelix-gogo-runtime-java (0.16.2-1.1) ... Selecting previously unselected package libosgi-annotation-java. Preparing to unpack .../068-libosgi-annotation-java_8.1.0-1_all.deb ... Unpacking libosgi-annotation-java (8.1.0-1) ... Selecting previously unselected package libosgi-core-java. Preparing to unpack .../069-libosgi-core-java_8.0.0-2_all.deb ... Unpacking libosgi-core-java (8.0.0-2) ... Selecting previously unselected package libfelix-resolver-java. Preparing to unpack .../070-libfelix-resolver-java_1.16.0-1_all.deb ... Unpacking libfelix-resolver-java (1.16.0-1) ... Selecting previously unselected package libhawtjni-runtime-java. Preparing to unpack .../071-libhawtjni-runtime-java_1.18-1_all.deb ... Unpacking libhawtjni-runtime-java (1.18-1) ... Selecting previously unselected package libjansi-native-java. Preparing to unpack .../072-libjansi-native-java_1.8-2_all.deb ... Unpacking libjansi-native-java (1.8-2) ... Selecting previously unselected package libjansi1-java. Preparing to unpack .../073-libjansi1-java_1.18-3_all.deb ... Unpacking libjansi1-java (1.18-3) ... Selecting previously unselected package libjline2-java. Preparing to unpack .../074-libjline2-java_2.14.6-5_all.deb ... Unpacking libjline2-java (2.14.6-5) ... Selecting previously unselected package libosgi-compendium-java. Preparing to unpack .../075-libosgi-compendium-java_7.0.0-1_all.deb ... Unpacking libosgi-compendium-java (7.0.0-1) ... Selecting previously unselected package libslf4j-java. Preparing to unpack .../076-libslf4j-java_1.7.32-1_all.deb ... Unpacking libslf4j-java (1.7.32-1) ... Selecting previously unselected package libxz-java. Preparing to unpack .../077-libxz-java_1.9-1_all.deb ... Unpacking libxz-java (1.9-1) ... Selecting previously unselected package libyaml-snake-java. Preparing to unpack .../078-libyaml-snake-java_1.33-2_all.deb ... Unpacking libyaml-snake-java (1.33-2) ... Selecting previously unselected package bnd. Preparing to unpack .../079-bnd_5.0.1-5_all.deb ... Unpacking bnd (5.0.1-5) ... Selecting previously unselected package dctrl-tools. Preparing to unpack .../080-dctrl-tools_2.24-3_armhf.deb ... Unpacking dctrl-tools (2.24-3) ... Selecting previously unselected package libdebhelper-perl. Preparing to unpack .../081-libdebhelper-perl_13.14.1_all.deb ... Unpacking libdebhelper-perl (13.14.1) ... Selecting previously unselected package libtool. Preparing to unpack .../082-libtool_2.4.7-7_all.deb ... Unpacking libtool (2.4.7-7) ... Selecting previously unselected package dh-autoreconf. Preparing to unpack .../083-dh-autoreconf_20_all.deb ... Unpacking dh-autoreconf (20) ... Selecting previously unselected package libarchive-zip-perl. Preparing to unpack .../084-libarchive-zip-perl_1.68-1_all.deb ... Unpacking libarchive-zip-perl (1.68-1) ... Selecting previously unselected package libsub-override-perl. Preparing to unpack .../085-libsub-override-perl_0.10-1_all.deb ... Unpacking libsub-override-perl (0.10-1) ... Selecting previously unselected package libfile-stripnondeterminism-perl. Preparing to unpack .../086-libfile-stripnondeterminism-perl_1.13.1-1_all.deb ... Unpacking libfile-stripnondeterminism-perl (1.13.1-1) ... Selecting previously unselected package dh-strip-nondeterminism. Preparing to unpack .../087-dh-strip-nondeterminism_1.13.1-1_all.deb ... Unpacking dh-strip-nondeterminism (1.13.1-1) ... Selecting previously unselected package libelf1:armhf. Preparing to unpack .../088-libelf1_0.190-1+b1_armhf.deb ... Unpacking libelf1:armhf (0.190-1+b1) ... Selecting previously unselected package dwz. Preparing to unpack .../089-dwz_0.15-1_armhf.deb ... Unpacking dwz (0.15-1) ... Selecting previously unselected package gettext. Preparing to unpack .../090-gettext_0.21-14+b1_armhf.deb ... Unpacking gettext (0.21-14+b1) ... Selecting previously unselected package intltool-debian. Preparing to unpack .../091-intltool-debian_0.35.0+20060710.6_all.deb ... Unpacking intltool-debian (0.35.0+20060710.6) ... Selecting previously unselected package po-debconf. Preparing to unpack .../092-po-debconf_1.0.21+nmu1_all.deb ... Unpacking po-debconf (1.0.21+nmu1) ... Selecting previously unselected package debhelper. Preparing to unpack .../093-debhelper_13.14.1_all.deb ... Unpacking debhelper (13.14.1) ... Selecting previously unselected package libgtk2.0-common. Preparing to unpack .../094-libgtk2.0-common_2.24.33-3_all.deb ... Unpacking libgtk2.0-common (2.24.33-3) ... Selecting previously unselected package libatk1.0-0:armhf. Preparing to unpack .../095-libatk1.0-0_2.50.0-1+b1_armhf.deb ... Unpacking libatk1.0-0:armhf (2.50.0-1+b1) ... Selecting previously unselected package libpixman-1-0:armhf. Preparing to unpack .../096-libpixman-1-0_0.42.2-1+b1_armhf.deb ... Unpacking libpixman-1-0:armhf (0.42.2-1+b1) ... Selecting previously unselected package libxau6:armhf. Preparing to unpack .../097-libxau6_1%3a1.0.9-1_armhf.deb ... Unpacking libxau6:armhf (1:1.0.9-1) ... Selecting previously unselected package libbsd0:armhf. Preparing to unpack .../098-libbsd0_0.12.2-1_armhf.deb ... Unpacking libbsd0:armhf (0.12.2-1) ... Selecting previously unselected package libxdmcp6:armhf. Preparing to unpack .../099-libxdmcp6_1%3a1.1.2-3_armhf.deb ... Unpacking libxdmcp6:armhf (1:1.1.2-3) ... Selecting previously unselected package libxcb1:armhf. Preparing to unpack .../100-libxcb1_1.15-1_armhf.deb ... Unpacking libxcb1:armhf (1.15-1) ... Selecting previously unselected package libx11-data. Preparing to unpack .../101-libx11-data_2%3a1.8.7-1_all.deb ... Unpacking libx11-data (2:1.8.7-1) ... Selecting previously unselected package libx11-6:armhf. Preparing to unpack .../102-libx11-6_2%3a1.8.7-1_armhf.deb ... Unpacking libx11-6:armhf (2:1.8.7-1) ... Selecting previously unselected package libxcb-render0:armhf. Preparing to unpack .../103-libxcb-render0_1.15-1_armhf.deb ... Unpacking libxcb-render0:armhf (1.15-1) ... Selecting previously unselected package libxcb-shm0:armhf. Preparing to unpack .../104-libxcb-shm0_1.15-1_armhf.deb ... Unpacking libxcb-shm0:armhf (1.15-1) ... Selecting previously unselected package libxext6:armhf. Preparing to unpack .../105-libxext6_2%3a1.3.4-1+b1_armhf.deb ... Unpacking libxext6:armhf (2:1.3.4-1+b1) ... Selecting previously unselected package libxrender1:armhf. Preparing to unpack .../106-libxrender1_1%3a0.9.10-1.1_armhf.deb ... Unpacking libxrender1:armhf (1:0.9.10-1.1) ... Selecting previously unselected package libcairo2:armhf. Preparing to unpack .../107-libcairo2_1.18.0-1+b1_armhf.deb ... Unpacking libcairo2:armhf (1.18.0-1+b1) ... Selecting previously unselected package fontconfig. Preparing to unpack .../108-fontconfig_2.15.0-1.1_armhf.deb ... Unpacking fontconfig (2.15.0-1.1) ... Selecting previously unselected package libfribidi0:armhf. Preparing to unpack .../109-libfribidi0_1.0.13-3+b1_armhf.deb ... Unpacking libfribidi0:armhf (1.0.13-3+b1) ... Selecting previously unselected package libthai-data. Preparing to unpack .../110-libthai-data_0.1.29-2_all.deb ... Unpacking libthai-data (0.1.29-2) ... Selecting previously unselected package libdatrie1:armhf. Preparing to unpack .../111-libdatrie1_0.2.13-3_armhf.deb ... Unpacking libdatrie1:armhf (0.2.13-3) ... Selecting previously unselected package libthai0:armhf. Preparing to unpack .../112-libthai0_0.1.29-2_armhf.deb ... Unpacking libthai0:armhf (0.1.29-2) ... Selecting previously unselected package libpango-1.0-0:armhf. Preparing to unpack .../113-libpango-1.0-0_1.52.0+ds-1_armhf.deb ... Unpacking libpango-1.0-0:armhf (1.52.0+ds-1) ... Selecting previously unselected package libpangoft2-1.0-0:armhf. Preparing to unpack .../114-libpangoft2-1.0-0_1.52.0+ds-1_armhf.deb ... Unpacking libpangoft2-1.0-0:armhf (1.52.0+ds-1) ... Selecting previously unselected package libpangocairo-1.0-0:armhf. Preparing to unpack .../115-libpangocairo-1.0-0_1.52.0+ds-1_armhf.deb ... Unpacking libpangocairo-1.0-0:armhf (1.52.0+ds-1) ... Selecting previously unselected package libxcomposite1:armhf. Preparing to unpack .../116-libxcomposite1_1%3a0.4.5-1_armhf.deb ... Unpacking libxcomposite1:armhf (1:0.4.5-1) ... Selecting previously unselected package libxfixes3:armhf. Preparing to unpack .../117-libxfixes3_1%3a6.0.0-2_armhf.deb ... Unpacking libxfixes3:armhf (1:6.0.0-2) ... Selecting previously unselected package libxcursor1:armhf. Preparing to unpack .../118-libxcursor1_1%3a1.2.1-1_armhf.deb ... Unpacking libxcursor1:armhf (1:1.2.1-1) ... Selecting previously unselected package libxdamage1:armhf. Preparing to unpack .../119-libxdamage1_1%3a1.1.6-1_armhf.deb ... Unpacking libxdamage1:armhf (1:1.1.6-1) ... Selecting previously unselected package libxi6:armhf. Preparing to unpack .../120-libxi6_2%3a1.8.1-1_armhf.deb ... Unpacking libxi6:armhf (2:1.8.1-1) ... Selecting previously unselected package libxinerama1:armhf. Preparing to unpack .../121-libxinerama1_2%3a1.1.4-3_armhf.deb ... Unpacking libxinerama1:armhf (2:1.1.4-3) ... Selecting previously unselected package libxrandr2:armhf. Preparing to unpack .../122-libxrandr2_2%3a1.5.4-1_armhf.deb ... Unpacking libxrandr2:armhf (2:1.5.4-1) ... Selecting previously unselected package libgtk2.0-0:armhf. Preparing to unpack .../123-libgtk2.0-0_2.24.33-3_armhf.deb ... Unpacking libgtk2.0-0:armhf (2.24.33-3) ... Selecting previously unselected package libglvnd0:armhf. Preparing to unpack .../124-libglvnd0_1.7.0-1_armhf.deb ... Unpacking libglvnd0:armhf (1.7.0-1) ... Selecting previously unselected package libdrm-common. Preparing to unpack .../125-libdrm-common_2.4.120-2_all.deb ... Unpacking libdrm-common (2.4.120-2) ... Selecting previously unselected package libdrm2:armhf. Preparing to unpack .../126-libdrm2_2.4.120-2_armhf.deb ... Unpacking libdrm2:armhf (2.4.120-2) ... Selecting previously unselected package libglapi-mesa:armhf. Preparing to unpack .../127-libglapi-mesa_23.3.5-1_armhf.deb ... Unpacking libglapi-mesa:armhf (23.3.5-1) ... Selecting previously unselected package libx11-xcb1:armhf. Preparing to unpack .../128-libx11-xcb1_2%3a1.8.7-1_armhf.deb ... Unpacking libx11-xcb1:armhf (2:1.8.7-1) ... Selecting previously unselected package libxcb-dri2-0:armhf. Preparing to unpack .../129-libxcb-dri2-0_1.15-1_armhf.deb ... Unpacking libxcb-dri2-0:armhf (1.15-1) ... Selecting previously unselected package libxcb-dri3-0:armhf. Preparing to unpack .../130-libxcb-dri3-0_1.15-1_armhf.deb ... Unpacking libxcb-dri3-0:armhf (1.15-1) ... Selecting previously unselected package libxcb-glx0:armhf. Preparing to unpack .../131-libxcb-glx0_1.15-1_armhf.deb ... Unpacking libxcb-glx0:armhf (1.15-1) ... Selecting previously unselected package libxcb-present0:armhf. Preparing to unpack .../132-libxcb-present0_1.15-1_armhf.deb ... Unpacking libxcb-present0:armhf (1.15-1) ... Selecting previously unselected package libxcb-randr0:armhf. Preparing to unpack .../133-libxcb-randr0_1.15-1_armhf.deb ... Unpacking libxcb-randr0:armhf (1.15-1) ... Selecting previously unselected package libxcb-sync1:armhf. Preparing to unpack .../134-libxcb-sync1_1.15-1_armhf.deb ... Unpacking libxcb-sync1:armhf (1.15-1) ... Selecting previously unselected package libxcb-xfixes0:armhf. Preparing to unpack .../135-libxcb-xfixes0_1.15-1_armhf.deb ... Unpacking libxcb-xfixes0:armhf (1.15-1) ... Selecting previously unselected package libxshmfence1:armhf. Preparing to unpack .../136-libxshmfence1_1.3-1_armhf.deb ... Unpacking libxshmfence1:armhf (1.3-1) ... Selecting previously unselected package libxxf86vm1:armhf. Preparing to unpack .../137-libxxf86vm1_1%3a1.1.4-1+b2_armhf.deb ... Unpacking libxxf86vm1:armhf (1:1.1.4-1+b2) ... Selecting previously unselected package libvulkan1:armhf. Preparing to unpack .../138-libvulkan1_1.3.275.0-1_armhf.deb ... Unpacking libvulkan1:armhf (1.3.275.0-1) ... Selecting previously unselected package libdrm-amdgpu1:armhf. Preparing to unpack .../139-libdrm-amdgpu1_2.4.120-2_armhf.deb ... Unpacking libdrm-amdgpu1:armhf (2.4.120-2) ... Selecting previously unselected package libdrm-nouveau2:armhf. Preparing to unpack .../140-libdrm-nouveau2_2.4.120-2_armhf.deb ... Unpacking libdrm-nouveau2:armhf (2.4.120-2) ... Selecting previously unselected package libdrm-radeon1:armhf. Preparing to unpack .../141-libdrm-radeon1_2.4.120-2_armhf.deb ... Unpacking libdrm-radeon1:armhf (2.4.120-2) ... Selecting previously unselected package libedit2:armhf. Preparing to unpack .../142-libedit2_3.1-20230828-1_armhf.deb ... Unpacking libedit2:armhf (3.1-20230828-1) ... Selecting previously unselected package libz3-4:armhf. Preparing to unpack .../143-libz3-4_4.8.12-3.1+b2_armhf.deb ... Unpacking libz3-4:armhf (4.8.12-3.1+b2) ... Selecting previously unselected package libllvm17:armhf. Preparing to unpack .../144-libllvm17_1%3a17.0.6-5_armhf.deb ... Unpacking libllvm17:armhf (1:17.0.6-5) ... Selecting previously unselected package libsensors-config. Preparing to unpack .../145-libsensors-config_1%3a3.6.0-9_all.deb ... Unpacking libsensors-config (1:3.6.0-9) ... Selecting previously unselected package libsensors5:armhf. Preparing to unpack .../146-libsensors5_1%3a3.6.0-9_armhf.deb ... Unpacking libsensors5:armhf (1:3.6.0-9) ... Selecting previously unselected package libgl1-mesa-dri:armhf. Preparing to unpack .../147-libgl1-mesa-dri_23.3.5-1_armhf.deb ... Unpacking libgl1-mesa-dri:armhf (23.3.5-1) ... Selecting previously unselected package libglx-mesa0:armhf. Preparing to unpack .../148-libglx-mesa0_23.3.5-1_armhf.deb ... Unpacking libglx-mesa0:armhf (23.3.5-1) ... Selecting previously unselected package libglx0:armhf. Preparing to unpack .../149-libglx0_1.7.0-1_armhf.deb ... Unpacking libglx0:armhf (1.7.0-1) ... Selecting previously unselected package libgl1:armhf. Preparing to unpack .../150-libgl1_1.7.0-1_armhf.deb ... Unpacking libgl1:armhf (1.7.0-1) ... Selecting previously unselected package libgif7:armhf. Preparing to unpack .../151-libgif7_5.2.2-1_armhf.deb ... Unpacking libgif7:armhf (5.2.2-1) ... Selecting previously unselected package x11-common. Preparing to unpack .../152-x11-common_1%3a7.7+23_all.deb ... Unpacking x11-common (1:7.7+23) ... Selecting previously unselected package libxtst6:armhf. Preparing to unpack .../153-libxtst6_2%3a1.2.3-1.1_armhf.deb ... Unpacking libxtst6:armhf (2:1.2.3-1.1) ... Selecting previously unselected package openjdk-17-jre:armhf. Preparing to unpack .../154-openjdk-17-jre_17.0.10+7-1_armhf.deb ... Unpacking openjdk-17-jre:armhf (17.0.10+7-1) ... Selecting previously unselected package default-jre. Preparing to unpack .../155-default-jre_2%3a1.17-75_armhf.deb ... Unpacking default-jre (2:1.17-75) ... Selecting previously unselected package openjdk-17-jdk-headless:armhf. Preparing to unpack .../156-openjdk-17-jdk-headless_17.0.10+7-1_armhf.deb ... Unpacking openjdk-17-jdk-headless:armhf (17.0.10+7-1) ... Selecting previously unselected package default-jdk-headless. Preparing to unpack .../157-default-jdk-headless_2%3a1.17-75_armhf.deb ... Unpacking default-jdk-headless (2:1.17-75) ... Selecting previously unselected package openjdk-17-jdk:armhf. Preparing to unpack .../158-openjdk-17-jdk_17.0.10+7-1_armhf.deb ... Unpacking openjdk-17-jdk:armhf (17.0.10+7-1) ... Selecting previously unselected package default-jdk. Preparing to unpack .../159-default-jdk_2%3a1.17-75_armhf.deb ... Unpacking default-jdk (2:1.17-75) ... Selecting previously unselected package libassuan0:armhf. Preparing to unpack .../160-libassuan0_2.5.6-1_armhf.deb ... Unpacking libassuan0:armhf (2.5.6-1) ... Selecting previously unselected package gpgconf. Preparing to unpack .../161-gpgconf_2.2.40-1.1+b1_armhf.deb ... Unpacking gpgconf (2.2.40-1.1+b1) ... Selecting previously unselected package libksba8:armhf. Preparing to unpack .../162-libksba8_1.6.6-1_armhf.deb ... Unpacking libksba8:armhf (1.6.6-1) ... Selecting previously unselected package libsasl2-modules-db:armhf. Preparing to unpack .../163-libsasl2-modules-db_2.1.28+dfsg1-4+b1_armhf.deb ... Unpacking libsasl2-modules-db:armhf (2.1.28+dfsg1-4+b1) ... Selecting previously unselected package libsasl2-2:armhf. Preparing to unpack .../164-libsasl2-2_2.1.28+dfsg1-4+b1_armhf.deb ... Unpacking libsasl2-2:armhf (2.1.28+dfsg1-4+b1) ... Selecting previously unselected package libldap-2.5-0:armhf. Preparing to unpack .../165-libldap-2.5-0_2.5.13+dfsg-5+b3_armhf.deb ... Unpacking libldap-2.5-0:armhf (2.5.13+dfsg-5+b3) ... Selecting previously unselected package libnpth0:armhf. Preparing to unpack .../166-libnpth0_1.6-3+b1_armhf.deb ... Unpacking libnpth0:armhf (1.6-3+b1) ... Selecting previously unselected package dirmngr. Preparing to unpack .../167-dirmngr_2.2.40-1.1+b1_armhf.deb ... Unpacking dirmngr (2.2.40-1.1+b1) ... Selecting previously unselected package gnupg-l10n. Preparing to unpack .../168-gnupg-l10n_2.2.40-1.1_all.deb ... Unpacking gnupg-l10n (2.2.40-1.1) ... Selecting previously unselected package gnupg-utils. Preparing to unpack .../169-gnupg-utils_2.2.40-1.1+b1_armhf.deb ... Unpacking gnupg-utils (2.2.40-1.1+b1) ... Selecting previously unselected package gpg. Preparing to unpack .../170-gpg_2.2.40-1.1+b1_armhf.deb ... Unpacking gpg (2.2.40-1.1+b1) ... Selecting previously unselected package pinentry-curses. Preparing to unpack .../171-pinentry-curses_1.2.1-3_armhf.deb ... Unpacking pinentry-curses (1.2.1-3) ... Selecting previously unselected package gpg-agent. Preparing to unpack .../172-gpg-agent_2.2.40-1.1+b1_armhf.deb ... Unpacking gpg-agent (2.2.40-1.1+b1) ... Selecting previously unselected package gpg-wks-client. Preparing to unpack .../173-gpg-wks-client_2.2.40-1.1+b1_armhf.deb ... Unpacking gpg-wks-client (2.2.40-1.1+b1) ... Selecting previously unselected package gpg-wks-server. Preparing to unpack .../174-gpg-wks-server_2.2.40-1.1+b1_armhf.deb ... Unpacking gpg-wks-server (2.2.40-1.1+b1) ... Selecting previously unselected package gpgsm. Preparing to unpack .../175-gpgsm_2.2.40-1.1+b1_armhf.deb ... Unpacking gpgsm (2.2.40-1.1+b1) ... Selecting previously unselected package gnupg. Preparing to unpack .../176-gnupg_2.2.40-1.1_all.deb ... Unpacking gnupg (2.2.40-1.1) ... Selecting previously unselected package libfile-dirlist-perl. Preparing to unpack .../177-libfile-dirlist-perl_0.05-3_all.deb ... Unpacking libfile-dirlist-perl (0.05-3) ... Selecting previously unselected package libfile-which-perl. Preparing to unpack .../178-libfile-which-perl_1.27-2_all.deb ... Unpacking libfile-which-perl (1.27-2) ... Selecting previously unselected package libfile-homedir-perl. Preparing to unpack .../179-libfile-homedir-perl_1.006-2_all.deb ... Unpacking libfile-homedir-perl (1.006-2) ... Selecting previously unselected package libfile-touch-perl. Preparing to unpack .../180-libfile-touch-perl_0.12-2_all.deb ... Unpacking libfile-touch-perl (0.12-2) ... Selecting previously unselected package libio-pty-perl. Preparing to unpack .../181-libio-pty-perl_1%3a1.20-1_armhf.deb ... Unpacking libio-pty-perl (1:1.20-1) ... Selecting previously unselected package libipc-run-perl. Preparing to unpack .../182-libipc-run-perl_20231003.0-1_all.deb ... Unpacking libipc-run-perl (20231003.0-1) ... Selecting previously unselected package libclass-method-modifiers-perl. Preparing to unpack .../183-libclass-method-modifiers-perl_2.15-1_all.deb ... Unpacking libclass-method-modifiers-perl (2.15-1) ... Selecting previously unselected package libclass-xsaccessor-perl. Preparing to unpack .../184-libclass-xsaccessor-perl_1.19-4+b2_armhf.deb ... Unpacking libclass-xsaccessor-perl (1.19-4+b2) ... Selecting previously unselected package libb-hooks-op-check-perl:armhf. Preparing to unpack .../185-libb-hooks-op-check-perl_0.22-2+b2_armhf.deb ... Unpacking libb-hooks-op-check-perl:armhf (0.22-2+b2) ... Selecting previously unselected package libdynaloader-functions-perl. Preparing to unpack .../186-libdynaloader-functions-perl_0.003-3_all.deb ... Unpacking libdynaloader-functions-perl (0.003-3) ... Selecting previously unselected package libdevel-callchecker-perl:armhf. Preparing to unpack .../187-libdevel-callchecker-perl_0.008-2+b1_armhf.deb ... Unpacking libdevel-callchecker-perl:armhf (0.008-2+b1) ... Selecting previously unselected package libparams-classify-perl:armhf. Preparing to unpack .../188-libparams-classify-perl_0.015-2+b2_armhf.deb ... Unpacking libparams-classify-perl:armhf (0.015-2+b2) ... Selecting previously unselected package libmodule-runtime-perl. Preparing to unpack .../189-libmodule-runtime-perl_0.016-2_all.deb ... Unpacking libmodule-runtime-perl (0.016-2) ... Selecting previously unselected package libimport-into-perl. Preparing to unpack .../190-libimport-into-perl_1.002005-2_all.deb ... Unpacking libimport-into-perl (1.002005-2) ... Selecting previously unselected package librole-tiny-perl. Preparing to unpack .../191-librole-tiny-perl_2.002004-1_all.deb ... Unpacking librole-tiny-perl (2.002004-1) ... Selecting previously unselected package libsub-quote-perl. Preparing to unpack .../192-libsub-quote-perl_2.006008-1_all.deb ... Unpacking libsub-quote-perl (2.006008-1) ... Selecting previously unselected package libmoo-perl. Preparing to unpack .../193-libmoo-perl_2.005005-1_all.deb ... Unpacking libmoo-perl (2.005005-1) ... Selecting previously unselected package libencode-locale-perl. Preparing to unpack .../194-libencode-locale-perl_1.05-3_all.deb ... Unpacking libencode-locale-perl (1.05-3) ... Selecting previously unselected package libtimedate-perl. Preparing to unpack .../195-libtimedate-perl_2.3300-2_all.deb ... Unpacking libtimedate-perl (2.3300-2) ... Selecting previously unselected package libhttp-date-perl. Preparing to unpack .../196-libhttp-date-perl_6.06-1_all.deb ... Unpacking libhttp-date-perl (6.06-1) ... Selecting previously unselected package libfile-listing-perl. Preparing to unpack .../197-libfile-listing-perl_6.16-1_all.deb ... Unpacking libfile-listing-perl (6.16-1) ... Selecting previously unselected package libhtml-tagset-perl. Preparing to unpack .../198-libhtml-tagset-perl_3.24-1_all.deb ... Unpacking libhtml-tagset-perl (3.24-1) ... Selecting previously unselected package liburi-perl. Preparing to unpack .../199-liburi-perl_5.27-1_all.deb ... Unpacking liburi-perl (5.27-1) ... Selecting previously unselected package libhtml-parser-perl:armhf. Preparing to unpack .../200-libhtml-parser-perl_3.81-1+b1_armhf.deb ... Unpacking libhtml-parser-perl:armhf (3.81-1+b1) ... Selecting previously unselected package libhtml-tree-perl. Preparing to unpack .../201-libhtml-tree-perl_5.07-3_all.deb ... Unpacking libhtml-tree-perl (5.07-3) ... Selecting previously unselected package libclone-perl:armhf. Preparing to unpack .../202-libclone-perl_0.46-1+b1_armhf.deb ... Unpacking libclone-perl:armhf (0.46-1+b1) ... Selecting previously unselected package libio-html-perl. Preparing to unpack .../203-libio-html-perl_1.004-3_all.deb ... Unpacking libio-html-perl (1.004-3) ... Selecting previously unselected package liblwp-mediatypes-perl. Preparing to unpack .../204-liblwp-mediatypes-perl_6.04-2_all.deb ... Unpacking liblwp-mediatypes-perl (6.04-2) ... Selecting previously unselected package libhttp-message-perl. Preparing to unpack .../205-libhttp-message-perl_6.45-1_all.deb ... Unpacking libhttp-message-perl (6.45-1) ... Selecting previously unselected package libhttp-cookies-perl. Preparing to unpack .../206-libhttp-cookies-perl_6.11-1_all.deb ... Unpacking libhttp-cookies-perl (6.11-1) ... Selecting previously unselected package libhttp-negotiate-perl. Preparing to unpack .../207-libhttp-negotiate-perl_6.01-2_all.deb ... Unpacking libhttp-negotiate-perl (6.01-2) ... Selecting previously unselected package perl-openssl-defaults:armhf. Preparing to unpack .../208-perl-openssl-defaults_7+b1_armhf.deb ... Unpacking perl-openssl-defaults:armhf (7+b1) ... Selecting previously unselected package libnet-ssleay-perl:armhf. Preparing to unpack .../209-libnet-ssleay-perl_1.94-1_armhf.deb ... Unpacking libnet-ssleay-perl:armhf (1.94-1) ... Selecting previously unselected package libio-socket-ssl-perl. Preparing to unpack .../210-libio-socket-ssl-perl_2.085-1_all.deb ... Unpacking libio-socket-ssl-perl (2.085-1) ... Selecting previously unselected package libnet-http-perl. Preparing to unpack .../211-libnet-http-perl_6.23-1_all.deb ... Unpacking libnet-http-perl (6.23-1) ... Selecting previously unselected package liblwp-protocol-https-perl. Preparing to unpack .../212-liblwp-protocol-https-perl_6.14-1_all.deb ... Unpacking liblwp-protocol-https-perl (6.14-1) ... Selecting previously unselected package libtry-tiny-perl. Preparing to unpack .../213-libtry-tiny-perl_0.31-2_all.deb ... Unpacking libtry-tiny-perl (0.31-2) ... Selecting previously unselected package libwww-robotrules-perl. Preparing to unpack .../214-libwww-robotrules-perl_6.02-1_all.deb ... Unpacking libwww-robotrules-perl (6.02-1) ... Selecting previously unselected package libwww-perl. Preparing to unpack .../215-libwww-perl_6.77-1_all.deb ... Unpacking libwww-perl (6.77-1) ... Selecting previously unselected package patchutils. Preparing to unpack .../216-patchutils_0.4.2-1_armhf.deb ... Unpacking patchutils (0.4.2-1) ... Selecting previously unselected package wdiff. Preparing to unpack .../217-wdiff_1.2.2-6_armhf.deb ... Unpacking wdiff (1.2.2-6) ... Selecting previously unselected package devscripts. Preparing to unpack .../218-devscripts_2.23.7_all.deb ... Unpacking devscripts (2.23.7) ... Selecting previously unselected package fastjar. Preparing to unpack .../219-fastjar_2%3a0.98-7_armhf.deb ... Unpacking fastjar (2:0.98-7) ... Selecting previously unselected package ivy. Preparing to unpack .../220-ivy_2.5.2-1_all.deb ... Unpacking ivy (2.5.2-1) ... Selecting previously unselected package libasm-java. Preparing to unpack .../221-libasm-java_9.5-1_all.deb ... Unpacking libasm-java (9.5-1) ... Selecting previously unselected package libbsf-java. Preparing to unpack .../222-libbsf-java_1%3a2.4.0-8_all.deb ... Unpacking libbsf-java (1:2.4.0-8) ... Selecting previously unselected package libcommons-cli-java. Preparing to unpack .../223-libcommons-cli-java_1.6.0-1_all.deb ... Unpacking libcommons-cli-java (1.6.0-1) ... Selecting previously unselected package libapache-pom-java. Preparing to unpack .../224-libapache-pom-java_29-2_all.deb ... Unpacking libapache-pom-java (29-2) ... Selecting previously unselected package libcommons-parent-java. Preparing to unpack .../225-libcommons-parent-java_56-1_all.deb ... Unpacking libcommons-parent-java (56-1) ... Selecting previously unselected package libcommons-logging-java. Preparing to unpack .../226-libcommons-logging-java_1.3.0-1_all.deb ... Unpacking libcommons-logging-java (1.3.0-1) ... Selecting previously unselected package libjansi-java. Preparing to unpack .../227-libjansi-java_2.4.1-2_all.deb ... Unpacking libjansi-java (2.4.1-2) ... Selecting previously unselected package libjsp-api-java. Preparing to unpack .../228-libjsp-api-java_2.3.4-3_all.deb ... Unpacking libjsp-api-java (2.3.4-3) ... Selecting previously unselected package libqdox-java. Preparing to unpack .../229-libqdox-java_1.12.1-3_all.deb ... Unpacking libqdox-java (1.12.1-3) ... Selecting previously unselected package libservlet-api-java. Preparing to unpack .../230-libservlet-api-java_4.0.1-2_all.deb ... Unpacking libservlet-api-java (4.0.1-2) ... Selecting previously unselected package libxpp3-java. Preparing to unpack .../231-libxpp3-java_1.1.4c-3_all.deb ... Unpacking libxpp3-java (1.1.4c-3) ... Selecting previously unselected package libxstream-java. Preparing to unpack .../232-libxstream-java_1.4.20-1_all.deb ... Unpacking libxstream-java (1.4.20-1) ... Selecting previously unselected package groovy. Preparing to unpack .../233-groovy_2.4.21-10_all.deb ... Unpacking groovy (2.4.21-10) ... Selecting previously unselected package libatinject-jsr330-api-java. Preparing to unpack .../234-libatinject-jsr330-api-java_1.0+ds1-5_all.deb ... Unpacking libatinject-jsr330-api-java (1.0+ds1-5) ... Selecting previously unselected package libcommons-collections3-java. Preparing to unpack .../235-libcommons-collections3-java_3.2.2-3_all.deb ... Unpacking libcommons-collections3-java (3.2.2-3) ... Selecting previously unselected package libcommons-compress-java. Preparing to unpack .../236-libcommons-compress-java_1.25.0-1_all.deb ... Unpacking libcommons-compress-java (1.25.0-1) ... Selecting previously unselected package libcommons-io-java. Preparing to unpack .../237-libcommons-io-java_2.11.0-2_all.deb ... Unpacking libcommons-io-java (2.11.0-2) ... Selecting previously unselected package libcommons-lang-java. Preparing to unpack .../238-libcommons-lang-java_2.6-10_all.deb ... Unpacking libcommons-lang-java (2.6-10) ... Selecting previously unselected package liberror-prone-java. Preparing to unpack .../239-liberror-prone-java_2.18.0-1_all.deb ... Unpacking liberror-prone-java (2.18.0-1) ... Selecting previously unselected package libjsr305-java. Preparing to unpack .../240-libjsr305-java_0.1~+svn49-11_all.deb ... Unpacking libjsr305-java (0.1~+svn49-11) ... Selecting previously unselected package libguava-java. Preparing to unpack .../241-libguava-java_32.0.1-1_all.deb ... Unpacking libguava-java (32.0.1-1) ... Selecting previously unselected package libcommons-codec-java. Preparing to unpack .../242-libcommons-codec-java_1.16.0-1_all.deb ... Unpacking libcommons-codec-java (1.16.0-1) ... Selecting previously unselected package libhttpcore-java. Preparing to unpack .../243-libhttpcore-java_4.4.16-1_all.deb ... Unpacking libhttpcore-java (4.4.16-1) ... Selecting previously unselected package libhttpclient-java. Preparing to unpack .../244-libhttpclient-java_4.5.14-1_all.deb ... Unpacking libhttpclient-java (4.5.14-1) ... Selecting previously unselected package libjarjar-java. Preparing to unpack .../245-libjarjar-java_1.4+svn142-12_all.deb ... Unpacking libjarjar-java (1.4+svn142-12) ... Selecting previously unselected package libjcip-annotations-java. Preparing to unpack .../246-libjcip-annotations-java_20060626-6_all.deb ... Unpacking libjcip-annotations-java (20060626-6) ... Selecting previously unselected package libjna-jni. Preparing to unpack .../247-libjna-jni_5.14.0-1_armhf.deb ... Unpacking libjna-jni (5.14.0-1) ... Selecting previously unselected package libjna-java. Preparing to unpack .../248-libjna-java_5.14.0-1_all.deb ... Unpacking libjna-java (5.14.0-1) ... Selecting previously unselected package libjzlib-java. Preparing to unpack .../249-libjzlib-java_1.1.3-3_all.deb ... Unpacking libjzlib-java (1.1.3-3) ... Selecting previously unselected package libjsch-java. Preparing to unpack .../250-libjsch-java_0.1.55-1_all.deb ... Unpacking libjsch-java (0.1.55-1) ... Selecting previously unselected package libminlog-java. Preparing to unpack .../251-libminlog-java_1.3.0-1.1_all.deb ... Unpacking libminlog-java (1.3.0-1.1) ... Selecting previously unselected package libobjenesis-java. Preparing to unpack .../252-libobjenesis-java_3.3-3_all.deb ... Unpacking libobjenesis-java (3.3-3) ... Selecting previously unselected package libreflectasm-java. Preparing to unpack .../253-libreflectasm-java_1.11.9+dfsg-4_all.deb ... Unpacking libreflectasm-java (1.11.9+dfsg-4) ... Selecting previously unselected package libkryo-java. Preparing to unpack .../254-libkryo-java_2.20-7_all.deb ... Unpacking libkryo-java (2.20-7) ... Selecting previously unselected package liblogback-java. Preparing to unpack .../255-liblogback-java_1%3a1.2.11-5_all.deb ... Unpacking liblogback-java (1:1.2.11-5) ... Selecting previously unselected package libnative-platform-jni. Preparing to unpack .../256-libnative-platform-jni_0.14-6_armhf.deb ... Unpacking libnative-platform-jni (0.14-6) ... Selecting previously unselected package libnative-platform-java. Preparing to unpack .../257-libnative-platform-java_0.14-6_all.deb ... Unpacking libnative-platform-java (0.14-6) ... Selecting previously unselected package libxml-commons-external-java. Preparing to unpack .../258-libxml-commons-external-java_1.4.01-6_all.deb ... Unpacking libxml-commons-external-java (1.4.01-6) ... Selecting previously unselected package libxml-commons-resolver1.1-java. Preparing to unpack .../259-libxml-commons-resolver1.1-java_1.2-11_all.deb ... Unpacking libxml-commons-resolver1.1-java (1.2-11) ... Selecting previously unselected package libxerces2-java. Preparing to unpack .../260-libxerces2-java_2.12.2-1_all.deb ... Unpacking libxerces2-java (2.12.2-1) ... Selecting previously unselected package libnekohtml-java. Preparing to unpack .../261-libnekohtml-java_1.9.22.noko2-0.1_all.deb ... Unpacking libnekohtml-java (1.9.22.noko2-0.1) ... Selecting previously unselected package libxbean-reflect-java. Preparing to unpack .../262-libxbean-reflect-java_4.5-8_all.deb ... Unpacking libxbean-reflect-java (4.5-8) ... Selecting previously unselected package libgradle-core-java. Preparing to unpack .../263-libgradle-core-java_4.4.1-20_all.deb ... Unpacking libgradle-core-java (4.4.1-20) ... Selecting previously unselected package libbcprov-java. Preparing to unpack .../264-libbcprov-java_1.77-1_all.deb ... Unpacking libbcprov-java (1.77-1) ... Selecting previously unselected package libbcpg-java. Preparing to unpack .../265-libbcpg-java_1.77-1_all.deb ... Unpacking libbcpg-java (1.77-1) ... Selecting previously unselected package libbsh-java. Preparing to unpack .../266-libbsh-java_2.0b4-20_all.deb ... Unpacking libbsh-java (2.0b4-20) ... Selecting previously unselected package libdd-plist-java. Preparing to unpack .../267-libdd-plist-java_1.20-1.1_all.deb ... Unpacking libdd-plist-java (1.20-1.1) ... Selecting previously unselected package libjaxen-java. Preparing to unpack .../268-libjaxen-java_1.1.6-4_all.deb ... Unpacking libjaxen-java (1.1.6-4) ... Selecting previously unselected package libdom4j-java. Preparing to unpack .../269-libdom4j-java_2.1.4-1_all.deb ... Unpacking libdom4j-java (2.1.4-1) ... Selecting previously unselected package libbcel-java. Preparing to unpack .../270-libbcel-java_6.5.0-2_all.deb ... Unpacking libbcel-java (6.5.0-2) ... Selecting previously unselected package libjformatstring-java. Preparing to unpack .../271-libjformatstring-java_0.10~20131207-2.1_all.deb ... Unpacking libjformatstring-java (0.10~20131207-2.1) ... Selecting previously unselected package libfindbugs-java. Preparing to unpack .../272-libfindbugs-java_3.1.0~preview2-3_all.deb ... Unpacking libfindbugs-java (3.1.0~preview2-3) ... Selecting previously unselected package libgoogle-gson-java. Preparing to unpack .../273-libgoogle-gson-java_2.10.1-1_all.deb ... Unpacking libgoogle-gson-java (2.10.1-1) ... Selecting previously unselected package libaopalliance-java. Preparing to unpack .../274-libaopalliance-java_20070526-7_all.deb ... Unpacking libaopalliance-java (20070526-7) ... Selecting previously unselected package libguice-java. Preparing to unpack .../275-libguice-java_4.2.3-2_all.deb ... Unpacking libguice-java (4.2.3-2) ... Selecting previously unselected package libjatl-java. Preparing to unpack .../276-libjatl-java_0.2.3-1.1_all.deb ... Unpacking libjatl-java (0.2.3-1.1) ... Selecting previously unselected package libjcifs-java. Preparing to unpack .../277-libjcifs-java_1.3.19-2_all.deb ... Unpacking libjcifs-java (1.3.19-2) ... Selecting previously unselected package libeclipse-jdt-annotation-java. Preparing to unpack .../278-libeclipse-jdt-annotation-java_2.2.700+eclipse4.26-2_all.deb ... Unpacking libeclipse-jdt-annotation-java (2.2.700+eclipse4.26-2) ... Selecting previously unselected package libjavaewah-java. Preparing to unpack .../279-libjavaewah-java_1.2.3-1_all.deb ... Unpacking libjavaewah-java (1.2.3-1) ... Selecting previously unselected package libel-api-java. Preparing to unpack .../280-libel-api-java_3.0.0-3_all.deb ... Unpacking libel-api-java (3.0.0-3) ... Selecting previously unselected package libwebsocket-api-java. Preparing to unpack .../281-libwebsocket-api-java_1.1-2_all.deb ... Unpacking libwebsocket-api-java (1.1-2) ... Selecting previously unselected package libjetty9-java. Preparing to unpack .../282-libjetty9-java_9.4.53-1_all.deb ... Unpacking libjetty9-java (9.4.53-1) ... Selecting previously unselected package libjgit-java. Preparing to unpack .../283-libjgit-java_4.11.9-2_all.deb ... Unpacking libjgit-java (4.11.9-2) ... Selecting previously unselected package libjs-jquery. Preparing to unpack .../284-libjs-jquery_3.6.1+dfsg+~3.5.14-1_all.deb ... Unpacking libjs-jquery (3.6.1+dfsg+~3.5.14-1) ... Selecting previously unselected package libcommons-lang3-java. Preparing to unpack .../285-libcommons-lang3-java_3.14.0-1_all.deb ... Unpacking libcommons-lang3-java (3.14.0-1) ... Selecting previously unselected package libplexus-utils2-java. Preparing to unpack .../286-libplexus-utils2-java_3.4.2-1_all.deb ... Unpacking libplexus-utils2-java (3.4.2-1) ... Selecting previously unselected package libwagon-provider-api-java. Preparing to unpack .../287-libwagon-provider-api-java_3.5.3-1_all.deb ... Unpacking libwagon-provider-api-java (3.5.3-1) ... Selecting previously unselected package libmaven-resolver-java. Preparing to unpack .../288-libmaven-resolver-java_1.6.3-1_all.deb ... Unpacking libmaven-resolver-java (1.6.3-1) ... Selecting previously unselected package libgeronimo-annotation-1.3-spec-java. Preparing to unpack .../289-libgeronimo-annotation-1.3-spec-java_1.3-1_all.deb ... Unpacking libgeronimo-annotation-1.3-spec-java (1.3-1) ... Selecting previously unselected package libmaven-parent-java. Preparing to unpack .../290-libmaven-parent-java_35-1_all.deb ... Unpacking libmaven-parent-java (35-1) ... Selecting previously unselected package libmaven-shared-utils-java. Preparing to unpack .../291-libmaven-shared-utils-java_3.3.4-1_all.deb ... Unpacking libmaven-shared-utils-java (3.3.4-1) ... Selecting previously unselected package libplexus-cipher-java. Preparing to unpack .../292-libplexus-cipher-java_2.0-1_all.deb ... Unpacking libplexus-cipher-java (2.0-1) ... Selecting previously unselected package libplexus-classworlds-java. Preparing to unpack .../293-libplexus-classworlds-java_2.7.0-1_all.deb ... Unpacking libplexus-classworlds-java (2.7.0-1) ... Selecting previously unselected package libplexus-component-annotations-java. Preparing to unpack .../294-libplexus-component-annotations-java_2.1.1-1_all.deb ... Unpacking libplexus-component-annotations-java (2.1.1-1) ... Selecting previously unselected package libplexus-interpolation-java. Preparing to unpack .../295-libplexus-interpolation-java_1.26-1_all.deb ... Unpacking libplexus-interpolation-java (1.26-1) ... Selecting previously unselected package libplexus-sec-dispatcher-java. Preparing to unpack .../296-libplexus-sec-dispatcher-java_2.0-3_all.deb ... Unpacking libplexus-sec-dispatcher-java (2.0-3) ... Selecting previously unselected package libgeronimo-interceptor-3.0-spec-java. Preparing to unpack .../297-libgeronimo-interceptor-3.0-spec-java_1.0.1-4_all.deb ... Unpacking libgeronimo-interceptor-3.0-spec-java (1.0.1-4) ... Selecting previously unselected package libcdi-api-java. Preparing to unpack .../298-libcdi-api-java_1.2-3_all.deb ... Unpacking libcdi-api-java (1.2-3) ... Selecting previously unselected package libsisu-inject-java. Preparing to unpack .../299-libsisu-inject-java_0.3.4-2_all.deb ... Unpacking libsisu-inject-java (0.3.4-2) ... Selecting previously unselected package libsisu-plexus-java. Preparing to unpack .../300-libsisu-plexus-java_0.3.4-3_all.deb ... Unpacking libsisu-plexus-java (0.3.4-3) ... Selecting previously unselected package libmaven3-core-java. Preparing to unpack .../301-libmaven3-core-java_3.8.7-2_all.deb ... Unpacking libmaven3-core-java (3.8.7-2) ... Selecting previously unselected package libplexus-container-default-java. Preparing to unpack .../302-libplexus-container-default-java_2.1.1-1_all.deb ... Unpacking libplexus-container-default-java (2.1.1-1) ... Selecting previously unselected package libpolyglot-maven-java. Preparing to unpack .../303-libpolyglot-maven-java_0.8~tobrien+git20120905-10_all.deb ... Unpacking libpolyglot-maven-java (0.8~tobrien+git20120905-10) ... Selecting previously unselected package librhino-java. Preparing to unpack .../304-librhino-java_1.7.14-2.1_all.deb ... Unpacking librhino-java (1.7.14-2.1) ... Selecting previously unselected package libsimple-http-java. Preparing to unpack .../305-libsimple-http-java_4.1.21-1.1_all.deb ... Unpacking libsimple-http-java (4.1.21-1.1) ... Selecting previously unselected package libwagon-file-java. Preparing to unpack .../306-libwagon-file-java_3.5.3-1_all.deb ... Unpacking libwagon-file-java (3.5.3-1) ... Selecting previously unselected package libjsoup-java. Preparing to unpack .../307-libjsoup-java_1.15.3-1_all.deb ... Unpacking libjsoup-java (1.15.3-1) ... Selecting previously unselected package libwagon-http-java. Preparing to unpack .../308-libwagon-http-java_3.5.3-1_all.deb ... Unpacking libwagon-http-java (3.5.3-1) ... Selecting previously unselected package libjcommander-java. Preparing to unpack .../309-libjcommander-java_1.71-4_all.deb ... Unpacking libjcommander-java (1.71-4) ... Selecting previously unselected package testng. Preparing to unpack .../310-testng_6.9.12-4_all.deb ... Unpacking testng (6.9.12-4) ... Selecting previously unselected package libgradle-plugins-java. Preparing to unpack .../311-libgradle-plugins-java_4.4.1-20_all.deb ... Unpacking libgradle-plugins-java (4.4.1-20) ... Selecting previously unselected package gradle. Preparing to unpack .../312-gradle_4.4.1-20_all.deb ... Unpacking gradle (4.4.1-20) ... Selecting previously unselected package maven-repo-helper. Preparing to unpack .../313-maven-repo-helper_1.11_all.deb ... Unpacking maven-repo-helper (1.11) ... Selecting previously unselected package gradle-debian-helper. Preparing to unpack .../314-gradle-debian-helper_2.4_all.deb ... Unpacking gradle-debian-helper (2.4) ... Selecting previously unselected package jarwrapper. Preparing to unpack .../315-jarwrapper_0.79_all.deb ... Unpacking jarwrapper (0.79) ... Selecting previously unselected package javahelper. Preparing to unpack .../316-javahelper_0.79_all.deb ... Unpacking javahelper (0.79) ... Selecting previously unselected package libbyte-buddy-java. Preparing to unpack .../317-libbyte-buddy-java_1.12.23-1_all.deb ... Unpacking libbyte-buddy-java (1.12.23-1) ... Selecting previously unselected package libcommons-math3-java. Preparing to unpack .../318-libcommons-math3-java_3.6.1-3_all.deb ... Unpacking libcommons-math3-java (3.6.1-3) ... Selecting previously unselected package libjackson2-annotations-java. Preparing to unpack .../319-libjackson2-annotations-java_2.14.0-1_all.deb ... Unpacking libjackson2-annotations-java (2.14.0-1) ... Selecting previously unselected package libjackson2-core-java. Preparing to unpack .../320-libjackson2-core-java_2.14.1-1_all.deb ... Unpacking libjackson2-core-java (2.14.1-1) ... Selecting previously unselected package libjackson2-databind-java. Preparing to unpack .../321-libjackson2-databind-java_2.14.0-1_all.deb ... Unpacking libjackson2-databind-java (2.14.0-1) ... Selecting previously unselected package liblz4-jni. Preparing to unpack .../322-liblz4-jni_1.8.0-4_armhf.deb ... Unpacking liblz4-jni (1.8.0-4) ... Selecting previously unselected package liblz4-java. Preparing to unpack .../323-liblz4-java_1.8.0-4_all.deb ... Unpacking liblz4-java (1.8.0-4) ... Selecting previously unselected package libmockito-java. Preparing to unpack .../324-libmockito-java_2.23.0-2_all.deb ... Unpacking libmockito-java (2.23.0-2) ... Selecting previously unselected package libredberry-pipe-java. Preparing to unpack .../325-libredberry-pipe-java_1.0.0~alpha0-3_all.deb ... Unpacking libredberry-pipe-java (1.0.0~alpha0-3) ... Selecting previously unselected package libtrove3-java. Preparing to unpack .../326-libtrove3-java_3.0.3-5_all.deb ... Unpacking libtrove3-java (3.0.3-5) ... Setting up libjcifs-java (1.3.19-2) ... Setting up libbcprov-java (1.77-1) ... Setting up libksba8:armhf (1.6.6-1) ... Setting up media-types (10.1.0) ... Setting up libpipeline1:armhf (1.5.7-1+b2) ... Setting up fastjar (2:0.98-7) ... Setting up libgraphite2-3:armhf (1.3.14-2) ... Setting up liblcms2-2:armhf (2.14-2+b1) ... Setting up libpixman-1-0:armhf (0.42.2-1+b1) ... Setting up libjcommander-java (1.71-4) ... Setting up libjackson2-annotations-java (2.14.0-1) ... Setting up wdiff (1.2.2-6) ... Setting up libsharpyuv0:armhf (1.3.2-0.4) ... Setting up libslf4j-java (1.7.32-1) ... Setting up libfile-which-perl (1.27-2) ... Setting up libxau6:armhf (1:1.0.9-1) ... Setting up libplexus-utils2-java (3.4.2-1) ... Setting up libredberry-pipe-java (1.0.0~alpha0-3) ... Setting up libplexus-classworlds-java (2.7.0-1) ... Setting up libqdox-java (1.12.1-3) ... Setting up libicu72:armhf (72.1-4+b1) ... Setting up liblerc4:armhf (4.0.0+ds-4+b1) ... Setting up libjsr305-java (0.1~+svn49-11) ... Setting up libsimple-http-java (4.1.21-1.1) ... Setting up bsdextrautils (2.39.3-6) ... Setting up hicolor-icon-theme (0.17-2) ... Setting up java-common (0.75) ... Setting up libdynaloader-functions-perl (0.003-3) ... Setting up libdatrie1:armhf (0.2.13-3) ... Setting up libjcip-annotations-java (20060626-6) ... Setting up libobjenesis-java (3.3-3) ... Setting up libclass-method-modifiers-perl (2.15-1) ... Setting up libaopalliance-java (20070526-7) ... Setting up libcommons-cli-java (1.6.0-1) ... Setting up libio-pty-perl (1:1.20-1) ... Setting up libmagic-mgc (1:5.45-2+b1) ... Setting up liblogback-java (1:1.2.11-5) ... Setting up libclone-perl:armhf (0.46-1+b1) ... Setting up libminlog-java (1.3.0-1.1) ... Setting up libarchive-zip-perl (1.68-1) ... Setting up libglib2.0-0:armhf (2.78.4-1) ... No schema files found: doing nothing. Setting up libglvnd0:armhf (1.7.0-1) ... Setting up libgoogle-gson-java (2.10.1-1) ... Setting up libhtml-tagset-perl (3.24-1) ... Setting up unzip (6.0-28) ... Setting up libdebhelper-perl (13.14.1) ... Setting up libbrotli1:armhf (1.1.0-2+b3) ... Setting up liblwp-mediatypes-perl (6.04-2) ... Setting up libgdk-pixbuf2.0-common (2.42.10+dfsg-3) ... Setting up libasm-java (9.5-1) ... Setting up x11-common (1:7.7+23) ... invoke-rc.d: could not determine current runlevel Setting up X socket directories... /tmp/.X11-unix /tmp/.ICE-unix. Setting up libtry-tiny-perl (0.31-2) ... Setting up libsensors-config (1:3.6.0-9) ... Setting up libmagic1:armhf (1:5.45-2+b1) ... Setting up libdeflate0:armhf (1.19-1) ... Setting up perl-openssl-defaults:armhf (7+b1) ... Setting up libdd-plist-java (1.20-1.1) ... Setting up gettext-base (0.21-14+b1) ... Setting up m4 (1.4.19-4) ... Setting up libel-api-java (3.0.0-3) ... Setting up libencode-locale-perl (1.05-3) ... Setting up libplexus-component-annotations-java (2.1.1-1) ... Setting up libnpth0:armhf (1.6-3+b1) ... Setting up file (1:5.45-2+b1) ... Setting up libpolyglot-maven-java (0.8~tobrien+git20120905-10) ... Setting up libfelix-gogo-runtime-java (0.16.2-1.1) ... Setting up libassuan0:armhf (2.5.6-1) ... Setting up libjzlib-java (1.1.3-3) ... Setting up libjbig0:armhf (2.1-6.1+b1) ... Setting up libsasl2-modules-db:armhf (2.1.28+dfsg1-4+b1) ... Setting up tzdata (2024a-1) ... Current default time zone: 'Etc/UTC' Local time is now: Mon Mar 25 16:32:05 UTC 2024. Universal Time is now: Mon Mar 25 16:32:05 UTC 2024. Run 'dpkg-reconfigure tzdata' if you wish to change it. Setting up libgeronimo-annotation-1.3-spec-java (1.3-1) ... Setting up libgeronimo-interceptor-3.0-spec-java (1.0.1-4) ... Setting up libcommons-collections3-java (3.2.2-3) ... Setting up libasound2-data (1.2.10-3) ... Setting up libjsch-java (0.1.55-1) ... Setting up libreflectasm-java (1.11.9+dfsg-4) ... Setting up librhino-java (1.7.14-2.1) ... Setting up autotools-dev (20220109.1) ... Setting up libz3-4:armhf (4.8.12-3.1+b2) ... Setting up libbsf-java (1:2.4.0-8) ... Setting up libosgi-annotation-java (8.1.0-1) ... Setting up libjformatstring-java (0.10~20131207-2.1) ... Setting up libjavaewah-java (1.2.3-1) ... Setting up libjpeg62-turbo:armhf (1:2.1.5-2+b2) ... Setting up libjaxen-java (1.1.6-4) ... Setting up libx11-data (2:1.8.7-1) ... Setting up libnspr4:armhf (2:4.35-1.1+b1) ... Setting up gnupg-l10n (2.2.40-1.1) ... Setting up libeclipse-jdt-annotation-java (2.2.700+eclipse4.26-2) ... Setting up libjansi-java (2.4.1-2) ... Setting up libapache-pom-java (29-2) ... Setting up libavahi-common-data:armhf (0.8-13+b1) ... Setting up libxpp3-java (1.1.4c-3) ... Setting up libatinject-jsr330-api-java (1.0+ds1-5) ... Setting up libdbus-1-3:armhf (1.14.10-4) ... Setting up libwebsocket-api-java (1.1-2) ... Setting up libfribidi0:armhf (1.0.13-3+b1) ... Setting up libplexus-interpolation-java (1.26-1) ... Setting up fonts-dejavu-mono (2.37-8) ... Setting up libpng16-16:armhf (1.6.43-1) ... Setting up libxml-commons-resolver1.1-java (1.2-11) ... Setting up libkryo-java (2.20-7) ... Setting up libxz-java (1.9-1) ... Setting up libio-html-perl (1.004-3) ... Setting up libjna-jni (5.14.0-1) ... Setting up autopoint (0.21-14) ... Setting up binfmt-support (2.2.2-6) ... invoke-rc.d: could not determine current runlevel invoke-rc.d: policy-rc.d denied execution of start. Setting up libb-hooks-op-check-perl:armhf (0.22-2+b2) ... Setting up fonts-dejavu-core (2.37-8) ... Setting up libfelix-framework-java (4.6.1-2.1) ... Setting up libipc-run-perl (20231003.0-1) ... Setting up libpcsclite1:armhf (2.0.1-1+b1) ... Setting up libsensors5:armhf (1:3.6.0-9) ... Setting up libhamcrest-java (2.2-2) ... Setting up libglapi-mesa:armhf (23.3.5-1) ... Setting up libbsh-java (2.0b4-20) ... Setting up libjsp-api-java (2.3.4-3) ... Setting up libsasl2-2:armhf (2.1.28+dfsg1-4+b1) ... Setting up libvulkan1:armhf (1.3.275.0-1) ... Setting up autoconf (2.71-3) ... Setting up libwebp7:armhf (1.3.2-0.4) ... Setting up libtimedate-perl (2.3300-2) ... Setting up libgif7:armhf (5.2.2-1) ... Setting up libjarjar-java (1.4+svn142-12) ... Setting up libtrove3-java (3.0.3-5) ... Setting up sensible-utils (0.0.22) ... Setting up libxshmfence1:armhf (1.3-1) ... Setting up libjsoup-java (1.15.3-1) ... Setting up at-spi2-common (2.50.0-1) ... Setting up libtiff6:armhf (4.5.1+git230720-4) ... Setting up libuchardet0:armhf (0.0.8-1+b1) ... Setting up libxml-commons-external-java (1.4.01-6) ... Setting up libjna-java (5.14.0-1) ... Setting up libxbean-reflect-java (4.5-8) ... Setting up libasound2:armhf (1.2.10-3) ... Setting up libservlet-api-java (4.0.1-2) ... Setting up librole-tiny-perl (2.002004-1) ... Setting up libjackson2-core-java (2.14.1-1) ... Setting up libsub-override-perl (0.10-1) ... Setting up libthai-data (0.1.29-2) ... Setting up netbase (6.4) ... Setting up libcommons-math3-java (3.6.1-3) ... Setting up libsub-quote-perl (2.006008-1) ... Setting up libnative-platform-jni (0.14-6) ... Setting up libclass-xsaccessor-perl (1.19-4+b2) ... Setting up libgtk2.0-common (2.24.33-3) ... Setting up libatk1.0-0:armhf (2.50.0-1+b1) ... Setting up liblz4-jni (1.8.0-4) ... Setting up libhttpcore-java (4.4.16-1) ... Setting up libbcpg-java (1.77-1) ... Setting up libjs-jquery (3.6.1+dfsg+~3.5.14-1) ... Setting up libxerces2-java (2.12.2-1) ... Setting up libfile-dirlist-perl (0.05-3) ... Setting up libfile-homedir-perl (1.006-2) ... Setting up libantlr-java (2.7.7+dfsg-13) ... Setting up libyaml-snake-java (1.33-2) ... Setting up openssl (3.1.5-1) ... Setting up libbsd0:armhf (0.12.2-1) ... Setting up libdrm-common (2.4.120-2) ... Setting up libcdi-api-java (1.2-3) ... Setting up libelf1:armhf (0.190-1+b1) ... Setting up readline-common (8.2-3) ... Setting up libhawtjni-runtime-java (1.18-1) ... Setting up libxml2:armhf (2.9.14+dfsg-1.3+b2) ... Setting up liburi-perl (5.27-1) ... Setting up libfile-touch-perl (0.12-2) ... Setting up dctrl-tools (2.24-3) ... Setting up libjatl-java (0.2.3-1.1) ... Setting up libnet-ssleay-perl:armhf (1.94-1) ... Setting up automake (1:1.16.5-1.3) ... update-alternatives: using /usr/bin/automake-1.16 to provide /usr/bin/automake (automake) in auto mode Setting up pinentry-curses (1.2.1-3) ... Setting up libdom4j-java (2.1.4-1) ... Setting up libfile-stripnondeterminism-perl (1.13.1-1) ... Setting up libwagon-provider-api-java (3.5.3-1) ... Setting up libnative-platform-java (0.14-6) ... Setting up libosgi-core-java (8.0.0-2) ... Setting up libhttp-date-perl (6.06-1) ... Setting up libxstream-java (1.4.20-1) ... Setting up libnekohtml-java (1.9.22.noko2-0.1) ... Setting up libxdmcp6:armhf (1:1.1.2-3) ... Setting up liblz4-java (1.8.0-4) ... Setting up libxcb1:armhf (1.15-1) ... Setting up gettext (0.21-14+b1) ... Setting up libjetty9-java (9.4.53-1) ... Setting up libxcb-xfixes0:armhf (1.15-1) ... Setting up java-wrappers (0.4) ... Setting up libfile-listing-perl (6.16-1) ... Setting up libosgi-compendium-java (7.0.0-1) ... Setting up jarwrapper (0.79) ... Setting up libtool (2.4.7-7) ... Setting up libxcb-render0:armhf (1.15-1) ... Setting up fontconfig-config (2.15.0-1.1) ... Setting up libxcb-glx0:armhf (1.15-1) ... Setting up libmaven-parent-java (35-1) ... Setting up libedit2:armhf (3.1-20230828-1) ... Setting up libreadline8:armhf (8.2-3+b1) ... Setting up libcommons-parent-java (56-1) ... Setting up libavahi-common3:armhf (0.8-13+b1) ... Setting up libcommons-logging-java (1.3.0-1) ... Setting up libnet-http-perl (6.23-1) ... Setting up libsisu-inject-java (0.3.4-2) ... Setting up libnss3:armhf (2:3.99-1) ... Setting up libxcb-shm0:armhf (1.15-1) ... Setting up libdevel-callchecker-perl:armhf (0.008-2+b1) ... Setting up libcommons-lang-java (2.6-10) ... Setting up libldap-2.5-0:armhf (2.5.13+dfsg-5+b3) ... Setting up libjackson2-databind-java (2.14.0-1) ... Setting up libplexus-cipher-java (2.0-1) ... Setting up intltool-debian (0.35.0+20060710.6) ... Setting up libxcb-present0:armhf (1.15-1) ... Setting up dh-autoreconf (20) ... Setting up patchutils (0.4.2-1) ... Setting up libthai0:armhf (0.1.29-2) ... Setting up ca-certificates (20240203) ... Updating certificates in /etc/ssl/certs... 146 added, 0 removed; done. Setting up libsisu-plexus-java (0.3.4-3) ... Setting up libbcel-java (6.5.0-2) ... Setting up libfreetype6:armhf (2.13.2+dfsg-1+b1) ... Setting up libxcb-sync1:armhf (1.15-1) ... Setting up testng (6.9.12-4) ... Setting up shared-mime-info (2.4-1) ... Setting up libcommons-lang3-java (3.14.0-1) ... Setting up libxcb-dri2-0:armhf (1.15-1) ... Setting up dh-strip-nondeterminism (1.13.1-1) ... Setting up libwww-robotrules-perl (6.02-1) ... Setting up libfelix-resolver-java (1.16.0-1) ... Setting up libdrm2:armhf (2.4.120-2) ... Setting up dwz (0.15-1) ... Setting up libjansi-native-java (1.8-2) ... Setting up groff-base (1.23.0-3) ... Setting up libxcb-randr0:armhf (1.15-1) ... Setting up libhtml-parser-perl:armhf (3.81-1+b1) ... Setting up gpgconf (2.2.40-1.1+b1) ... Setting up libjansi1-java (1.18-3) ... Setting up libplexus-sec-dispatcher-java (2.0-3) ... Setting up libx11-6:armhf (2:1.8.7-1) ... Setting up libharfbuzz0b:armhf (8.3.0-2) ... Setting up libgdk-pixbuf-2.0-0:armhf (2.42.10+dfsg-3+b1) ... Setting up libfontconfig1:armhf (2.15.0-1.1) ... Setting up ca-certificates-java (20240118) ... No JRE found. Skipping Java certificates setup. Setting up libwagon-file-java (3.5.3-1) ... Setting up libcommons-codec-java (1.16.0-1) ... Setting up libjline2-java (2.14.6-5) ... Setting up libllvm17:armhf (1:17.0.6-5) ... Setting up libxcomposite1:armhf (1:0.4.5-1) ... Setting up libavahi-client3:armhf (0.8-13+b1) ... Setting up libio-socket-ssl-perl (2.085-1) ... Setting up gpg (2.2.40-1.1+b1) ... Setting up gnupg-utils (2.2.40-1.1+b1) ... Setting up libhttp-message-perl (6.45-1) ... Setting up libdrm-amdgpu1:armhf (2.4.120-2) ... Setting up libxcb-dri3-0:armhf (1.15-1) ... Setting up gtk-update-icon-cache (3.24.41-1) ... Setting up libx11-xcb1:armhf (2:1.8.7-1) ... Setting up libhttp-negotiate-perl (6.01-2) ... Setting up fontconfig (2.15.0-1.1) ... Regenerating fonts cache... done. Setting up libdrm-nouveau2:armhf (2.4.120-2) ... Setting up libfindbugs-java (3.1.0~preview2-3) ... Setting up libxdamage1:armhf (1:1.1.6-1) ... Setting up gpg-agent (2.2.40-1.1+b1) ... Setting up libxrender1:armhf (1:0.9.10-1.1) ... Setting up libcommons-compress-java (1.25.0-1) ... Setting up libhttp-cookies-perl (6.11-1) ... Setting up libcommons-io-java (2.11.0-2) ... Setting up libdrm-radeon1:armhf (2.4.120-2) ... Setting up po-debconf (1.0.21+nmu1) ... Setting up libhtml-tree-perl (5.07-3) ... Setting up libpython3.11-stdlib:armhf (3.11.8-1) ... Setting up libparams-classify-perl:armhf (0.015-2+b2) ... Setting up gpgsm (2.2.40-1.1+b1) ... Setting up libpango-1.0-0:armhf (1.52.0+ds-1) ... Setting up libgl1-mesa-dri:armhf (23.3.5-1) ... Setting up libxext6:armhf (2:1.3.4-1+b1) ... Setting up man-db (2.12.0-3) ... Not building database; man-db/auto-update is not 'true'. Setting up libcairo2:armhf (1.18.0-1+b1) ... Setting up libxxf86vm1:armhf (1:1.1.4-1+b2) ... Setting up dirmngr (2.2.40-1.1+b1) ... Setting up libmaven-resolver-java (1.6.3-1) ... Setting up adwaita-icon-theme (46.0-1) ... update-alternatives: using /usr/share/icons/Adwaita/cursor.theme to provide /usr/share/icons/default/index.theme (x-cursor-theme) in auto mode Setting up libmodule-runtime-perl (0.016-2) ... Setting up libxfixes3:armhf (1:6.0.0-2) ... Setting up libxinerama1:armhf (2:1.1.4-3) ... Setting up libxrandr2:armhf (2:1.5.4-1) ... Setting up gpg-wks-server (2.2.40-1.1+b1) ... Setting up libcups2:armhf (2.4.7-1+b1) ... Setting up libhttpclient-java (4.5.14-1) ... Setting up libwagon-http-java (3.5.3-1) ... Setting up libmaven-shared-utils-java (3.3.4-1) ... Setting up libpangoft2-1.0-0:armhf (1.52.0+ds-1) ... Setting up libpangocairo-1.0-0:armhf (1.52.0+ds-1) ... Setting up libpython3-stdlib:armhf (3.11.6-1) ... Setting up python3.11 (3.11.8-1) ... Setting up libjgit-java (4.11.9-2) ... Setting up libglx-mesa0:armhf (23.3.5-1) ... Setting up libxi6:armhf (2:1.8.1-1) ... Setting up gpg-wks-client (2.2.40-1.1+b1) ... Setting up libglx0:armhf (1.7.0-1) ... Setting up libimport-into-perl (1.002005-2) ... Setting up libxtst6:armhf (2:1.2.3-1.1) ... Setting up libmoo-perl (2.005005-1) ... Setting up libxcursor1:armhf (1:1.2.1-1) ... Setting up debhelper (13.14.1) ... Setting up python3 (3.11.6-1) ... Setting up libgl1:armhf (1.7.0-1) ... Setting up openjdk-17-jre-headless:armhf (17.0.10+7-1) ... update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/java to provide /usr/bin/java (java) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/jpackage to provide /usr/bin/jpackage (jpackage) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/keytool to provide /usr/bin/keytool (keytool) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/rmiregistry to provide /usr/bin/rmiregistry (rmiregistry) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/lib/jexec to provide /usr/bin/jexec (jexec) in auto mode Setting up gnupg (2.2.40-1.1) ... Setting up libgtk2.0-0:armhf (2.24.33-3) ... Setting up liblwp-protocol-https-perl (6.14-1) ... Setting up liberror-prone-java (2.18.0-1) ... Setting up libwww-perl (6.77-1) ... Setting up devscripts (2.23.7) ... Setting up libguava-java (32.0.1-1) ... Setting up javahelper (0.79) ... Setting up libplexus-container-default-java (2.1.1-1) ... Setting up libguice-java (4.2.3-2) ... Setting up libmaven3-core-java (3.8.7-2) ... Setting up libbyte-buddy-java (1.12.23-1) ... Setting up libmockito-java (2.23.0-2) ... Processing triggers for libc-bin (2.37-15) ... Processing triggers for ca-certificates-java (20240118) ... Adding debian:ACCVRAIZ1.pem Adding debian:AC_RAIZ_FNMT-RCM.pem Adding debian:AC_RAIZ_FNMT-RCM_SERVIDORES_SEGUROS.pem Adding debian:ANF_Secure_Server_Root_CA.pem Adding debian:Actalis_Authentication_Root_CA.pem Adding debian:AffirmTrust_Commercial.pem Adding debian:AffirmTrust_Networking.pem Adding debian:AffirmTrust_Premium.pem Adding debian:AffirmTrust_Premium_ECC.pem Adding debian:Amazon_Root_CA_1.pem Adding debian:Amazon_Root_CA_2.pem Adding debian:Amazon_Root_CA_3.pem Adding debian:Amazon_Root_CA_4.pem Adding debian:Atos_TrustedRoot_2011.pem Adding debian:Atos_TrustedRoot_Root_CA_ECC_TLS_2021.pem Adding debian:Atos_TrustedRoot_Root_CA_RSA_TLS_2021.pem Adding debian:Autoridad_de_Certificacion_Firmaprofesional_CIF_A62634068.pem Adding debian:BJCA_Global_Root_CA1.pem Adding debian:BJCA_Global_Root_CA2.pem Adding debian:Baltimore_CyberTrust_Root.pem Adding debian:Buypass_Class_2_Root_CA.pem Adding debian:Buypass_Class_3_Root_CA.pem Adding debian:CA_Disig_Root_R2.pem Adding debian:CFCA_EV_ROOT.pem Adding debian:COMODO_Certification_Authority.pem Adding debian:COMODO_ECC_Certification_Authority.pem Adding debian:COMODO_RSA_Certification_Authority.pem Adding debian:Certainly_Root_E1.pem Adding debian:Certainly_Root_R1.pem Adding debian:Certigna.pem Adding debian:Certigna_Root_CA.pem Adding debian:Certum_EC-384_CA.pem Adding debian:Certum_Trusted_Network_CA.pem Adding debian:Certum_Trusted_Network_CA_2.pem Adding debian:Certum_Trusted_Root_CA.pem Adding debian:CommScope_Public_Trust_ECC_Root-01.pem Adding debian:CommScope_Public_Trust_ECC_Root-02.pem Adding debian:CommScope_Public_Trust_RSA_Root-01.pem Adding debian:CommScope_Public_Trust_RSA_Root-02.pem Adding debian:Comodo_AAA_Services_root.pem Adding debian:D-TRUST_BR_Root_CA_1_2020.pem Adding debian:D-TRUST_EV_Root_CA_1_2020.pem Adding debian:D-TRUST_Root_Class_3_CA_2_2009.pem Adding debian:D-TRUST_Root_Class_3_CA_2_EV_2009.pem Adding debian:DigiCert_Assured_ID_Root_CA.pem Adding debian:DigiCert_Assured_ID_Root_G2.pem Adding debian:DigiCert_Assured_ID_Root_G3.pem Adding debian:DigiCert_Global_Root_CA.pem Adding debian:DigiCert_Global_Root_G2.pem Adding debian:DigiCert_Global_Root_G3.pem Adding debian:DigiCert_High_Assurance_EV_Root_CA.pem Adding debian:DigiCert_TLS_ECC_P384_Root_G5.pem Adding debian:DigiCert_TLS_RSA4096_Root_G5.pem Adding debian:DigiCert_Trusted_Root_G4.pem Adding debian:Entrust.net_Premium_2048_Secure_Server_CA.pem Adding debian:Entrust_Root_Certification_Authority.pem Adding debian:Entrust_Root_Certification_Authority_-_EC1.pem Adding debian:Entrust_Root_Certification_Authority_-_G2.pem Adding debian:Entrust_Root_Certification_Authority_-_G4.pem Adding debian:GDCA_TrustAUTH_R5_ROOT.pem Adding debian:GLOBALTRUST_2020.pem Adding debian:GTS_Root_R1.pem Adding debian:GTS_Root_R2.pem Adding debian:GTS_Root_R3.pem Adding debian:GTS_Root_R4.pem Adding debian:GlobalSign_ECC_Root_CA_-_R4.pem Adding debian:GlobalSign_ECC_Root_CA_-_R5.pem Adding debian:GlobalSign_Root_CA.pem Adding debian:GlobalSign_Root_CA_-_R3.pem Adding debian:GlobalSign_Root_CA_-_R6.pem Adding debian:GlobalSign_Root_E46.pem Adding debian:GlobalSign_Root_R46.pem Adding debian:Go_Daddy_Class_2_CA.pem Adding debian:Go_Daddy_Root_Certificate_Authority_-_G2.pem Adding debian:HARICA_TLS_ECC_Root_CA_2021.pem Adding debian:HARICA_TLS_RSA_Root_CA_2021.pem Adding debian:Hellenic_Academic_and_Research_Institutions_ECC_RootCA_2015.pem Adding debian:Hellenic_Academic_and_Research_Institutions_RootCA_2015.pem Adding debian:HiPKI_Root_CA_-_G1.pem Adding debian:Hongkong_Post_Root_CA_3.pem Adding debian:ISRG_Root_X1.pem Adding debian:ISRG_Root_X2.pem Adding debian:IdenTrust_Commercial_Root_CA_1.pem Adding debian:IdenTrust_Public_Sector_Root_CA_1.pem Adding debian:Izenpe.com.pem Adding debian:Microsec_e-Szigno_Root_CA_2009.pem Adding debian:Microsoft_ECC_Root_Certificate_Authority_2017.pem Adding debian:Microsoft_RSA_Root_Certificate_Authority_2017.pem Adding debian:NAVER_Global_Root_Certification_Authority.pem Adding debian:NetLock_Arany_=Class_Gold=_Főtanúsítvány.pem Adding debian:OISTE_WISeKey_Global_Root_GB_CA.pem Adding debian:OISTE_WISeKey_Global_Root_GC_CA.pem Adding debian:QuoVadis_Root_CA_1_G3.pem Adding debian:QuoVadis_Root_CA_2.pem Adding debian:QuoVadis_Root_CA_2_G3.pem Adding debian:QuoVadis_Root_CA_3.pem Adding debian:QuoVadis_Root_CA_3_G3.pem Adding debian:SSL.com_EV_Root_Certification_Authority_ECC.pem Adding debian:SSL.com_EV_Root_Certification_Authority_RSA_R2.pem Adding debian:SSL.com_Root_Certification_Authority_ECC.pem Adding debian:SSL.com_Root_Certification_Authority_RSA.pem Adding debian:SSL.com_TLS_ECC_Root_CA_2022.pem Adding debian:SSL.com_TLS_RSA_Root_CA_2022.pem Adding debian:SZAFIR_ROOT_CA2.pem Adding debian:Sectigo_Public_Server_Authentication_Root_E46.pem Adding debian:Sectigo_Public_Server_Authentication_Root_R46.pem Adding debian:SecureSign_RootCA11.pem Adding debian:SecureTrust_CA.pem Adding debian:Secure_Global_CA.pem Adding debian:Security_Communication_ECC_RootCA1.pem Adding debian:Security_Communication_RootCA2.pem Adding debian:Security_Communication_RootCA3.pem Adding debian:Security_Communication_Root_CA.pem Adding debian:Starfield_Class_2_CA.pem Adding debian:Starfield_Root_Certificate_Authority_-_G2.pem Adding debian:Starfield_Services_Root_Certificate_Authority_-_G2.pem Adding debian:SwissSign_Gold_CA_-_G2.pem Adding debian:SwissSign_Silver_CA_-_G2.pem Adding debian:T-TeleSec_GlobalRoot_Class_2.pem Adding debian:T-TeleSec_GlobalRoot_Class_3.pem Adding debian:TUBITAK_Kamu_SM_SSL_Kok_Sertifikasi_-_Surum_1.pem Adding debian:TWCA_Global_Root_CA.pem Adding debian:TWCA_Root_Certification_Authority.pem Adding debian:TeliaSonera_Root_CA_v1.pem Adding debian:Telia_Root_CA_v2.pem Adding debian:TrustAsia_Global_Root_CA_G3.pem Adding debian:TrustAsia_Global_Root_CA_G4.pem Adding debian:Trustwave_Global_Certification_Authority.pem Adding debian:Trustwave_Global_ECC_P256_Certification_Authority.pem Adding debian:Trustwave_Global_ECC_P384_Certification_Authority.pem Adding debian:TunTrust_Root_CA.pem Adding debian:UCA_Extended_Validation_Root.pem Adding debian:UCA_Global_G2_Root.pem Adding debian:USERTrust_ECC_Certification_Authority.pem Adding debian:USERTrust_RSA_Certification_Authority.pem Adding debian:XRamp_Global_CA_Root.pem Adding debian:certSIGN_ROOT_CA.pem Adding debian:certSIGN_Root_CA_G2.pem Adding debian:e-Szigno_Root_CA_2017.pem Adding debian:ePKI_Root_Certification_Authority.pem Adding debian:emSign_ECC_Root_CA_-_C3.pem Adding debian:emSign_ECC_Root_CA_-_G3.pem Adding debian:emSign_Root_CA_-_C1.pem Adding debian:emSign_Root_CA_-_G1.pem Adding debian:vTrus_ECC_Root_CA.pem Adding debian:vTrus_Root_CA.pem done. Setting up maven-repo-helper (1.11) ... Setting up antlr (2.7.7+dfsg-13) ... Setting up openjdk-17-jdk-headless:armhf (17.0.10+7-1) ... update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/jar to provide /usr/bin/jar (jar) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/jarsigner to provide /usr/bin/jarsigner (jarsigner) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/javac to provide /usr/bin/javac (javac) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/javadoc to provide /usr/bin/javadoc (javadoc) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/javap to provide /usr/bin/javap (javap) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/jcmd to provide /usr/bin/jcmd (jcmd) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/jdb to provide /usr/bin/jdb (jdb) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/jdeprscan to provide /usr/bin/jdeprscan (jdeprscan) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/jdeps to provide /usr/bin/jdeps (jdeps) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/jfr to provide /usr/bin/jfr (jfr) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/jimage to provide /usr/bin/jimage (jimage) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/jinfo to provide /usr/bin/jinfo (jinfo) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/jlink to provide /usr/bin/jlink (jlink) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/jmap to provide /usr/bin/jmap (jmap) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/jmod to provide /usr/bin/jmod (jmod) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/jps to provide /usr/bin/jps (jps) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/jrunscript to provide /usr/bin/jrunscript (jrunscript) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/jshell to provide /usr/bin/jshell (jshell) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/jstack to provide /usr/bin/jstack (jstack) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/jstat to provide /usr/bin/jstat (jstat) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/jstatd to provide /usr/bin/jstatd (jstatd) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/serialver to provide /usr/bin/serialver (serialver) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/jhsdb to provide /usr/bin/jhsdb (jhsdb) in auto mode Setting up ivy (2.5.2-1) ... Setting up ant (1.10.14-1) ... Setting up junit4 (4.13.2-4) ... Setting up groovy (2.4.21-10) ... update-alternatives: using /usr/share/groovy/bin/groovy to provide /usr/bin/groovy (groovy) in auto mode update-alternatives: using /usr/share/groovy/bin/groovyc to provide /usr/bin/groovyc (groovyc) in auto mode update-alternatives: using /usr/share/groovy/bin/grape to provide /usr/bin/grape (grape) in auto mode update-alternatives: using /usr/share/groovy/bin/startGroovy to provide /usr/bin/startGroovy (startGroovy) in auto mode update-alternatives: using /usr/share/groovy/bin/groovysh to provide /usr/bin/groovysh (groovysh) in auto mode update-alternatives: using /usr/share/groovy/bin/java2groovy to provide /usr/bin/java2groovy (java2groovy) in auto mode update-alternatives: using /usr/share/groovy/bin/groovyConsole to provide /usr/bin/groovyConsole (groovyConsole) in auto mode update-alternatives: using /usr/share/groovy/bin/groovydoc to provide /usr/bin/groovydoc (groovydoc) in auto mode Setting up default-jre-headless (2:1.17-75) ... Setting up openjdk-17-jre:armhf (17.0.10+7-1) ... Setting up default-jre (2:1.17-75) ... Setting up openjdk-17-jdk:armhf (17.0.10+7-1) ... update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/jconsole to provide /usr/bin/jconsole (jconsole) in auto mode Setting up ant-optional (1.10.14-1) ... Setting up bnd (5.0.1-5) ... Setting up default-jdk-headless (2:1.17-75) ... Setting up libgradle-core-java (4.4.1-20) ... Setting up libgradle-plugins-java (4.4.1-20) ... Setting up gradle (4.4.1-20) ... Setting up default-jdk (2:1.17-75) ... Setting up gradle-debian-helper (2.4) ... Processing triggers for ca-certificates (20240203) ... Updating certificates in /etc/ssl/certs... 0 added, 0 removed; done. Running hooks in /etc/ca-certificates/update.d... done. Processing triggers for ca-certificates-java (20240118) ... done. Reading package lists... Building dependency tree... Reading state information... Reading extended state information... Initializing package states... Writing extended state information... Building tag database... -> Finished parsing the build-deps I: Building the package I: Running cd /build/reproducible-path/milib-2.2.0+dfsg/ && env PATH="/usr/sbin:/usr/bin:/sbin:/bin:/usr/games" HOME="/nonexistent/first-build" dpkg-buildpackage -us -uc -b && env PATH="/usr/sbin:/usr/bin:/sbin:/bin:/usr/games" HOME="/nonexistent/first-build" dpkg-genchanges -S > ../milib_2.2.0+dfsg-1_source.changes dpkg-buildpackage: info: source package milib dpkg-buildpackage: info: source version 2.2.0+dfsg-1 dpkg-buildpackage: info: source distribution unstable dpkg-buildpackage: info: source changed by Pierre Gruet dpkg-source --before-build . dpkg-buildpackage: info: host architecture armhf debian/rules clean dh clean --with javahelper --with maven_repo_helper debian/rules override_dh_auto_clean make[1]: Entering directory '/build/reproducible-path/milib-2.2.0+dfsg' dh_auto_clean # Clearing the build.gradle file we provide rm build.gradle rm: cannot remove 'build.gradle': No such file or directory make[1]: [debian/rules:11: override_dh_auto_clean] Error 1 (ignored) make[1]: Leaving directory '/build/reproducible-path/milib-2.2.0+dfsg' jh_clean dh_clean debian/rules binary dh binary --with javahelper --with maven_repo_helper dh_update_autotools_config dh_autoreconf debian/rules override_dh_auto_configure make[1]: Entering directory '/build/reproducible-path/milib-2.2.0+dfsg' # Adding the upstream version number (without +dfsg) to the build.gradle file # we got by patching build.gradle.kts sed "s/\(^group.*\)/\1\nversion = '2.2.0+dfsg'/ ; s/\+dfsg[[:digit:]]*//" build.gradle.kts > build.gradle dh_auto_configure make[1]: Leaving directory '/build/reproducible-path/milib-2.2.0+dfsg' jh_linkjars dh_auto_build mkdir -p .gradle/init.d cp /usr/share/gradle-debian-helper/init.gradle .gradle/init.d/ gradle --info --console plain --offline --stacktrace --no-daemon --refresh-dependencies --gradle-user-home .gradle -Duser.home=. -Duser.name=debian -Ddebian.package=milib -Dfile.encoding=UTF-8 --parallel --max-workers=3 jar openjdk version "17.0.10" 2024-01-16 OpenJDK Runtime Environment (build 17.0.10+7-Debian-1) OpenJDK Server VM (build 17.0.10+7-Debian-1, mixed mode, sharing) Initialized native services in: /build/reproducible-path/milib-2.2.0+dfsg/.gradle/native To honour the JVM settings for this build a new JVM will be forked. Please consider using the daemon: https://docs.gradle.org/4.4.1/userguide/gradle_daemon.html. Starting process 'Gradle build daemon'. Working directory: /build/reproducible-path/milib-2.2.0+dfsg/.gradle/daemon/4.4.1 Command: /usr/lib/jvm/java-17-openjdk-armhf/bin/java --add-opens java.base/java.lang=ALL-UNNAMED -Xbootclasspath/a:/usr/share/java/gradle-helper-hook.jar:/usr/share/java/maven-repo-helper.jar -Dfile.encoding=UTF-8 -Duser.country=US -Duser.language=en -Duser.variant -cp /usr/share/gradle/lib/gradle-launcher-4.4.1.jar org.gradle.launcher.daemon.bootstrap.GradleDaemon 4.4.1 Successfully started process 'Gradle build daemon' An attempt to start the daemon took 3.397 secs. The client will now receive all logging from the daemon (pid: 31539). The daemon log file: /build/reproducible-path/milib-2.2.0+dfsg/.gradle/daemon/4.4.1/daemon-31539.out.log Daemon will be stopped at the end of the build stopping after processing Closing daemon's stdin at end of input. The daemon will no longer process any standard input. Using 3 worker leases. Creating new cache for fileHashes, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/caches/4.4.1/fileHashes/fileHashes.bin, access org.gradle.cache.internal.DefaultCacheAccess@1d4b4e6 Creating new cache for resourceHashesCache, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/caches/4.4.1/fileHashes/resourceHashesCache.bin, access org.gradle.cache.internal.DefaultCacheAccess@1d4b4e6 Creating new cache for fileHashes, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/4.4.1/fileHashes/fileHashes.bin, access org.gradle.cache.internal.DefaultCacheAccess@5ffc5b Starting Build Compiling initialization script '/build/reproducible-path/milib-2.2.0+dfsg/.gradle/init.d/init.gradle' using SubsetScriptTransformer. Creating new cache for metadata-1.1/results, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/caches/transforms-1/metadata-1.1/results.bin, access org.gradle.cache.internal.DefaultCacheAccess@14b4cf3 Compiling initialization script '/build/reproducible-path/milib-2.2.0+dfsg/.gradle/init.d/init.gradle' using BuildScriptTransformer. Settings evaluated using settings file '/build/reproducible-path/milib-2.2.0+dfsg/settings.gradle'. Settings file not found (/build/reproducible-path/milib-2.2.0+dfsg/settings.gradle) Root project name not defined in settings.gradle, defaulting to 'milib' instead of the name of the root directory 'milib-2.2.0+dfsg' Projects loaded. Root project using build file '/build/reproducible-path/milib-2.2.0+dfsg/build.gradle'. Included projects: [root project 'milib'] Keep-alive timer started Adding Debian repository to project 'milib' Parallel execution is an incubating feature. Evaluating root project 'milib' using build file '/build/reproducible-path/milib-2.2.0+dfsg/build.gradle'. Compiling build file '/build/reproducible-path/milib-2.2.0+dfsg/build.gradle' using SubsetScriptTransformer. Compiling build file '/build/reproducible-path/milib-2.2.0+dfsg/build.gradle' using BuildScriptTransformer. Adding Maven pom generation to project 'milib' Linking the generated javadoc to the system JDK API documentation All projects evaluated. Selected primary task 'jar' from project : Creating new cache for annotation-processors, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/4.4.1/fileContent/annotation-processors.bin, access org.gradle.cache.internal.DefaultCacheAccess@e1761a Tasks to be executed: [task ':compileJava', task ':processResources', task ':classes', task ':debianMavenPom', task ':jar'] Creating new cache for resourceHashesCache, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/4.4.1/fileHashes/resourceHashesCache.bin, access org.gradle.cache.internal.DefaultCacheAccess@5ffc5b Creating new cache for taskHistory, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/4.4.1/taskHistory/taskHistory.bin, access org.gradle.cache.internal.DefaultCacheAccess@352dbe Creating new cache for outputFiles, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/buildOutputCleanup/outputFiles.bin, access org.gradle.cache.internal.DefaultCacheAccess@11ec6d0 :compileJava (Thread[Task worker for ':',5,main]) started. :compileJava Putting task artifact state for task ':compileJava' into context took 0.028 secs. Creating new cache for metadata-2.36/module-metadata, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/caches/modules-2/metadata-2.36/module-metadata.bin, access org.gradle.cache.internal.DefaultCacheAccess@18d65a5 Loading the Maven rules... Replacing org.apache.commons:commons-math3:jar:3.6.1 -> org.apache.commons:commons-math3:jar:debian Replacing cc.redberry:pipe:jar:1.3.0 -> cc.redberry:pipe:jar:1.0.0-alpha0 Replacing com.fasterxml.jackson:jackson-bom:jar:2.14.0 -> com.fasterxml.jackson:jackson-bom:jar:debian Passing through com.fasterxml.jackson:jackson-parent:jar:debian Passing through com.fasterxml:oss-parent:jar:debian Passing through com.fasterxml.jackson.core:jackson-databind:jar:2.x Passing through com.fasterxml.jackson:jackson-base:jar:debian Passing through com.fasterxml.jackson:jackson-bom:jar:debian Replacing org.apache.commons:commons-compress:jar:1.21 -> org.apache.commons:commons-compress:jar:debian Passing through org.apache.commons:commons-parent:jar:debian Passing through org.apache:apache:jar:debian Replacing commons-io:commons-io:jar:2.11.0 -> commons-io:commons-io:jar:debian Replacing org.lz4:lz4-java:jar:1.8.0 -> org.lz4:lz4-java:jar:debian Replacing com.beust:jcommander:jar:1.72 -> com.beust:jcommander:jar:debian Replacing net.sf.trove4j:trove4j:jar:3.0.3 -> net.sf.trove4j:trove4j:jar:debian Replacing com.google.guava:guava:jar:31.1-jre -> com.google.guava:guava:jar:debian Passing through com.google.guava:guava-parent:jar:debian Passing through com.fasterxml.jackson.core:jackson-annotations:jar:2.x Passing through com.fasterxml.jackson.core:jackson-core:jar:2.x Passing through org.jsr-305:jsr305:jar:0.x Passing through com.google.errorprone:error_prone_annotations:jar:debian Passing through com.google.errorprone:error_prone_parent:jar:debian Malformed jar [jackson-databind-2.x.jar] found on classpath. Gradle 5.0 will no longer allow malformed jars on a classpath. at org.gradle.api.internal.changedetection.state.AbstractClasspathSnapshotBuilder$JarHasher.hashMalformedZip(AbstractClasspathSnapshotBuilder.java:120) at org.gradle.api.internal.changedetection.state.AbstractClasspathSnapshotBuilder$JarHasher.hashJarContents(AbstractClasspathSnapshotBuilder.java:115) at org.gradle.api.internal.changedetection.state.AbstractClasspathSnapshotBuilder$JarHasher.hash(AbstractClasspathSnapshotBuilder.java:93) at org.gradle.api.internal.changedetection.state.ResourceSnapshotterCacheService.hashFile(ResourceSnapshotterCacheService.java:44) at org.gradle.api.internal.changedetection.state.AbstractClasspathSnapshotBuilder.visitJar(AbstractClasspathSnapshotBuilder.java:83) at org.gradle.api.internal.changedetection.state.AbstractClasspathSnapshotBuilder.visitFileSnapshot(AbstractClasspathSnapshotBuilder.java:76) at org.gradle.api.internal.changedetection.state.AbstractFileCollectionSnapshotter$FileCollectionVisitorImpl.visitCollection(AbstractFileCollectionSnapshotter.java:77) at org.gradle.api.internal.file.AbstractFileCollection.visitRootElements(AbstractFileCollection.java:234) at org.gradle.api.internal.file.CompositeFileCollection.visitRootElements(CompositeFileCollection.java:185) at org.gradle.api.internal.changedetection.state.AbstractFileCollectionSnapshotter.snapshot(AbstractFileCollectionSnapshotter.java:53) at org.gradle.api.internal.changedetection.state.DefaultCompileClasspathSnapshotter.snapshot(DefaultCompileClasspathSnapshotter.java:38) at org.gradle.api.internal.changedetection.state.CacheBackedTaskHistoryRepository.snapshotTaskFiles(CacheBackedTaskHistoryRepository.java:331) at org.gradle.api.internal.changedetection.state.CacheBackedTaskHistoryRepository.createExecution(CacheBackedTaskHistoryRepository.java:154) at org.gradle.api.internal.changedetection.state.CacheBackedTaskHistoryRepository.access$100(CacheBackedTaskHistoryRepository.java:61) at org.gradle.api.internal.changedetection.state.CacheBackedTaskHistoryRepository$1.getCurrentExecution(CacheBackedTaskHistoryRepository.java:114) at org.gradle.api.internal.changedetection.changes.DefaultTaskArtifactStateRepository$TaskArtifactStateImpl.getStates(DefaultTaskArtifactStateRepository.java:201) at org.gradle.api.internal.changedetection.changes.DefaultTaskArtifactStateRepository$TaskArtifactStateImpl.isUpToDate(DefaultTaskArtifactStateRepository.java:86) at org.gradle.api.internal.tasks.execution.SkipUpToDateTaskExecuter.execute(SkipUpToDateTaskExecuter.java:53) at org.gradle.api.internal.tasks.execution.ResolveTaskOutputCachingStateExecuter.execute(ResolveTaskOutputCachingStateExecuter.java:54) at org.gradle.api.internal.tasks.execution.ValidatingTaskExecuter.execute(ValidatingTaskExecuter.java:60) at org.gradle.api.internal.tasks.execution.SkipEmptySourceFilesTaskExecuter.execute(SkipEmptySourceFilesTaskExecuter.java:97) at org.gradle.api.internal.tasks.execution.CleanupStaleOutputsExecuter.execute(CleanupStaleOutputsExecuter.java:87) at org.gradle.api.internal.tasks.execution.ResolveTaskArtifactStateTaskExecuter.execute(ResolveTaskArtifactStateTaskExecuter.java:52) at org.gradle.api.internal.tasks.execution.SkipTaskWithNoActionsExecuter.execute(SkipTaskWithNoActionsExecuter.java:52) at org.gradle.api.internal.tasks.execution.SkipOnlyIfTaskExecuter.execute(SkipOnlyIfTaskExecuter.java:54) at org.gradle.api.internal.tasks.execution.ExecuteAtMostOnceTaskExecuter.execute(ExecuteAtMostOnceTaskExecuter.java:43) at org.gradle.api.internal.tasks.execution.CatchExceptionTaskExecuter.execute(CatchExceptionTaskExecuter.java:34) at org.gradle.execution.taskgraph.DefaultTaskGraphExecuter$EventFiringTaskWorker$1.run(DefaultTaskGraphExecuter.java:248) at org.gradle.internal.progress.DefaultBuildOperationExecutor$RunnableBuildOperationWorker.execute(DefaultBuildOperationExecutor.java:336) at org.gradle.internal.progress.DefaultBuildOperationExecutor$RunnableBuildOperationWorker.execute(DefaultBuildOperationExecutor.java:328) at org.gradle.internal.progress.DefaultBuildOperationExecutor.execute(DefaultBuildOperationExecutor.java:199) at org.gradle.internal.progress.DefaultBuildOperationExecutor.run(DefaultBuildOperationExecutor.java:110) at org.gradle.execution.taskgraph.DefaultTaskGraphExecuter$EventFiringTaskWorker.execute(DefaultTaskGraphExecuter.java:241) at org.gradle.execution.taskgraph.DefaultTaskGraphExecuter$EventFiringTaskWorker.execute(DefaultTaskGraphExecuter.java:230) at org.gradle.execution.taskgraph.DefaultTaskPlanExecutor$TaskExecutorWorker.processTask(DefaultTaskPlanExecutor.java:123) at org.gradle.execution.taskgraph.DefaultTaskPlanExecutor$TaskExecutorWorker.access$200(DefaultTaskPlanExecutor.java:79) at org.gradle.execution.taskgraph.DefaultTaskPlanExecutor$TaskExecutorWorker$1.execute(DefaultTaskPlanExecutor.java:104) at org.gradle.execution.taskgraph.DefaultTaskPlanExecutor$TaskExecutorWorker$1.execute(DefaultTaskPlanExecutor.java:98) at org.gradle.execution.taskgraph.DefaultTaskExecutionPlan.execute(DefaultTaskExecutionPlan.java:626) at org.gradle.execution.taskgraph.DefaultTaskExecutionPlan.executeWithTask(DefaultTaskExecutionPlan.java:581) at org.gradle.execution.taskgraph.DefaultTaskPlanExecutor$TaskExecutorWorker.run(DefaultTaskPlanExecutor.java:98) at org.gradle.internal.concurrent.ExecutorPolicy$CatchAndRecordFailures.onExecute(ExecutorPolicy.java:63) at org.gradle.internal.concurrent.ManagedExecutorImpl$1.run(ManagedExecutorImpl.java:46) at java.base/java.util.concurrent.ThreadPoolExecutor.runWorker(ThreadPoolExecutor.java:1136) at java.base/java.util.concurrent.ThreadPoolExecutor$Worker.run(ThreadPoolExecutor.java:635) at org.gradle.internal.concurrent.ThreadFactoryImpl$ManagedThreadRunnable.run(ThreadFactoryImpl.java:55) at java.base/java.lang.Thread.run(Thread.java:840) Up-to-date check for task ':compileJava' took 14.333 secs. It is not up-to-date because: No history is available. All input files are considered out-of-date for incremental task ':compileJava'. Compiling with JDK Java compiler API. Note: Some input files use or override a deprecated API. Note: Recompile with -Xlint:deprecation for details. Note: Some input files use unchecked or unsafe operations. Note: Recompile with -Xlint:unchecked for details. :compileJava (Thread[Task worker for ':',5,main]) completed. Took 39.846 secs. :processResources (Thread[Task worker for ':',5,main]) started. :processResources Putting task artifact state for task ':processResources' into context took 0.0 secs. Up-to-date check for task ':processResources' took 0.03 secs. It is not up-to-date because: No history is available. :processResources (Thread[Task worker for ':',5,main]) completed. Took 0.125 secs. :classes (Thread[Task worker for ':',5,main]) started. :classes Skipping task ':classes' as it has no actions. :classes (Thread[Task worker for ':',5,main]) completed. Took 0.002 secs. :debianMavenPom (Thread[Task worker for ':',5,main]) started. :debianMavenPom Putting task artifact state for task ':debianMavenPom' into context took 0.0 secs. Up-to-date check for task ':debianMavenPom' took 0.009 secs. It is not up-to-date because: No history is available. Generating pom file /build/reproducible-path/milib-2.2.0+dfsg/build/debian/milib.pom :debianMavenPom (Thread[Task worker for ':',5,main]) completed. Took 0.452 secs. :jar (Thread[Task worker for ':',5,main]) started. :jar Putting task artifact state for task ':jar' into context took 0.0 secs. Up-to-date check for task ':jar' took 0.156 secs. It is not up-to-date because: No history is available. :jar (Thread[Task worker for ':',5,main]) completed. Took 0.887 secs. BUILD SUCCESSFUL in 1m 0s 4 actionable tasks: 4 executed dh_auto_test mkdir -p .gradle/init.d cp /usr/share/gradle-debian-helper/init.gradle .gradle/init.d/ gradle --info --console plain --offline --stacktrace --no-daemon --refresh-dependencies --gradle-user-home .gradle -Duser.home=. -Duser.name=debian -Ddebian.package=milib -Dfile.encoding=UTF-8 --parallel --max-workers=3 test openjdk version "17.0.10" 2024-01-16 OpenJDK Runtime Environment (build 17.0.10+7-Debian-1) OpenJDK Server VM (build 17.0.10+7-Debian-1, mixed mode, sharing) Initialized native services in: /build/reproducible-path/milib-2.2.0+dfsg/.gradle/native To honour the JVM settings for this build a new JVM will be forked. Please consider using the daemon: https://docs.gradle.org/4.4.1/userguide/gradle_daemon.html. Starting process 'Gradle build daemon'. Working directory: /build/reproducible-path/milib-2.2.0+dfsg/.gradle/daemon/4.4.1 Command: /usr/lib/jvm/java-17-openjdk-armhf/bin/java --add-opens java.base/java.lang=ALL-UNNAMED -Xbootclasspath/a:/usr/share/java/gradle-helper-hook.jar:/usr/share/java/maven-repo-helper.jar -Dfile.encoding=UTF-8 -Duser.country=US -Duser.language=en -Duser.variant -cp /usr/share/gradle/lib/gradle-launcher-4.4.1.jar org.gradle.launcher.daemon.bootstrap.GradleDaemon 4.4.1 Successfully started process 'Gradle build daemon' An attempt to start the daemon took 2.923 secs. The client will now receive all logging from the daemon (pid: 32187). The daemon log file: /build/reproducible-path/milib-2.2.0+dfsg/.gradle/daemon/4.4.1/daemon-32187.out.log Daemon will be stopped at the end of the build stopping after processing Closing daemon's stdin at end of input. The daemon will no longer process any standard input. Using 3 worker leases. Creating new cache for fileHashes, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/caches/4.4.1/fileHashes/fileHashes.bin, access org.gradle.cache.internal.DefaultCacheAccess@a6efaa Creating new cache for resourceHashesCache, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/caches/4.4.1/fileHashes/resourceHashesCache.bin, access org.gradle.cache.internal.DefaultCacheAccess@a6efaa Creating new cache for fileHashes, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/4.4.1/fileHashes/fileHashes.bin, access org.gradle.cache.internal.DefaultCacheAccess@fb60f3 Starting Build Creating new cache for metadata-1.1/results, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/caches/transforms-1/metadata-1.1/results.bin, access org.gradle.cache.internal.DefaultCacheAccess@fe7bd5 Settings evaluated using settings file '/build/reproducible-path/milib-2.2.0+dfsg/settings.gradle'. Settings file not found (/build/reproducible-path/milib-2.2.0+dfsg/settings.gradle) Root project name not defined in settings.gradle, defaulting to 'milib' instead of the name of the root directory 'milib-2.2.0+dfsg' Projects loaded. Root project using build file '/build/reproducible-path/milib-2.2.0+dfsg/build.gradle'. Included projects: [root project 'milib'] Keep-alive timer started Adding Debian repository to project 'milib' Parallel execution is an incubating feature. Evaluating root project 'milib' using build file '/build/reproducible-path/milib-2.2.0+dfsg/build.gradle'. Adding Maven pom generation to project 'milib' Linking the generated javadoc to the system JDK API documentation All projects evaluated. Selected primary task 'test' from project : Creating new cache for annotation-processors, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/4.4.1/fileContent/annotation-processors.bin, access org.gradle.cache.internal.DefaultCacheAccess@245dc9 Tasks to be executed: [task ':compileJava', task ':processResources', task ':classes', task ':compileTestJava', task ':processTestResources', task ':testClasses', task ':test'] Creating new cache for resourceHashesCache, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/4.4.1/fileHashes/resourceHashesCache.bin, access org.gradle.cache.internal.DefaultCacheAccess@fb60f3 Creating new cache for taskHistory, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/4.4.1/taskHistory/taskHistory.bin, access org.gradle.cache.internal.DefaultCacheAccess@579644 Creating new cache for outputFiles, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/buildOutputCleanup/outputFiles.bin, access org.gradle.cache.internal.DefaultCacheAccess@1aa9b0a :compileJava (Thread[Task worker for ':',5,main]) started. :compileJava Putting task artifact state for task ':compileJava' into context took 0.015 secs. Creating new cache for metadata-2.36/module-metadata, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/caches/modules-2/metadata-2.36/module-metadata.bin, access org.gradle.cache.internal.DefaultCacheAccess@5451a9 Loading the Maven rules... Replacing org.apache.commons:commons-math3:jar:3.6.1 -> org.apache.commons:commons-math3:jar:debian Replacing cc.redberry:pipe:jar:1.3.0 -> cc.redberry:pipe:jar:1.0.0-alpha0 Replacing com.fasterxml.jackson:jackson-bom:jar:2.14.0 -> com.fasterxml.jackson:jackson-bom:jar:debian Passing through com.fasterxml.jackson:jackson-parent:jar:debian Passing through com.fasterxml:oss-parent:jar:debian Passing through com.fasterxml.jackson.core:jackson-databind:jar:2.x Passing through com.fasterxml.jackson:jackson-base:jar:debian Passing through com.fasterxml.jackson:jackson-bom:jar:debian Replacing org.apache.commons:commons-compress:jar:1.21 -> org.apache.commons:commons-compress:jar:debian Passing through org.apache.commons:commons-parent:jar:debian Passing through org.apache:apache:jar:debian Replacing commons-io:commons-io:jar:2.11.0 -> commons-io:commons-io:jar:debian Replacing org.lz4:lz4-java:jar:1.8.0 -> org.lz4:lz4-java:jar:debian Replacing com.beust:jcommander:jar:1.72 -> com.beust:jcommander:jar:debian Replacing net.sf.trove4j:trove4j:jar:3.0.3 -> net.sf.trove4j:trove4j:jar:debian Replacing com.google.guava:guava:jar:31.1-jre -> com.google.guava:guava:jar:debian Passing through com.google.guava:guava-parent:jar:debian Passing through com.fasterxml.jackson.core:jackson-annotations:jar:2.x Passing through com.fasterxml.jackson.core:jackson-core:jar:2.x Passing through org.jsr-305:jsr305:jar:0.x Passing through com.google.errorprone:error_prone_annotations:jar:debian Passing through com.google.errorprone:error_prone_parent:jar:debian Skipping task ':compileJava' as it is up-to-date (took 2.823 secs). :compileJava UP-TO-DATE :compileJava (Thread[Task worker for ':',5,main]) completed. Took 2.918 secs. :processResources (Thread[Task worker for ':',5,main]) started. :processResources Putting task artifact state for task ':processResources' into context took 0.0 secs. Skipping task ':processResources' as it is up-to-date (took 0.03 secs). :processResources UP-TO-DATE :processResources (Thread[Task worker for ':',5,main]) completed. Took 0.042 secs. :classes (Thread[Task worker for ':',5,main]) started. :classes Skipping task ':classes' as it has no actions. :classes UP-TO-DATE :classes (Thread[Task worker for ':',5,main]) completed. Took 0.005 secs. :compileTestJava (Thread[Task worker for ':',5,main]) started. :compileTestJava Putting task artifact state for task ':compileTestJava' into context took 0.0 secs. Replacing junit:junit:jar:4.13.2 -> junit:junit:jar:4.x Replacing org.mockito:mockito-all:jar:1.10.19 -> org.mockito:mockito-all:jar:debian org.mockito:mockito-all:debian is relocated to org.mockito:mockito-core:debian. Please update your dependencies. Passing through org.hamcrest:hamcrest:jar:debian Passing through org.mockito:mockito-core:jar:debian Passing through net.bytebuddy:byte-buddy:jar:debian Passing through net.bytebuddy:byte-buddy-parent:jar:debian Passing through net.bytebuddy:byte-buddy-agent:jar:debian Passing through org.objenesis:objenesis:jar:debian Passing through org.objenesis:objenesis-parent:jar:debian Passing through net.bytebuddy:byte-buddy-dep:jar:debian Passing through org.ow2.asm:asm:jar:debian Passing through org.ow2.asm:asm-commons:jar:debian Up-to-date check for task ':compileTestJava' took 7.264 secs. It is not up-to-date because: No history is available. All input files are considered out-of-date for incremental task ':compileTestJava'. Compiling with JDK Java compiler API. Note: Some input files use or override a deprecated API. Note: Recompile with -Xlint:deprecation for details. Note: Some input files use unchecked or unsafe operations. Note: Recompile with -Xlint:unchecked for details. :compileTestJava (Thread[Task worker for ':',5,main]) completed. Took 27.285 secs. :processTestResources (Thread[Task worker for ':',5,main]) started. :processTestResources Putting task artifact state for task ':processTestResources' into context took 0.0 secs. Up-to-date check for task ':processTestResources' took 0.081 secs. It is not up-to-date because: No history is available. :processTestResources (Thread[Task worker for ':',5,main]) completed. Took 0.159 secs. :testClasses (Thread[Task worker for ':',5,main]) started. :testClasses Skipping task ':testClasses' as it has no actions. :testClasses (Thread[Task worker for ':',5,main]) completed. Took 0.001 secs. :test (Thread[Task worker for ':',5,main]) started. :test Putting task artifact state for task ':test' into context took 0.0 secs. Up-to-date check for task ':test' took 2.385 secs. It is not up-to-date because: No history is available. Starting process 'Gradle Test Executor 1'. Working directory: /build/reproducible-path/milib-2.2.0+dfsg Command: /usr/lib/jvm/java-17-openjdk-armhf/bin/java -Dorg.gradle.native=false @/tmp/gradle-worker-classpath5375013282113761975txt -Xms1024m -Xmx2048m -Dfile.encoding=UTF-8 -Duser.country=US -Duser.language=en -Duser.variant -ea worker.org.gradle.process.internal.worker.GradleWorkerMain 'Gradle Test Executor 1' Successfully started process 'Gradle Test Executor 1' Gradle Test Executor 1 started executing tests. com.milaboratory.primitivio.blocks.PrimitivOBlocksTest > benchmark1 SKIPPED com.milaboratory.primitivio.blocks.PrimitivOBlocksTest > test1 STANDARD_OUT ================== High compression: false Concurrency: 4 File size: 6799510 Write time: 786.63ms O. Stats: Wall clock time: 807.74ms Total CPU time: 1.5s User wait time: 595.63ms Serialization time: 1.04s (68.95%) Checksum calculation time: 316.18ms (21.05%) Compression time: 85.73ms (5.71%) Total IO delay: 141.68ms Concurrency overhead: 137.65ms Uncompressed size: 18.44MiB (~2.08KiB per object) Output size: 6.48MiB (~748B per object; compression = 35.17%) IO speed: 45.99MiB/s Concurrency adjusted uncompressed speed: 33.64MiB/s Actual uncompressed speed: 22.85MiB/s Actual speed: 8.04MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 748B Blocks: 62 (~107.1KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 1: Wall clock time: 536.76ms Total CPU time: 625.88ms Serialization time: 508.16ms (81.19%) Checksum calculation time: 48.06ms (7.68%) Compression time: 62.24ms (9.95%) Total IO delay: 149.98ms Input size: 6.48MiB Decompressed size: 18.44MiB (compression = 35.17%) IO speed: 43.52MiB/s Concurrency adjusted uncompressed speed: 95.53MiB/s Actual uncompressed speed: 34.4MiB/s Actual speed: 12.1MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 748B Blocks: 62 (~107.1KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Pending / IO / Serde: 0 / 0 / 0 I. Stats 2: Wall clock time: 1.04s Total CPU time: 881.18ms Serialization time: 640.14ms (72.65%) Checksum calculation time: 94.73ms (10.75%) Compression time: 129.94ms (14.75%) Total IO delay: 327.23ms Input size: 12.97MiB Decompressed size: 36.87MiB (compression = 35.17%) IO speed: 39.66MiB/s Concurrency adjusted uncompressed speed: 122.1MiB/s Actual uncompressed speed: 35.35MiB/s Actual speed: 12.43MiB/s Objects: 18158 Average object size uncompressed: 2.08KiB Average object size compressed: 748B Blocks: 124 (~107.1KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 ================== High compression: false Concurrency: 4 File size: 6791878 Write time: 230.51ms O. Stats: Wall clock time: 233.12ms Total CPU time: 283.24ms User wait time: 181.91ms Serialization time: 135.56ms (47.86%) Checksum calculation time: 49.28ms (17.4%) Compression time: 86.64ms (30.59%) Total IO delay: 58.14ms Concurrency overhead: 13.97ms Uncompressed size: 18.44MiB (~2.08KiB per object) Output size: 6.48MiB (~748B per object; compression = 35.13%) IO speed: 111.68MiB/s Concurrency adjusted uncompressed speed: 186.23MiB/s Actual uncompressed speed: 79.13MiB/s Actual speed: 27.8MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 748B Blocks: 20 (~331.63KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 1: Wall clock time: 296.85ms Total CPU time: 282.9ms Serialization time: 134.26ms (47.46%) Checksum calculation time: 64.19ms (22.69%) Compression time: 83.42ms (29.49%) Total IO delay: 59.89ms Input size: 6.48MiB Decompressed size: 18.44MiB (compression = 35.13%) IO speed: 109.78MiB/s Concurrency adjusted uncompressed speed: 216.9MiB/s Actual uncompressed speed: 62.29MiB/s Actual speed: 21.88MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 748B Blocks: 20 (~331.63KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 2: Wall clock time: 595.98ms Total CPU time: 531.24ms Serialization time: 237.3ms (44.67%) Checksum calculation time: 125.47ms (23.62%) Compression time: 166.65ms (31.37%) Total IO delay: 103.21ms Input size: 12.95MiB Decompressed size: 36.87MiB (compression = 35.13%) IO speed: 125.77MiB/s Concurrency adjusted uncompressed speed: 233.38MiB/s Actual uncompressed speed: 61.97MiB/s Actual speed: 21.77MiB/s Objects: 18158 Average object size uncompressed: 2.08KiB Average object size compressed: 748B Blocks: 40 (~331.63KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 ================== High compression: false Concurrency: 1 File size: 6799510 Write time: 371.7ms O. Stats: Wall clock time: 373.28ms Total CPU time: 258.42ms User wait time: 328.57ms Serialization time: 122ms (47.21%) Checksum calculation time: 46.89ms (18.15%) Compression time: 72.16ms (27.92%) Total IO delay: 45.45ms Concurrency overhead: 9.45ms Uncompressed size: 18.44MiB (~2.08KiB per object) Output size: 6.48MiB (~748B per object; compression = 35.17%) IO speed: 144.1MiB/s Concurrency adjusted uncompressed speed: 58.9MiB/s Actual uncompressed speed: 49.43MiB/s Actual speed: 17.38MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 748B Blocks: 62 (~107.1KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Checksum ok! I. Stats 1: Wall clock time: 218.69ms Total CPU time: 232.75ms Serialization time: 109.45ms (47.03%) Checksum calculation time: 46.89ms (20.15%) Compression time: 73.03ms (31.38%) Total IO delay: 67.32ms Input size: 6.48MiB Decompressed size: 18.44MiB (compression = 35.17%) IO speed: 96.78MiB/s Concurrency adjusted uncompressed speed: 61.46MiB/s Actual uncompressed speed: 84.57MiB/s Actual speed: 29.75MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 748B Blocks: 62 (~107.1KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 2: Wall clock time: 510.86ms Total CPU time: 513.89ms Serialization time: 264.25ms (51.42%) Checksum calculation time: 93.43ms (18.18%) Compression time: 146.07ms (28.42%) Total IO delay: 205.47ms Input size: 12.97MiB Decompressed size: 36.87MiB (compression = 35.17%) IO speed: 63.26MiB/s Concurrency adjusted uncompressed speed: 51.28MiB/s Actual uncompressed speed: 72.3MiB/s Actual speed: 25.43MiB/s Objects: 18158 Average object size uncompressed: 2.08KiB Average object size compressed: 748B Blocks: 124 (~107.1KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 ================== High compression: false Concurrency: 1 File size: 6791878 Write time: 327.55ms O. Stats: Wall clock time: 329.83ms Total CPU time: 253.93ms User wait time: 292.75ms Serialization time: 123.46ms (48.62%) Checksum calculation time: 47.03ms (18.52%) Compression time: 72ms (28.35%) Total IO delay: 38.03ms Concurrency overhead: 2.24ms Uncompressed size: 18.44MiB (~2.08KiB per object) Output size: 6.48MiB (~748B per object; compression = 35.13%) IO speed: 170.45MiB/s Concurrency adjusted uncompressed speed: 62.71MiB/s Actual uncompressed speed: 56.04MiB/s Actual speed: 19.69MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 748B Blocks: 20 (~331.63KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Checksum ok! I. Stats 1: Wall clock time: 241.87ms Total CPU time: 250.03ms Serialization time: 100.46ms (40.18%) Checksum calculation time: 56.14ms (22.45%) Compression time: 92.59ms (37.03%) Total IO delay: 33.07ms Input size: 6.48MiB Decompressed size: 18.44MiB (compression = 35.13%) IO speed: 196.28MiB/s Concurrency adjusted uncompressed speed: 65.15MiB/s Actual uncompressed speed: 76.5MiB/s Actual speed: 26.88MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 748B Blocks: 20 (~331.63KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 2: Wall clock time: 544.4ms Total CPU time: 495.51ms Serialization time: 202.57ms (40.88%) Checksum calculation time: 112.34ms (22.67%) Compression time: 178.91ms (36.11%) Total IO delay: 76.51ms Input size: 12.95MiB Decompressed size: 36.87MiB (compression = 35.13%) IO speed: 170.45MiB/s Concurrency adjusted uncompressed speed: 64.46MiB/s Actual uncompressed speed: 67.78MiB/s Actual speed: 23.81MiB/s Objects: 18158 Average object size uncompressed: 2.08KiB Average object size compressed: 748B Blocks: 40 (~331.63KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Pending / IO / Serde: 0 / 0 / 4 Pending / IO / Serde: 2 / 0 / 1 ================== High compression: true Concurrency: 4 File size: 4156299 Write time: 3.96s O. Stats: Wall clock time: 3.97s Total CPU time: 10.55s User wait time: 3.77s Serialization time: 133.19ms (1.26%) Checksum calculation time: 58.88ms (0.56%) Compression time: 10.34s (98.01%) Total IO delay: 88.74ms Concurrency overhead: 61.64ms Uncompressed size: 18.44MiB (~2.08KiB per object) Output size: 3.96MiB (~457B per object; compression = 21.5%) IO speed: 45.04MiB/s Concurrency adjusted uncompressed speed: 6.78MiB/s Actual uncompressed speed: 4.65MiB/s Actual speed: 1023.68KiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 457B Blocks: 62 (~65.47KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 1: Wall clock time: 202ms Total CPU time: 186.11ms Serialization time: 80.95ms (43.5%) Checksum calculation time: 48.27ms (25.94%) Compression time: 52.81ms (28.38%) Total IO delay: 88.48ms Input size: 3.96MiB Decompressed size: 18.44MiB (compression = 21.5%) IO speed: 45.04MiB/s Concurrency adjusted uncompressed speed: 271.13MiB/s Actual uncompressed speed: 91.27MiB/s Actual speed: 19.62MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 457B Blocks: 62 (~65.47KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 2: Wall clock time: 455.3ms Total CPU time: 360.86ms Serialization time: 148.71ms (41.21%) Checksum calculation time: 97.45ms (27%) Compression time: 105.41ms (29.21%) Total IO delay: 211.17ms Input size: 7.93MiB Decompressed size: 36.87MiB (compression = 21.5%) IO speed: 37.57MiB/s Concurrency adjusted uncompressed speed: 257.86MiB/s Actual uncompressed speed: 81.04MiB/s Actual speed: 17.42MiB/s Objects: 18158 Average object size uncompressed: 2.08KiB Average object size compressed: 457B Blocks: 124 (~65.47KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Pending / IO / Serde: 2 / 0 / 2 Pending / IO / Serde: 3 / 0 / 1 ================== High compression: true Concurrency: 4 File size: 4098671 Write time: 5.72s O. Stats: Wall clock time: 5.72s Total CPU time: 9.55s User wait time: 5.23s Serialization time: 92.31ms (0.97%) Checksum calculation time: 47.24ms (0.49%) Compression time: 9.4s (98.47%) Total IO delay: 44.6ms Concurrency overhead: 6ms Uncompressed size: 18.44MiB (~2.08KiB per object) Output size: 3.91MiB (~451B per object; compression = 21.2%) IO speed: 88.84MiB/s Concurrency adjusted uncompressed speed: 7.67MiB/s Actual uncompressed speed: 3.22MiB/s Actual speed: 699.27KiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 451B Blocks: 20 (~200.13KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Pending / IO / Serde: 0 / 0 / 0 I. Stats 1: Wall clock time: 284.9ms Total CPU time: 245.53ms Serialization time: 93.76ms (38.19%) Checksum calculation time: 81.18ms (33.06%) Compression time: 69.61ms (28.35%) Total IO delay: 61.77ms Input size: 3.91MiB Decompressed size: 18.44MiB (compression = 21.2%) IO speed: 64.08MiB/s Concurrency adjusted uncompressed speed: 242.59MiB/s Actual uncompressed speed: 64.92MiB/s Actual speed: 13.76MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 451B Blocks: 20 (~200.13KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 2: Wall clock time: 583.65ms Total CPU time: 463.47ms Serialization time: 154.32ms (33.3%) Checksum calculation time: 162.27ms (35.01%) Compression time: 145.2ms (31.33%) Total IO delay: 104.98ms Input size: 7.82MiB Decompressed size: 36.87MiB (compression = 21.2%) IO speed: 75.17MiB/s Concurrency adjusted uncompressed speed: 259.67MiB/s Actual uncompressed speed: 63.25MiB/s Actual speed: 13.41MiB/s Objects: 18158 Average object size uncompressed: 2.08KiB Average object size compressed: 451B Blocks: 40 (~200.13KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 ================== High compression: true Concurrency: 1 File size: 4156299 Write time: 8.56s O. Stats: Wall clock time: 8.56s Total CPU time: 8.46s User wait time: 8.53s Serialization time: 105.18ms (1.24%) Checksum calculation time: 47.1ms (0.56%) Compression time: 8.3s (98.1%) Total IO delay: 44.46ms Concurrency overhead: 14.4ms Uncompressed size: 18.44MiB (~2.08KiB per object) Output size: 3.96MiB (~457B per object; compression = 21.5%) IO speed: 90.09MiB/s Concurrency adjusted uncompressed speed: 2.16MiB/s Actual uncompressed speed: 2.15MiB/s Actual speed: 473.95KiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 457B Blocks: 62 (~65.47KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Checksum ok! I. Stats 1: Wall clock time: 235ms Total CPU time: 200.76ms Serialization time: 72.6ms (36.16%) Checksum calculation time: 60.96ms (30.37%) Compression time: 62.91ms (31.33%) Total IO delay: 113.87ms Input size: 3.96MiB Decompressed size: 18.44MiB (compression = 21.5%) IO speed: 35.08MiB/s Concurrency adjusted uncompressed speed: 58.72MiB/s Actual uncompressed speed: 78.79MiB/s Actual speed: 16.94MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 457B Blocks: 62 (~65.47KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 2: Wall clock time: 472.24ms Total CPU time: 372.15ms Serialization time: 136.52ms (36.68%) Checksum calculation time: 108.63ms (29.19%) Compression time: 118.18ms (31.76%) Total IO delay: 200.84ms Input size: 7.93MiB Decompressed size: 36.87MiB (compression = 21.5%) IO speed: 39.64MiB/s Concurrency adjusted uncompressed speed: 64.46MiB/s Actual uncompressed speed: 78.12MiB/s Actual speed: 16.8MiB/s Objects: 18158 Average object size uncompressed: 2.08KiB Average object size compressed: 457B Blocks: 124 (~65.47KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 ================== High compression: true Concurrency: 1 File size: 4098671 Write time: 9.98s O. Stats: Wall clock time: 9.98s Total CPU time: 9.92s User wait time: 9.95s Serialization time: 100.99ms (1.02%) Checksum calculation time: 47.75ms (0.48%) Compression time: 9.76s (98.44%) Total IO delay: 30.78ms Concurrency overhead: 2.27ms Uncompressed size: 18.44MiB (~2.08KiB per object) Output size: 3.91MiB (~451B per object; compression = 21.2%) IO speed: 130.29MiB/s Concurrency adjusted uncompressed speed: 1.85MiB/s Actual uncompressed speed: 1.85MiB/s Actual speed: 401.22KiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 451B Blocks: 20 (~200.13KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Checksum ok! I. Stats 1: Wall clock time: 238.84ms Total CPU time: 221.58ms Serialization time: 73.44ms (33.14%) Checksum calculation time: 74.62ms (33.68%) Compression time: 72.9ms (32.9%) Total IO delay: 45.56ms Input size: 3.91MiB Decompressed size: 18.44MiB (compression = 21.2%) IO speed: 86.86MiB/s Concurrency adjusted uncompressed speed: 69.05MiB/s Actual uncompressed speed: 77.47MiB/s Actual speed: 16.42MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 451B Blocks: 20 (~200.13KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 2: Wall clock time: 520.96ms Total CPU time: 428.37ms Serialization time: 154.1ms (35.97%) Checksum calculation time: 130.73ms (30.52%) Compression time: 142.31ms (33.22%) Total IO delay: 87.64ms Input size: 7.82MiB Decompressed size: 36.87MiB (compression = 21.2%) IO speed: 89.86MiB/s Concurrency adjusted uncompressed speed: 71.46MiB/s Actual uncompressed speed: 70.91MiB/s Actual speed: 15.03MiB/s Objects: 18158 Average object size uncompressed: 2.08KiB Average object size compressed: 451B Blocks: 40 (~200.13KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 com.milaboratory.primitivio.blocks.PrimitivOBlocksTest > bigBlocks STANDARD_OUT Pending / IO / Serde / Objs: 0 / 1 / 1 / 1000 Pending / IO / Serde / Objs: 0 / 1 / 0 / 4000 Pending / IO / Serde / Objs: 0 / 1 / 1 / 7000 Pending / IO / Serde / Objs: 0 / 1 / 1 / 10000 Pending / IO / Serde / Objs: 1 / 1 / 0 / 14000 Pending / IO / Serde / Objs: 0 / 1 / 1 / 17000 Pending / IO / Serde / Objs: 1 / 1 / 0 / 20000 O. Stats: Wall clock time: 14.46s Total CPU time: 11.6s User wait time: 484.25us Serialization time: 2.65s (22.81%) Checksum calculation time: 5.64s (48.59%) Compression time: 1.79s (15.45%) Total IO delay: 10.45s Concurrency overhead: 17.98ms Uncompressed size: 1.86GiB (~97.66KiB per object) Output size: 1.86GiB (~97.66KiB per object; compression = 100%) IO speed: 182.6MiB/s Concurrency adjusted uncompressed speed: 687.86MiB/s Actual uncompressed speed: 131.92MiB/s Actual speed: 131.92MiB/s Objects: 20000 Average object size uncompressed: 97.66KiB Average object size compressed: 97.66KiB Blocks: 20 (~95.37MiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 com.milaboratory.test.TestUtil > testLT STANDARD_OUT Short tests. No system env properties. com.milaboratory.core.motif.BitapPatternTest > ttt STANDARD_OUT 0 ATTWCCGACA 9 ||| |||| 20 ATTT--GACA 27 [S3:W->T,D4:C,D5:C] 24 -26 com.milaboratory.core.merger.MergerParametersTest > test2 STANDARD_OUT { "qualityMergingAlgorithm": "SumSubtraction", "partsLayout": "Collinear", "minimalOverlap": 15, "maxQuality": 50, "minimalIdentity": 0.8, "identityType": "Unweighted" } com.milaboratory.core.io.sequence.fasta.RandomAccessFastaReaderTest > test1nt STANDARD_ERROR Indexing milib_326c759082a0fbb2f4959967ff264bbd6632b7093594106240637940121.fasta: 0% Indexing milib_326c759082a0fbb2f4959967ff264bbd6632b7093594106240637940121.fasta: done com.milaboratory.core.io.sequence.fasta.RandomAccessFastaReaderTest > test1 STANDARD_ERROR Indexing milib_326c759082a0fbb2f4959967ff264bbd6632b7093594106240637940121.fasta: 0% Indexing milib_326c759082a0fbb2f4959967ff264bbd6632b7093594106240637940121.fasta: done com.milaboratory.core.io.sequence.fasta.RandomAccessFastaReaderTest > test2 STANDARD_ERROR Indexing milib_e2a052d432469e255d0a373ec622d20475dcba0c4532202376860771668.tmp: 0% Indexing milib_e2a052d432469e255d0a373ec622d20475dcba0c4532202376860771668.tmp: done com.milaboratory.core.io.util.IOUtilTest > test111 STANDARD_OUT 3 3 -2147483648 -9223372036854775808 com.milaboratory.core.tree.PrimerGenerator > generate SKIPPED com.milaboratory.core.tree.SequenceTreeMapTest > testCase9 STANDARD_OUT Hit 1 0 ac-gacTtgactg 11 0 acTgac-tgactg 11 Hit 2 0 ac-gactTgactg 11 0 acTgact-gactg 11 com.milaboratory.core.tree.SequenceTreeMapTest > optimalityAndScopeTest STANDARD_OUT --NW alignments-- CASSLAPGATN-KLFF CASS-APGATNEKLFF CASSLAPGATN-KLFF CASSLAPG-TNEKLFF CASSLAPGATN-KLfF CASSLAPG-TNEKLyF --STM alignments-- CASSLAPGATN-KLFF CASS-APGATNEKLFF CASSLAPGATN-KLFF CASSLAPG-TNEKLFF CASSlAPGATN-KLFF CASSa-PGATNEKLFF CASSLAPGaTN-KLFF CASSLAPGt-NEKLFF CASSlAPGATN-KLFF CA-SsAPGATNEKLFF CASSlAPGATN-KLFF CAS-sAPGATNEKLFF CASSLAPGATNk-LFF CASS-APGATNeKLFF CASSLAPGaTN-KLFF CASSLAP-gTNEKLFF CASSLAPGATNk-LFF CASSLAPG-TNeKLFF CASSLAPGATN-KLfF CASSLAPG-TNEKLyF ------------------ com.milaboratory.core.alignment.AlignmentTrimmerTest > testRandom1 STANDARD_OUT lTrimmed = 1748 rTrimmed = 1601 lTrimmed = 2776 rTrimmed = 2803 com.milaboratory.core.alignment.blast.BlastDBBuilderTest > test1 SKIPPED com.milaboratory.core.alignment.blast.BlastAlignerTest > test1 SKIPPED com.milaboratory.core.alignment.blast.BlastAlignerTest > simpleRandomTestT1 SKIPPED com.milaboratory.core.alignment.blast.BlastAlignerTest > simpleRandomTestT2 SKIPPED com.milaboratory.core.alignment.blast.BlastAlignerTest > simpleRandomTestT3 SKIPPED com.milaboratory.core.alignment.blast.BlastAlignerExtTest > test16SMicrobial1 SKIPPED com.milaboratory.core.alignment.blast.BlastAlignerExtTest > test1 SKIPPED com.milaboratory.core.alignment.batch.SimpleBatchAlignerTest > test1 STANDARD_OUT 4 hits. com.milaboratory.core.alignment.MultiAlignmentHelperTest > test1 STANDARD_OUT 8 AGACACAGATACA 20 ||||||| ||||| 0 AGACACATATACA 12 0 GATACATTAGACACAGATACA--- 20 ||||||| ||||| 0 --------AGACACATATACACAG 15 0 GATACATTAGA---CACAGATACA 20 ||||||||||| |||||||||| 5 GATACATTAGAGACCACAGATACA 28 0 GATAC-----ATTAGA---CACAGATACA 20 ||||| |||||| |||||||||| 0 GATACGATACATTAGAGACCACAGATACA 28 Quality 78778 878777 7778887878 Subject 0 GATAC-----ATTAGA---CACAGATACA--- 20 Query0 0 aga---cacaTataca 12 Query1 0 -------------aga---cacaTatacaCAG 15 Query2 5 gatac-----attagaGACcacagataca 28 Query3 0 gatacGATACattagaGACcacagataca 28 Quality 78778 Subject 0 GATAC 4 Query1 0 ----- 0 Query2 5 gatac 9 Query3 0 gatac 4 Quality Subject 5 ----- 5 Query1 0 ----- 0 Query2 10 ----- 10 Query3 5 GATAC 9 Quality 87877 Subject 5 ATTAG 9 Query0 0 ag 1 Query1 0 ---ag 1 Query2 10 attag 14 Query3 10 attag 14 Quality 7 7 Subject 10 A---C 11 Query0 2 a---c 3 Query1 2 a---c 3 Query2 15 aGACc 19 Query3 15 aGACc 19 Quality 77888 Subject 12 ACAGA 16 Query0 4 acaTa 8 Query1 4 acaTa 8 Query2 20 acaga 24 Query3 20 acaga 24 Quality 7878 Subject 17 TACA- 20 Query0 9 taca 12 Query1 9 tacaC 13 Query2 25 taca 28 Query3 25 taca 28 Quality Subject 21 -- 21 Query1 14 AG 15 0 GATAC-----ATTAGA---CACAGATACA--- 20 0 ...---....T..... 12 0 -------------...---....T.....CAG 15 5 .....-----......GAC.......... 28 0 .....GATAC......GAC.......... 28 787788787777778887878 0 GATACATTAGACACAGATACA 20 com.milaboratory.core.alignment.MultiAlignmentHelperTest > test2 STANDARD_OUT 15 TATAGGGAGAACTCCGATCGACATCG 40 ||||||||| ||||||||||||||| 0 TATAGGGAG--CTCCGATCGACATCG 23 56 CGATCC--CGGTGACAAAGCGTTCGGACC 82 |||||| ||||||||||||||||||||| 0 CGATCCTTCGGTGACAAAGCGTTCGGACC 28 36 CATCGGGTATCGCCCTGGTACG 57 |||| ||||||||||||||||| 0 CATCAGGTATCGCCCTGGTACG 21 0 AACGATGGGCGCAAATATAGGGAGAACTCCGATCGACATCGGGTATCGCCCTGGTACGATCC--CGGTGACAAAGCGTTCGGACCTGTCTGGACGCTAGAACGC 101 0 tatagggag--ctccgatcgacatcg 23 0 cgatccTTcggtgacaaagcgttcggacc 28 0 catcAggtatcgccctggtacg 21 com.milaboratory.core.alignment.AlignmentHelperTest > test1 STANDARD_OUT 0 GAGGTGCAGCTGGTGGAGTCTGGGGGAGGC 29 |||||||||||||||||||||||||||||| 0 GAGGTGCAGCTGGTGGAGTCTGGGGGAGGC 29 30 TTGGT-ACAGCCTGGGGGGTCCCTGAGACT 58 |||| | |||||||||||||| |||||| 30 CTGGTCA-AGCCTGGGGGGTCCATGAGACA 58 59 CTCCTGTGCAGCCTCTGGATTCACCTTCAG 88 |||||||||||||||||||||| ||||||| 59 CTCCTGTGCAGCCTCTGGATTCCCCTTCAG 88 89 TAGC-TATAGCATGAACTGGGTCCGCCAGG 117 || | ||||||||||||||||||||||||| 89 TA-CTTATAGCATGAACTGGGTCCGCCAGG 117 118 CTCCAGGGAAGGGGCTGGAGTGGGTTTCAT 147 ||||||||||||||||||||||||| |||| 118 CTCCAGGGAAGGGGCTGGAGTGGGTCTCAT 147 148 ACATTAGTAGTAGTAGTAG-TACCATATAC 176 |||||||||| ||||||| || |||||| 148 CCATTAGTAGTGGTAGTAGTTA-CATATAT 176 177 TACGCAGACTCTGTGAAGGGCCGATTCACC 206 ||||||||||| |||||||||||||||||| 177 TACGCAGACTCCGTGAAGGGCCGATTCACC 206 207 ATCTCCAGAGACAATGCCAAGAACTCACTG 236 |||||||||||||| ||||||||||||||| 207 ATCTCCAGAGACAACGCCAAGAACTCACTG 236 237 TATCTGCAAATGAACAGCCTGAGAGACGAG 266 ||||||||||||||||||||||||| |||| 237 TATCTGCAAATGAACAGCCTGAGAGCCGAG 266 267 GACACGGCTGTGTATTACTGTGC 289 ||||||||||||||||||||||| 267 GACACGGCTGTGTATTACTGTGC 289 com.milaboratory.core.alignment.AlignerCustomTest > testSemiLocal0 STANDARD_OUT 29.0 2 c----cccTTgaa---tgTtaGTa-----taacta--tct 27 0 cAGTTccc--gaaACCtgCta--aGCTCTtaactaCTtct 35 29.0 2 c----cccTTgaa---tgTtaGTa-----taacta--tct 27 0 cAGTTccc--gaaACCtgCta--aGCTCTtaactaCTtct 35 com.milaboratory.core.alignment.AlignmentTest > testInvert STANDARD_OUT 8 AGACACAGATACA 20 ||||||| ||||| 0 AGACACATATACA 12 0 AGACACATATACA 12 ||||||| ||||| 8 AGACACAGATACA 20 0 GATACATTAGACACAGATACA--- 20 ||||||| ||||| 0 --------AGACACATATACACAG 15 0 --------AGACACATATACACAG 15 ||||||| ||||| 0 GATACATTAGACACAGATACA--- 20 0 GATACATTAGA---CACAGATACA 20 ||||||||||| |||||||||| 5 GATACATTAGAGACCACAGATACA 28 5 GATACATTAGAGACCACAGATACA 28 ||||||||||| |||||||||| 0 GATACATTAGA---CACAGATACA 20 0 GATAC-----ATTAGA---CACAGATACA 20 ||||| |||||| |||||||||| 0 GATACGATACATTAGAGACCACAGATACA 28 0 GATACGATACATTAGAGACCACAGATACA 28 ||||| |||||| |||||||||| 0 GATAC-----ATTAGA---CACAGATACA 20 com.milaboratory.core.alignment.kaligner1.KMapperTest > testBestOffset2 STANDARD_OUT -205 com.milaboratory.core.alignment.kaligner1.KAlignerTest > testRandomCorrectness STANDARD_OUT C=1182;I=0;M=0;ScE=0;R=0.0 AlignmentTime = 920.25us C=1642;I=1;M=0;ScE=0;R=0.0 AlignmentTime = 501.06us C=2048;I=0;M=0;ScE=0;R=0.0 AlignmentTime = 233.91us C=2142;I=0;M=0;ScE=0;R=8.333333333333333E-7 AlignmentTime = 246.61us com.milaboratory.core.alignment.kaligner1.KAlignerTest > testRandom1 STANDARD_OUT ##teamcity[buildStatisticValue key='kmFound' value='0.9449'] ##teamcity[buildStatisticValue key='kmWrong' value='1.0E-4'] ##teamcity[buildStatisticValue key='kmFalse' value='0.0058'] com.milaboratory.core.alignment.kaligner1.KAlignerTest > testRandomCorrectnessConcurrent STANDARD_OUT C=2998;I=0;M=0;ScE=1;R=0.0 AlignmentTime = 280.13us C=3000;I=0;M=0;ScE=0;R=0.0 AlignmentTime = 309.18us C=2996;I=0;M=0;ScE=0;R=0.0 AlignmentTime = 307.41us C=3000;I=0;M=0;ScE=0;R=0.0 AlignmentTime = 353.80us com.milaboratory.core.alignment.AlignerTest > testCalculateScore1 STANDARD_OUT 4.41us 4.43us 3.37us com.milaboratory.core.alignment.kaligner2.KAligner2Test > testBoundaries STANDARD_OUT 4965 com.milaboratory.core.alignment.kaligner2.KAligner2Test > caseJ1 STANDARD_OUT 52 0 TGATGCTTTTGATATCTGGGGCCAAGGGACAATGGTCACCGTCTCTTCAGGA 51 ||||||||||||||||||||||||||||||||||||||||||||||||||| 55 TGATGCTTTTGATATCTGGGGCCAAGGGACAATGGTCACCGTCTCTTCAGGG 106 [S51:A->G] (0->52) (55->107) com.milaboratory.core.alignment.kaligner2.KAligner2Test > testCase0 SKIPPED com.milaboratory.core.alignment.kaligner2.KAligner2Test > testSimpleRandomTest STANDARD_OUT Time per query: 2.23ms Processed queries: 19 Bad percent: 0.0 False positive percent: 0.6988277727682597 Scoring error percent: 0.0 com.milaboratory.core.alignment.kaligner2.KMapper2Test > test11112 STANDARD_OUT ID: 0 Score: 1716 Cluster 0: Q 27 -> T 15 - -12 Q 30 -> T 18 - -12 Q 39 -> T 28 - -11 Q 42 -> T 31 - -11 Q 45 -> T 34 - -11 Q 48 -> T 37 - -11 Q 51 -> T 40 - -11 Cluster 1: Q 84 -> T 50 - -34 Q 87 -> T 53 - -34 Q 90 -> T 56 - -34 Q 93 -> T 59 - -34 Q 96 -> T 62 - -34 Q 99 -> T 65 - -34 Q 111 -> T 79 - -32 Q 114 -> T 82 - -32 Cluster 2: Q 150 -> T 92 - -58 Q 153 -> T 95 - -58 Q 156 -> T 98 - -58 Q 159 -> T 101 - -58 Cluster 3: Q 198 -> T 120 - -78 Q 201 -> T 123 - -78 Q 204 -> T 126 - -78 Q 207 -> T 129 - -78 Q 216 -> T 139 - -77 Q 219 -> T 142 - -77 Q 231 -> T 153 - -78 Q 234 -> T 156 - -78 Q 237 -> T 159 - -78 Q 240 -> T 162 - -78 Cluster 4: Q 246 -> T 178 - -68 Q 249 -> T 181 - -68 Q 252 -> T 184 - -68 Q 255 -> T 187 - -68 Q 258 -> T 190 - -68 Q 261 -> T 193 - -68 Q 262 -> T 194 - -68 com.milaboratory.core.alignment.kaligner2.KMapper2Test > test1111 STANDARD_OUT ID: 0 Score: 1209 Cluster 0: Q 9 -> T 15 - 6 Q 12 -> T 18 - 6 Q 15 -> T 21 - 6 Q 18 -> T 24 - 6 Q 21 -> T 27 - 6 Q 24 -> T 30 - 6 Q 27 -> T 33 - 6 Q 30 -> T 36 - 6 Cluster 1: Q 57 -> T 48 - -9 Q 69 -> T 61 - -8 Q 78 -> T 69 - -9 Q 81 -> T 72 - -9 Q 84 -> T 75 - -9 Q 87 -> T 78 - -9 Q 90 -> T 81 - -9 Cluster 2: Q 123 -> T 89 - -34 Q 126 -> T 92 - -34 Q 129 -> T 95 - -34 Q 132 -> T 98 - -34 Q 135 -> T 101 - -34 Q 150 -> T 116 - -34 Q 171 -> T 135 - -36 Q 174 -> T 138 - -36 Q 177 -> T 141 - -36 Q 180 -> T 144 - -36 Q 183 -> T 147 - -36 com.milaboratory.core.alignment.kaligner2.KMapper2Test > testRandom1 STANDARD_OUT noHits: 222 noHits2: 0 noHits3: 0 wrongTopHit: 40 wrongTopHitS: 28 noCorrectHitInList: 19 Timings: DescriptiveStatistics: n: 100000 min: 16038.0 max: 9.73475694E8 mean: 263144.3220599702 std dev: 5400026.380307346 median: 194951.5 skewness: 121.66201239293335 kurtosis: 16670.90900264126 Clusters basicSize DescriptiveStatistics: n: 99738 min: 1.0 max: 6.0 mean: 2.8758848182237324 std dev: 1.106528792823208 median: 3.0 skewness: 0.29497130772348684 kurtosis: -0.6950967554231662 Top Delta DescriptiveStatistics: n: 99759 min: -29.0 max: 0.0 mean: -0.001303140568770635 std dev: 0.15477816420649226 median: 0.0 skewness: -136.58433377780725 kurtosis: 20415.36343338452 com.milaboratory.core.alignment.kaligner2.OffsetPacksAccumulatorTest > testScoreCorrection2 SKIPPED com.milaboratory.core.alignment.BandedAffineAlignerTest > test11 STANDARD_OUT 0 --------------------- -1 0 ATAAAAAAAAAAACGAGCTAG 20 0 --------------------- -1 0 ATAAAAAAAAAAACGAGCTAG 20 com.milaboratory.core.alignment.BandedAffineAlignerTest > test23 STANDARD_OUT 0 atgcggggatgc 11 0 atgcggggatgc 11 com.milaboratory.core.alignment.BandedAffineAlignerTest > test1 STANDARD_OUT 0 at-----------cgagctagTTTTTTTTTTT 20 0 atAAAAAAAAAAAcgagctag----------- 20 0 at-----------cgagctagTTTTTTTTTTT 20 0 atAAAAAAAAAAAcgagctag----------- 20 com.milaboratory.core.alignment.BandedAffineAlignerTest > test2 STANDARD_OUT 0 atgcGGGGatgc 11 0 atgcTA--atgc 9 0 atgcGGGGatgc----------- 11 0 atgcTA--atgcTTTTTTTTTTT 20 com.milaboratory.core.alignment.BandedAffineAlignerTest > test3 STANDARD_OUT 0 cgtaGGGGcgta 11 11 cgta--ATcgta 20 0 -----------cgtaGGGGcgta 11 0 TTTTTTTTTTTcgtaAT--cgta 20 com.milaboratory.core.alignment.BandedAffineAlignerTest > test4 STANDARD_OUT 0 atgcggggat-gTTTTT 15 0 atgcggggatAg----- 11 0 atgcggggat-gTTTTTTT 17 0 atgcggggatAg------- 11 com.milaboratory.core.alignment.BandedAffineAlignerTest > test5 STANDARD_OUT 7 g-taggggcgta 17 0 gAtaggggcgta 11 0 TTTTTTTg-taggggcgta 17 0 -------gAtaggggcgta 11 com.milaboratory.core.alignment.BandedAffineAlignerTest > test6 STANDARD_OUT 0 0 0 0 com.milaboratory.core.alignment.BandedAffineAlignerTest > semiGlobalLeft1 STANDARD_OUT 0 gCccTtgtgatgacccagactccagcctccgtgGAGgCaGctgtgggaggcacagtcaccatcaagtgccaggccagtcagagcattagcaacctcttaGCCTGGTATCAGCAGAAACCAGGGCAGCCTCCCAAGCTCCTGATCTATTATGCATCCGATCTGGcatctggggtctcatcaaggttcaaaggcagtggatctgggacagagtAcactctcaccatcagTggcgtgcagtgtgccgatgctgccacttactac 260 1 gAccCtgtgatgacccagactccagcctccgtgTCTgAaCctgtgggaggcacagtcaccatcaagtgccaggccagtcagagcattagcaacctctta-------------------------------------------------------------NNNcatctggggtctcatcaaggttcaaaggcagtggatctgggacagagtTcactctcaccatcagCggcgtgcagtgtgccgatgctgccacttactac 200 com.milaboratory.core.alignment.AlignmentIteratorTest > test1 STANDARD_OUT 0 -ATT-AGACA-- 7 ||| || | 0 AATTGGGA-ATT 10 I0AI3GSA3GDC6I8TI8T com.milaboratory.core.alignment.BandedLinearAlignerTest > testCase1 STANDARD_OUT GCGTGAAGACTGCAGGCATTGAGTACGTTACTAGTCCAGTGGGGCCCAACCGTAACATTGCGTGTGACTGGTTGCTTAGCGGGTGACGGCGTTTCAGGTTACGCCCTCTGTGCATCACCGATAGCGTTGTTTGAGCTTTCTAACGTCTCAAACCTGCTTGCGCCCTACGGTTTCTCTATATATACACGAAAGGGGCTGGTCGCAACCTCGCAATTCTATCCCTCCAACCTCCCTCGAATTTTT AAAGCGTGAAGACTTGCAGGCATTGGTACGTTATTAGTCCAGTGGGGCCACAACCGTAACATTGCGTGTGACTGGTGCTTAGCGGGTGACGGCGTTCAGGTTACGCCCTCTGTGCATCACCGATTAGCGTTGTCTGAGCTTTCTAACGTCTCAAACCTGCTTGCGCCCTACGGTTTCTCTATAGTATCACGAAAGGGTCTGGTCGCAACCTCGCAATTCTATCCCTCCAACCTCCCTTGAATTTTTCTA com.milaboratory.core.alignment.BandedLinearAlignerTest > testGlobal1 STANDARD_OUT 1 AATTGACA 8 |||||| 0 TATTGACT 7 com.milaboratory.core.alignment.BandedLinearAlignerTest > testGlobal2 STANDARD_OUT 1 AATTGACAG 9 |||||| | 0 TATTGAC-G 7 com.milaboratory.core.alignment.BandedLinearAlignerTest > testGlobal3 STANDARD_OUT 0 TATTGACT 7 |||||| 1 AATTGACA 8 com.milaboratory.core.alignment.BandedLinearAlignerTest > testGlobal4 STANDARD_OUT 0 TATTGAC-G 7 |||||| | 1 AATTGACAG 9 com.milaboratory.core.sequence.AminoAcidAlphabetTest > testCalculateMatches SKIPPED com.milaboratory.core.sequence.AminoAcidSequenceTest > testName STANDARD_OUT 3 com.milaboratory.core.sequence.AminoAcidSequenceTest > testConvertPositionSync1 STANDARD_OUT FromCenter 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 FromLeftWithoutIncompleteCodon 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 FromLeftWithIncompleteCodon 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 FromRightWithoutIncompleteCodon 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 FromRightWithIncompleteCodon 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 com.milaboratory.core.sequence.GeneticCodeTest > generateExtendedGeneticCode SKIPPED com.milaboratory.core.sequence.ShortSequenceSetTest > test1 STANDARD_OUT 99952 elements with 366.36KiB in raw nucleotide entropy serialized into 273.22KiB com.milaboratory.core.sequence.NucleotideAlphabetTest > testCalculateIntersections SKIPPED com.milaboratory.core.sequence.quality.QualityTrimmerTest > testParametersSerialization0 STANDARD_OUT { "averageQualityThreshold": 7.0, "windowSize": 6 } com.milaboratory.core.sequence.quality.QualityAggregatorTest > test1 STANDARD_OUT 45 com.milaboratory.core.sequence.quality.QualityAggregatorTest > test2 STANDARD_OUT 613 com.milaboratory.core.sequence.quality.QualityAggregatorTest > test3 STANDARD_OUT 2483 com.milaboratory.core.mutations.MutationTest > exportRegexps STANDARD_OUT S([\QAGCTNRYSWKMBDHV\E])(\d+)([\QAGCTNRYSWKMBDHV\E])|D([\QAGCTNRYSWKMBDHV\E])(\d+)|I(\d+)([\QAGCTNRYSWKMBDHV\E]) S([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E])(\d+)([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E])|D([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E])(\d+)|I(\d+)([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E]) com.milaboratory.core.mutations.MutationsTest > testCanonical1 STANDARD_OUT CCTAAAATGTATCCAAGCACCTGTCCTATTGACACCTTGCTACAAGTCAGTTCTAACAATAGGCTCGCAAATGGTCCTGCTTCGATCCAACCTGCTGACTCAGCAACTACTTCCCCACAGCGGCAACTATACAGAACTCTCACCCAGGATAAGGGCCATTCAGTCACACCGGTCCTAATCGCGCAATCACAATACCGGTGTGATTAATGTTCCTCCTTAGTCCTTATATTTCTTAGGTGCCAGAATCGTGACACAGAGACGTCTGCTCCAACATTAATGACTGATCCAGCAGCACGAGTTCCACCACCCCCTCTACTCCCCACATTAGAGTAGGCTTCTTAGCGTGCGTTCCTATGCAAACTAGCAGTAGACTTGTGGAACCCACGATACGTATTTGGATGCGCGTCAGCATTCCGATCTCAATTGACTCTTTTAATCGGGACCCCTCAGTGCGCAACAATACTGCGCTAGTGGATCTGATGGTGCTCTTGGGCACCAGAATATCGCTGCTTGCC CCTAAAATGTATCCAGCACCTGTCCTATTGACACCTTTCTACAAGTCAGTTCTAAAATAAGGCCTCTAGCAGATGGTCTTGCTTCGATCCAACCTGCTGACTCTGCAACTACTTTCCCACAGGGCAACTATATAGAACTCTCACCCAGGATAAGGGCTTCGGTCGACACTCGGTCCTAATCGCGCAATCACAATACCGGTGTGATTTATGTTCCTCCTTAGTCCTATATTTCTTATGTCGCCAGAATCGTGACACAGAGACGTCTGCTCCAACATTAATGACTGATCCAGCAGCGCGTTCCACCACCCCCCTACTCCCCACATTAGAGTAGGCTTTTTAGCGGCGTTCCTATGCTAACTAGCAGTAGACTTGTGGAACCCACGATACGTATTTGGATGCGCGTCAGCATTCCGATCTAATTGACTCTTCTAACGGGGCCCCTCAGTCGCAAAATACTGCGGCTAGTGGATCTGATGGTGCTTGGACCAGAATGTCGCTGCTTGCC CCTAAAGATGTATCCAGCACCTGTTATTGACACCTTTTCTACAGCAGTTCTGAAATAAGGCCTCTAGCAGGTGGTCTTTTATCCAAACCTGCGACTCTGCAACTACTTCTCCAGGGCAACTATATGAATGCTCACCCAGGATAAGGGCTATTGGCCGCACCTCGGTCCTAATCGCGCAAACTAATACCGGTGTGATTTGTGTTCCTCCTTGTCCTATATTTCTTATGTCCCAGAATCGTGCACACAGGAGCGTCTGCTCCATCATTAATGACTGATCAGCAGGCGCGTTCCACCACCCCCCTACTCCCCACATTAGAGTAGCGCTTTTTAGCGGCGTTCCTAGTTTACTAGCAGTAGACTGTGGGACCACGTACGTATTTATGCCGCGTCAGCATTCCGATCTAATTGACTCTTCTAACGGGGCCCCTCAGTCGCTAAATACGCGGCTAGGATCTGATTGGTGCTTGGACCAGAATGTCGCTGCTTGCC 0 CCTAAAGATGTATCC-AGCACCTGT--TATTGACACCTTTTCTAC-AG-CAGTTCTGA-AATAAGGCCTCTAGCAGGTGGT-CT--TT-TATCCAAACCTGC-GACTCTGCAACTACTT-CTC-CAG-GGCAACTATA-TGAA-TGCTCACCCAGGATAAGGGCTATTGGCCG-CAC-CTCGGTCCTAATCGCGCAA--ACTAATACCGGTGTGATTTGTGTTCCTCCTT-GTCC-TATATTTCTTATGTCCCAGAATCGTGCACACAG-GAGCGTCTGCTCCATCATTAATGACTGAT-CAGCAG-GCGCGTTCCACCACCCCC-CTACTCCCCACATTAGAGTAGCGCTTTTTAGCG-GCGTTCCTA-GTTTACTAGCAGTAGAC-TGTGGGA-CCACG-TACGTATTT--ATGCCGCGTCAGCATTCCGATCT-AATTGACTCTTCTAA-CGGGGCCCCTCAGT-CGCTA-AATAC-GCGGCTA--GGATCTGATTGGTG--CTT-GG-ACCAGAATGTCGCTGCTTGCC 488 |||||| |||||||| ||||||||| |||||||||| || |||| || ||||||| | ||| ||| ||| ||| |||| || || |||| ||||||| ||||| |||||||||| | | ||| |||||||||| ||| | |||||||||||||||||| ||| | | ||| | ||||||||||||||||| || ||||||||||||||| ||||||||||| |||| ||||||||||| || ||||||||||| |||||| || ||||||||||| |||||||||||||| |||||| || |||||||||||||| ||||||||||||||||||||| |||| |||||| ||||||||| | ||||||||||||| ||||| | ||||| ||||||||| ||| ||||||||||||||||||| ||||||||||| ||| |||| ||||||||| ||| | ||||| || |||| |||||||| ||||| ||| || |||||||| |||||||||||| 0 CCTAAA-ATGTATCCAAGCACCTGTCCTATTGACACC-TTGCTACAAGTCAGTTCTAACAAT-AGG-CTC--GCAAATGGTCCTGCTTCGATCC-AACCTGCTGACTCAGCAACTACTTCCCCACAGCGGCAACTATACAGAACT-CTCACCCAGGATAAGGGCCATT--CAGTCACAC-CGGTCCTAATCGCGCAATCAC-AATACCGGTGTGATTAATGTTCCTCCTTAGTCCTTATATTTCTTAGGTGCCAGAATCGTG-ACACAGAGA-CGTCTGCTCCAACATTAATGACTGATCCAGCAGCACGAGTTCCACCACCCCCTCTACTCCCCACATTAGAGTAG-GCTTCTTAGCGTGCGTTCCTATGCAAACTAGCAGTAGACTTGTGGAACCCACGATACGTATTTGGATG-CGCGTCAGCATTCCGATCTCAATTGACTCTTTTAATCGGGACCCCTCAGTGCGCAACAATACTGC-GCTAGTGGATCTGA-TGGTGCTCTTGGGCACCAGAATATCGCTGCTTGCC 514 [I14:A,D15:A,I24:C,D25:C,D36:T,S38:G->T,I39:G,I75:C,D76:C,I78:G,I78:C,S78:G->T,D79:C,I81:C,S81:T->G,D82:C,D83:G,D111:T,S112:C->T,I113:C,I131:C,S131:C->A,D132:A,D155:C,D157:A,S158:T->C,I159:A,S160:C->T,D161:A,D162:G,S163:T->C,S164:C->A,S165:A->G,I166:T,I168:C,I168:A,I186:T,S186:T->C,D187:C,I223:T,D224:T,I285:C,D286:C,I291:G,I291:C,S291:G->A,S293:A->G,S294:C->A,D296:A,D297:G,I354:T,I354:G,S354:T->C,D355:G,S356:C->A,D358:A,I372:T,D373:T,D395:T,S396:G->T,I397:G,I470:G,I470:T,D471:T,D473:G,I485:C,S485:C->T,D486:T] 0 CCTAAAATGTATCC-AAGCACCTGT-CCTATTGACACCTTG-CTACAAGTCAGTTCTAACAATAGGCTCGCAAATGGT-CCT--GCT-TCGATCCAACCTGCTGACTCAGCAACTACTTC-CCCACAGCGGCAACTATA-CAGAACTCTCACCCAGGATAAGGGCCAT-TCAGTCA-CA--CCGGTCCTAATCGCGCAA-TCACAATACCGGTGTGATTAATGTTCCTCCTTAGTCC-TTATATTTCTTAGGTGCCAGAATCGTGACACAGAGACGTCTGCTCCAACATTAATGACTGAT-CCAGCA--GCACGAGTTCCACCACCCCCTCTACTCCCCACATTAGAGTAGGCTTCTTAGCGTGCGTTCCTA--TGCAAACTAGCAGTAGAC-TTGTGGAACCCACGATACGTATTTG-GATGCGCGTCAGCATTCCGATCTCAATTGACTCTTTTAATCGGGACCCCTCAGTGCGCAACAATACTGCGCTA--GTGGATCTGATGGTG-CTCTTGGGCACCAGAATATCGCTGCTTGCC 514 |||||||||||||| | |||||||| | |||||||||| | |||||||||||||||||||||||||||||||||||| | | | ||||||||||||||||||||||||||| |||||||||||||||||| |||||||||||||||||||||| | | || |||||||||||||||||| ||||||||||||||||||||||||||||||||||| | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| | |||| | | |||||||||||||||||||||||||||||||||||||||||||||||||||||||| | ||||||||||||| | ||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| | | ||||||||||| |||||||||||||||||||||||||||| 0 CCTAAAATGTATCCAA-GCACCTGTCC-TATTGACACC-TTGCTACAAGTCAGTTCTAACAATAGGCTCGCAAATGGTCC-TGCT-TCG--ATCCAACCTGCTGACTCAGCAACTACT-TCCCCACAGCGGCAACTATACA-GAACTCTCACCCAGGATAAGGG-C-CATT--CAGTCACACCGGTCCTAATCGCGCAATC-ACAATACCGGTGTGATTAATGTTCCTCCTTAGTCCTT-ATATTTCTTAGGTGCCAGAATCGTGACACAGAGACGTCTGCTCCAACATTAATGACTGATCC-AGCAGCACGAG--TTCCACCACCCCCTCTACTCCCCACATTAGAGTAGGCTTCTTAGCGTGCGTTCCTATGC-AA-ACTAGCAGTAGACTT-GTGGAACCCACGATACGTATT-TGGATGCGCGTCAGCATTCCGATCTCAATTGACTCTTTTAATCGGGACCCCTCAGTGCGCAACAATACTGCGCTAGTG-G-ATCTGATGGTGCT-CTTGGGCACCAGAATATCGCTGCTTGCC 514 com.milaboratory.core.mutations.MutationsUtilTest > test1111 STANDARD_OUT S([\QAGCTNRYSWKMBDHV\E])(\d+)([\QAGCTNRYSWKMBDHV\E])|D([\QAGCTNRYSWKMBDHV\E])(\d+)|I(\d+)([\QAGCTNRYSWKMBDHV\E]) S([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E])(\d+)([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E])|D([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E])(\d+)|I(\d+)([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E]) com.milaboratory.core.mutations.MutationsUtilTest > nt2AAWithMappingManual1 STANDARD_OUT [I2C::SM0I, I2G::I1A, I2C::I1A, SG2C:SM0I:I1A] com.milaboratory.core.mutations.MutationsUtilTest > nt2AAWithMappingManual2 STANDARD_OUT [S0:T->N,D13:V,S14:S->Y,S15:P->R,S16:W->P,S17:Y->G,S18:D->T,S19:P->I,S20:G->P,S21:D->A,S22:K->T,S23:A->K,S24:F->R,S25:G->S,S26:P->D,I27:S] [-1, -1, 9, 15] com.milaboratory.core.mutations.MutationsUtilTest > nt2AAWithMappingManual3 STANDARD_OUT 0 CAGGTTCAGCTGGTGCAGTCTGGAGCTGAGGTGAAGAAGCCTGGGGCCTCAGTGAAGGTCTCCTGCAAGGCTTCTGGTTACACCTTTACCAGCTACGGTATCAGCTGGGTGCGACAGGCCCCTGGACAAGGGCTTGAGTGGATGGGATGGATCAGCGCTTACAATGGTAACACAAACTATGCACAGAAGCTCCAGGGCAGAGTCACCATGACCACAGACACATCCACGAGCACAGCCTACATGGAGCTGAGGAGCCTGAGATCTGACGACACGGCCGTGTATTACTGTGCGAGAGA 295 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||| ||||| ||||||||||||||||||||||||||||| ||||||||| ||||||||| ||||||||||||||||||| || ||||| ||| || |||||||||||||| 0 CAGGTTCAGCTGGTGCAGTCTGGAGCTGAGGTGAAGAAGCCTGGGGCCTCAGTGAAGGTCTCCTGCAAGGCTTCTGGTTACACCTTTACCAGCTACGGTATCAGCTGGGTGCGACAGGCCCCTGGACAAGGGCTTGAGTGGATGGGATGGATCAGCGCTTACAATGGTAACACATTCTATGCAGAGAAGTTCCAGGGCAGAGTCACCATGACCACAGACGCATCCACGACCACAGCCTATATGGAGCTGAGGAGCCTGACATTTGACG-----GCCACATACTACTGTGCGAGAGA 290 [S58:N->F,S61:Q->E,S63:L->F,S73:T->A,S76:S->T,S86:R->T,S87:S->F,S89:D->G,D90:T,D91:A,S92:V->H,S93:Y->I,S94:Y->L,S95:C->L,S96:A->C,S97:R->E,S98:_->R] QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYGISWVRQAPGQGLEWMGWISAYNGNTFYAEKFQGRVTMTTDASTTTAYMELRSLTFDGHILLCER QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYGISWVRQAPGQGLEWMGWISAYNGNTFYAEKFQGRVTMTTDASTTTAYMELRSLTFDGHILLCER [S58:N->F,S61:Q->E,S63:L->F,S73:T->A,S76:S->T,S86:R->T,S87:S->F,S89:D->G,D90:T,D91:A,S92:V->H,S93:Y->I,S94:Y->L,S95:C->L,S96:A->C,S97:R->E,S98:_->R] [0, 0, 1, 2, 3, 4, -1, 5, 6, 7, 7, 8, 8, 8, 10, 10, 11, 12] com.milaboratory.core.mutations.MutationsUtilTest > nt2AAWithMappingManual4 STANDARD_OUT [S3:S->M,D4:D,S5:_->I] com.milaboratory.core.RangeTest > test23e14 STANDARD_OUT 1000001 1010100 1000111 1000011 1000010 com.milaboratory.util.CacheTest > test1 STANDARD_OUT Cache misses:400 Cache hits:800 com.milaboratory.util.VersionInfoTest > test3 SKIPPED com.milaboratory.util.AtomicEnumHistogramTest > test1 STANDARD_OUT {"labels":["A","B","C","null"],"hist":[1,2,0,1]} com.milaboratory.util.JsonOverriderTest > test1 STANDARD_OUT WARNING: unnecessary override -Ob= with the same value. com.milaboratory.util.RemoveActionTest > test1 STANDARD_OUT /tmp/milib_7e62fe9975a57bdec5f84c41d9364e83f2cda5c98344584286744868976 com.milaboratory.util.RemoveActionTest > test2 STANDARD_OUT /tmp/milib_1dc000064eb8d6e514ada4eba28e1ca7fca22954251484128020444988.tmp com.milaboratory.util.IntCombinationsTest > test1 STANDARD_OUT [0, 1] [0, 2] [1, 2] com.milaboratory.util.sorting.SortingUtilTest > test1 STANDARD_OUT Collation: 311.62ms Sorting: 305.01ms 1 217 41404 99524 99999 com.milaboratory.util.sorting.HashSorterTest > testSingleton STANDARD_OUT /tmp/milib_243d81b81390c0c049e5417d0af9619857d2dd0d6549491550508290169 timeInCollate: 14.61s timeInCollatorInit: 9.57s timeAwaitingO: 1.57ms timeAwaitingI: 2.17s timeInFinalSorting1: 0ns timeInFinalSorting2: 17.45ms timeInFinalSorting3: 80.69ms /9S (5|27|32): objs=50000 size=3.75MiB com.milaboratory.util.sorting.HashSorterTest > test1 STANDARD_OUT /tmp/milib_8cd6cfd55eaf8fc2a9cb57a8436c1602fadbf81215788893763046999850 timeInCollate: 30.34s timeInCollatorInit: 1.75s timeAwaitingO: 2.3s timeAwaitingI: 7.63s timeInFinalSorting1: 4.51s timeInFinalSorting2: 3.51s timeInFinalSorting3: 1.55s /0N (5|27|32): objs=150813 size=8.35MiB /1N (5|27|32): objs=154192 size=8.51MiB /2N (5|27|32): objs=150795 size=8.49MiB /3N (5|27|32): objs=149546 size=8.3MiB /4N (5|27|32): objs=159515 size=9.09MiB /5N (5|27|32): objs=156913 size=9.24MiB /6N (5|27|32): objs=155366 size=8.77MiB /7N (5|27|32): objs=168814 size=9.67MiB /8N (5|27|32): objs=154980 size=8.67MiB /9N (5|27|32): objs=150885 size=8.68MiB /10N (5|27|32): objs=153016 size=8.58MiB /11N (5|27|32): objs=155420 size=8.72MiB /12N (5|27|32): objs=165219 size=9.55MiB /13N (5|27|32): objs=150966 size=8.6MiB /14N (5|27|32): objs=154556 size=9.25MiB /15N (5|27|32): objs=164363 size=9.48MiB /16N (5|27|32): objs=161069 size=9.32MiB /17N (5|27|32): objs=155199 size=8.71MiB /18N (5|27|32): objs=154621 size=8.91MiB /19N (5|27|32): objs=156366 size=8.65MiB /20N (5|27|32): objs=161131 size=9.28MiB /21N (5|27|32): objs=156618 size=9.02MiB /22N (5|27|32): objs=145669 size=8.46MiB /23N (5|27|32): objs=166145 size=9.49MiB /24N (5|27|32): objs=156171 size=8.49MiB /25N (5|27|32): objs=148535 size=8.29MiB /26N (5|27|32): objs=163062 size=9.4MiB /27N (5|27|32): objs=151798 size=8.49MiB /28N (5|27|32): objs=157917 size=9.08MiB /29N (5|27|32): objs=154681 size=8.55MiB /30N (5|27|32): objs=157847 size=8.67MiB /31N (5|27|32): objs=157812 size=8.81MiB /0/0N (2|25|36): objs=40234 size=907.53KiB /0/1N (2|25|36): objs=38123 size=902.67KiB /0/2N (2|25|36): objs=32888 size=566.24KiB /0/3N (2|25|36): objs=12021 size=70.18KiB /0/4S (2|25|36): objs=160 size=297B /0/5N (2|25|36): objs=304 size=895B /0/6S (2|25|36): objs=134 size=149B /0/7N (2|25|36): objs=4098 size=17.28KiB /0/8S (2|25|36): objs=179 size=298B /0/9N (2|25|36): objs=1223 size=5.16KiB /0/10S (2|25|36): objs=157 size=206B /0/11N (2|25|36): objs=3471 size=15.28KiB /0/12S (2|25|36): objs=154 size=274B /0/13N (2|25|36): objs=909 size=3.83KiB /0/14S (2|25|36): objs=148 size=129B /0/15N (2|25|36): objs=925 size=3.66KiB /0/16S (2|25|36): objs=154 size=333B /0/17S (2|25|36): objs=154 size=180B /0/18S (2|25|36): objs=165 size=177B /0/19N (2|25|36): objs=615 size=2.22KiB /0/20S (2|25|36): objs=167 size=318B /0/21N (2|25|36): objs=1554 size=6.31KiB /0/22S (2|25|36): objs=148 size=128B /0/23S (2|25|36): objs=152 size=174B /0/24S (2|25|36): objs=193 size=113B /0/25N (2|25|36): objs=588 size=2.14KiB /0/26S (2|25|36): objs=149 size=227B /0/27N (2|25|36): objs=2351 size=9.77KiB /0/28S (2|25|36): objs=147 size=336B /0/29N (2|25|36): objs=5519 size=23.99KiB /0/30S (2|25|36): objs=127 size=292B /0/31N (2|25|36): objs=896 size=3.42KiB /0/32S (2|25|36): objs=154 size=220B /0/33N (2|25|36): objs=523 size=1.65KiB /0/34S (2|25|36): objs=139 size=91B /0/35N (2|25|36): objs=1790 size=7.54KiB /1/0N (2|25|36): objs=39289 size=714.76KiB /1/1N (2|25|36): objs=34819 size=614.15KiB /1/2N (2|25|36): objs=41011 size=953.25KiB /1/3N (2|25|36): objs=1638 size=6.92KiB /1/4S (2|25|36): objs=155 size=309B /1/5N (2|25|36): objs=866 size=3.54KiB /1/6S (2|25|36): objs=153 size=308B /1/7N (2|25|36): objs=1366 size=5.4KiB /1/8S (2|25|36): objs=158 size=169B /1/9S (2|25|36): objs=135 size=143B /1/10S (2|25|36): objs=130 size=162B /1/11N (2|25|36): objs=4237 size=20.78KiB /1/12S (2|25|36): objs=145 size=226B /1/13N (2|25|36): objs=737 size=2.6KiB /1/14S (2|25|36): objs=149 size=87B /1/15N (2|25|36): objs=1502 size=6.4KiB /1/16S (2|25|36): objs=176 size=227B /1/17N (2|25|36): objs=1343 size=5.58KiB /1/18S (2|25|36): objs=140 size=84B /1/19N (2|25|36): objs=3964 size=17.57KiB /1/20S (2|25|36): objs=179 size=328B /1/21N (2|25|36): objs=601 size=2.25KiB /1/22S (2|25|36): objs=158 size=130B /1/23N (2|25|36): objs=2173 size=9.09KiB /1/24S (2|25|36): objs=158 size=110B /1/25N (2|25|36): objs=304 size=1.04KiB /1/26S (2|25|36): objs=166 size=219B /1/27N (2|25|36): objs=3984 size=19.1KiB /1/28S (2|25|36): objs=165 size=204B /1/29N (2|25|36): objs=4648 size=21.56KiB /1/30S (2|25|36): objs=152 size=155B /1/31S (2|25|36): objs=149 size=241B /1/32S (2|25|36): objs=133 size=225B /1/33N (2|25|36): objs=1097 size=4.35KiB /1/34S (2|25|36): objs=154 size=295B /1/35N (2|25|36): objs=7858 size=36.88KiB /2/0N (2|25|36): objs=37653 size=777.5KiB /2/1N (2|25|36): objs=5503 size=26.13KiB /2/2S (2|25|36): objs=153 size=205B /2/3N (2|25|36): objs=32206 size=555.19KiB /2/4N (2|25|36): objs=38931 size=856.91KiB /2/5S (2|25|36): objs=162 size=170B /2/6N (2|25|36): objs=1443 size=5.7KiB /2/7N (2|25|36): objs=5196 size=26.32KiB /2/8S (2|25|36): objs=153 size=193B /2/9N (2|25|36): objs=629 size=2.36KiB /2/10S (2|25|36): objs=146 size=286B /2/11N (2|25|36): objs=3690 size=16.77KiB /2/12S (2|25|36): objs=184 size=336B /2/13N (2|25|36): objs=1675 size=6.97KiB /2/14S (2|25|36): objs=147 size=311B /2/15N (2|25|36): objs=321 size=831B /2/16S (2|25|36): objs=169 size=350B /2/17N (2|25|36): objs=2553 size=10.82KiB /2/18S (2|25|36): objs=165 size=172B /2/19N (2|25|36): objs=746 size=2.79KiB /2/20S (2|25|36): objs=163 size=294B /2/21N (2|25|36): objs=327 size=884B /2/22S (2|25|36): objs=127 size=251B /2/23N (2|25|36): objs=4650 size=20.94KiB /2/24S (2|25|36): objs=158 size=306B /2/25N (2|25|36): objs=454 size=1.58KiB /2/26S (2|25|36): objs=164 size=160B /2/28S (2|25|36): objs=169 size=195B /2/29N (2|25|36): objs=3156 size=14.77KiB /2/30S (2|25|36): objs=147 size=235B /2/31N (2|25|36): objs=7455 size=35.95KiB /2/32S (2|25|36): objs=132 size=262B /2/33N (2|25|36): objs=786 size=3.09KiB /2/34S (2|25|36): objs=159 size=253B /2/35N (2|25|36): objs=923 size=3.34KiB /3/0N (2|25|36): objs=38008 size=761.94KiB /3/1N (2|25|36): objs=40488 size=808.84KiB /3/2N (2|25|36): objs=33820 size=672.18KiB /3/3N (2|25|36): objs=9883 size=47.04KiB /3/4S (2|25|36): objs=167 size=220B /3/5N (2|25|36): objs=471 size=1.55KiB /3/6S (2|25|36): objs=179 size=99B /3/8S (2|25|36): objs=156 size=223B /3/9N (2|25|36): objs=277 size=809B /3/10S (2|25|36): objs=138 size=104B /3/11N (2|25|36): objs=1247 size=5.16KiB /3/12S (2|25|36): objs=162 size=302B /3/13N (2|25|36): objs=439 size=1.4KiB /3/14S (2|25|36): objs=146 size=259B /3/15N (2|25|36): objs=1957 size=8.25KiB /3/16S (2|25|36): objs=143 size=188B /3/17N (2|25|36): objs=2990 size=13.1KiB /3/18S (2|25|36): objs=155 size=130B /3/19N (2|25|36): objs=2261 size=9.82KiB /3/20S (2|25|36): objs=154 size=235B /3/21N (2|25|36): objs=286 size=1015B /3/22S (2|25|36): objs=155 size=258B /3/23N (2|25|36): objs=4235 size=19.99KiB /3/24S (2|25|36): objs=168 size=238B /3/25N (2|25|36): objs=3125 size=13.33KiB /3/26S (2|25|36): objs=146 size=163B /3/27N (2|25|36): objs=777 size=2.92KiB /3/28S (2|25|36): objs=169 size=281B /3/30S (2|25|36): objs=146 size=284B /3/31N (2|25|36): objs=1024 size=4.11KiB /3/32S (2|25|36): objs=143 size=101B /3/33N (2|25|36): objs=747 size=2.7KiB /3/34S (2|25|36): objs=154 size=244B /3/35N (2|25|36): objs=5030 size=21.76KiB /4/0N (2|25|36): objs=40618 size=912.43KiB /4/1N (2|25|36): objs=38923 size=843.8KiB /4/2N (2|25|36): objs=42063 size=939.97KiB /4/3N (2|25|36): objs=5343 size=24.91KiB /4/4S (2|25|36): objs=152 size=141B /4/5N (2|25|36): objs=887 size=3.63KiB /4/6S (2|25|36): objs=153 size=160B /4/7N (2|25|36): objs=463 size=1.62KiB /4/8S (2|25|36): objs=170 size=204B /4/10S (2|25|36): objs=169 size=119B /4/11N (2|25|36): objs=1336 size=5.52KiB /4/12S (2|25|36): objs=146 size=100B /4/13N (2|25|36): objs=1387 size=5.62KiB /4/14S (2|25|36): objs=147 size=210B /4/15N (2|25|36): objs=2120 size=8.71KiB /4/16S (2|25|36): objs=129 size=310B /4/17N (2|25|36): objs=1513 size=6.19KiB /4/18S (2|25|36): objs=165 size=130B /4/19N (2|25|36): objs=1864 size=7.89KiB /4/20S (2|25|36): objs=153 size=288B /4/21N (2|25|36): objs=1670 size=6.85KiB /4/22S (2|25|36): objs=157 size=300B /4/23S (2|25|36): objs=171 size=212B /4/24S (2|25|36): objs=171 size=284B /4/25N (2|25|36): objs=636 size=2.3KiB /4/26S (2|25|36): objs=140 size=126B /4/27N (2|25|36): objs=9339 size=44.33KiB /4/28S (2|25|36): objs=173 size=252B /4/29N (2|25|36): objs=2075 size=8.4KiB /4/30S (2|25|36): objs=138 size=252B /4/31N (2|25|36): objs=2585 size=11.08KiB /4/32S (2|25|36): objs=143 size=291B /4/33N (2|25|36): objs=733 size=2.93KiB /4/34S (2|25|36): objs=155 size=102B /4/35N (2|25|36): objs=3328 size=15.14KiB /5/0N (2|25|36): objs=39102 size=855.96KiB /5/1N (2|25|36): objs=41194 size=1.06MiB /5/2N (2|25|36): objs=36671 size=744.1KiB /5/3N (2|25|36): objs=16796 size=142.52KiB /5/4S (2|25|36): objs=135 size=246B /5/5N (2|25|36): objs=2687 size=12KiB /5/6S (2|25|36): objs=162 size=149B /5/7N (2|25|36): objs=456 size=1.63KiB /5/8S (2|25|36): objs=177 size=333B /5/9N (2|25|36): objs=308 size=859B /5/10S (2|25|36): objs=151 size=291B /5/11N (2|25|36): objs=1343 size=5.21KiB /5/12S (2|25|36): objs=137 size=221B /5/13N (2|25|36): objs=2340 size=10.07KiB /5/14S (2|25|36): objs=173 size=161B /5/16S (2|25|36): objs=156 size=245B /5/17N (2|25|36): objs=766 size=2.97KiB /5/18S (2|25|36): objs=157 size=293B /5/19N (2|25|36): objs=2467 size=11KiB /5/20S (2|25|36): objs=149 size=130B /5/21N (2|25|36): objs=847 size=3.35KiB /5/22S (2|25|36): objs=140 size=234B /5/23N (2|25|36): objs=938 size=3.56KiB /5/24S (2|25|36): objs=136 size=298B /5/25N (2|25|36): objs=1856 size=7.86KiB /5/26S (2|25|36): objs=163 size=283B /5/27N (2|25|36): objs=2035 size=8.52KiB /5/28S (2|25|36): objs=152 size=322B /5/29N (2|25|36): objs=1912 size=8.13KiB /5/30S (2|25|36): objs=145 size=320B /5/31N (2|25|36): objs=1086 size=4.23KiB /5/32S (2|25|36): objs=146 size=314B /5/33N (2|25|36): objs=1692 size=7.13KiB /5/34S (2|25|36): objs=138 size=239B /6/0N (2|25|36): objs=39878 size=723.49KiB /6/1N (2|25|36): objs=35103 size=628.87KiB /6/2N (2|25|36): objs=40191 size=994KiB /6/3N (2|25|36): objs=3438 size=15.79KiB /6/4S (2|25|36): objs=133 size=296B /6/5S (2|25|36): objs=160 size=191B /6/6S (2|25|36): objs=155 size=303B /6/7N (2|25|36): objs=1854 size=7.75KiB /6/8S (2|25|36): objs=150 size=283B /6/10S (2|25|36): objs=165 size=187B /6/11N (2|25|36): objs=294 size=852B /6/12S (2|25|36): objs=154 size=306B /6/13N (2|25|36): objs=8063 size=42.43KiB /6/14S (2|25|36): objs=176 size=113B /6/15N (2|25|36): objs=3558 size=16.87KiB /6/16S (2|25|36): objs=147 size=172B /6/17N (2|25|36): objs=3098 size=13.11KiB /6/18S (2|25|36): objs=135 size=313B /6/19N (2|25|36): objs=3830 size=17.98KiB /6/20S (2|25|36): objs=144 size=201B /6/21N (2|25|36): objs=4259 size=20.39KiB /6/22S (2|25|36): objs=148 size=341B /6/24S (2|25|36): objs=141 size=178B /6/25N (2|25|36): objs=1082 size=4.23KiB /6/26S (2|25|36): objs=159 size=347B /6/27N (2|25|36): objs=1388 size=5.61KiB /6/28S (2|25|36): objs=160 size=90B /6/29N (2|25|36): objs=1664 size=6.88KiB /6/30S (2|25|36): objs=159 size=316B /6/31N (2|25|36): objs=1735 size=7.31KiB /6/32S (2|25|36): objs=162 size=194B /6/33N (2|25|36): objs=1532 size=6.27KiB /6/34S (2|25|36): objs=155 size=249B /6/35N (2|25|36): objs=1796 size=7.38KiB /7/0N (2|25|36): objs=39028 size=897.23KiB /7/1N (2|25|36): objs=44183 size=1.08MiB /7/2N (2|25|36): objs=42231 size=941KiB /7/3N (2|25|36): objs=1873 size=7.69KiB /7/4S (2|25|36): objs=150 size=235B /7/5N (2|25|36): objs=9169 size=42.42KiB /7/6S (2|25|36): objs=150 size=84B /7/8S (2|25|36): objs=155 size=178B /7/9N (2|25|36): objs=1102 size=4.2KiB /7/10S (2|25|36): objs=162 size=160B /7/11N (2|25|36): objs=730 size=2.84KiB /7/12S (2|25|36): objs=161 size=111B /7/13N (2|25|36): objs=12254 size=70.2KiB /7/14S (2|25|36): objs=156 size=114B /7/15N (2|25|36): objs=1023 size=4.2KiB /7/16S (2|25|36): objs=169 size=143B /7/17N (2|25|36): objs=4158 size=19.19KiB /7/18S (2|25|36): objs=133 size=143B /7/19N (2|25|36): objs=4513 size=20.32KiB /7/20S (2|25|36): objs=156 size=337B /7/21N (2|25|36): objs=793 size=2.99KiB /7/22S (2|25|36): objs=152 size=125B /7/24S (2|25|36): objs=151 size=343B /7/25S (2|25|36): objs=157 size=245B /7/26S (2|25|36): objs=133 size=219B /7/27N (2|25|36): objs=768 size=2.85KiB /7/28S (2|25|36): objs=156 size=231B /7/29N (2|25|36): objs=483 size=1.54KiB /7/30S (2|25|36): objs=161 size=288B /7/31N (2|25|36): objs=912 size=3.5KiB /7/32S (2|25|36): objs=172 size=299B /7/33N (2|25|36): objs=2807 size=13.58KiB /7/34S (2|25|36): objs=157 size=96B /7/35S (2|25|36): objs=156 size=177B /8/0N (2|25|36): objs=39844 size=924.59KiB /8/1N (2|25|36): objs=39841 size=876.45KiB /8/2N (2|25|36): objs=26119 size=344.13KiB /8/3S (2|25|36): objs=156 size=142B /8/4N (2|25|36): objs=1561 size=6.4KiB /8/5S (2|25|36): objs=166 size=162B /8/6N (2|25|36): objs=1237 size=4.94KiB /8/7S (2|25|36): objs=147 size=246B /8/8N (2|25|36): objs=9372 size=52.35KiB /8/9N (2|25|36): objs=3085 size=13.94KiB /8/10S (2|25|36): objs=139 size=157B /8/11N (2|25|36): objs=1876 size=7.97KiB /8/12S (2|25|36): objs=162 size=347B /8/13N (2|25|36): objs=2125 size=10.65KiB /8/14S (2|25|36): objs=162 size=160B /8/15N (2|25|36): objs=294 size=1.04KiB /8/16S (2|25|36): objs=156 size=322B /8/17N (2|25|36): objs=5965 size=27.94KiB /8/18S (2|25|36): objs=136 size=83B /8/19N (2|25|36): objs=588 size=2.05KiB /8/20S (2|25|36): objs=159 size=260B /8/21N (2|25|36): objs=2919 size=12.73KiB /8/22S (2|25|36): objs=164 size=254B /8/23N (2|25|36): objs=6125 size=31.26KiB /8/24S (2|25|36): objs=150 size=222B /8/25N (2|25|36): objs=278 size=711B /8/26S (2|25|36): objs=176 size=192B /8/27N (2|25|36): objs=1595 size=6.58KiB /8/28S (2|25|36): objs=161 size=154B /8/29N (2|25|36): objs=4445 size=19.84KiB /8/30S (2|25|36): objs=153 size=97B /8/32S (2|25|36): objs=145 size=102B /8/33N (2|25|36): objs=286 size=780B /8/34S (2|25|36): objs=173 size=271B /8/35N (2|25|36): objs=4920 size=22.87KiB /9/0N (2|25|36): objs=39052 size=855.81KiB /9/1N (2|25|36): objs=37054 size=729.53KiB /9/2N (2|25|36): objs=37337 size=906.76KiB /9/3N (2|25|36): objs=6334 size=28.54KiB /9/4S (2|25|36): objs=155 size=200B /9/5N (2|25|36): objs=1237 size=4.82KiB /9/6S (2|25|36): objs=137 size=318B /9/7N (2|25|36): objs=901 size=3.65KiB /9/8S (2|25|36): objs=159 size=311B /9/9S (2|25|36): objs=145 size=264B /9/10S (2|25|36): objs=172 size=321B /9/11N (2|25|36): objs=1978 size=8.25KiB /9/12S (2|25|36): objs=140 size=154B /9/13N (2|25|36): objs=1476 size=5.98KiB /9/14S (2|25|36): objs=158 size=331B /9/15N (2|25|36): objs=644 size=2.46KiB /9/16S (2|25|36): objs=142 size=136B /9/17N (2|25|36): objs=2163 size=9.01KiB /9/18S (2|25|36): objs=151 size=203B /9/19N (2|25|36): objs=3079 size=13.09KiB /9/20S (2|25|36): objs=139 size=262B /9/21N (2|25|36): objs=4055 size=19.17KiB /9/22S (2|25|36): objs=131 size=265B /9/23N (2|25|36): objs=2121 size=9.59KiB /9/24S (2|25|36): objs=153 size=265B /9/26S (2|25|36): objs=150 size=239B /9/27N (2|25|36): objs=532 size=1.96KiB /9/28S (2|25|36): objs=139 size=293B /9/29N (2|25|36): objs=3545 size=15.97KiB /9/30S (2|25|36): objs=164 size=90B /9/31N (2|25|36): objs=4385 size=20.81KiB /9/32S (2|25|36): objs=150 size=183B /9/34S (2|25|36): objs=136 size=314B /9/35N (2|25|36): objs=2471 size=10.7KiB /10/0N (2|25|36): objs=38512 size=828.31KiB /10/1N (2|25|36): objs=34429 size=605.92KiB /10/2N (2|25|36): objs=36882 size=768.26KiB /10/3S (2|25|36): objs=167 size=353B /10/4N (2|25|36): objs=1861 size=7.79KiB /10/5S (2|25|36): objs=164 size=92B /10/6N (2|25|36): objs=1353 size=5.47KiB /10/7S (2|25|36): objs=159 size=147B /10/8N (2|25|36): objs=1623 size=6.51KiB /10/9S (2|25|36): objs=162 size=310B /10/10N (2|25|36): objs=2112 size=9.32KiB /10/11N (2|25|36): objs=3537 size=16.1KiB /10/12S (2|25|36): objs=182 size=220B /10/13N (2|25|36): objs=1316 size=5.5KiB /10/14S (2|25|36): objs=153 size=123B /10/15N (2|25|36): objs=5456 size=25.61KiB /10/16S (2|25|36): objs=167 size=332B /10/17N (2|25|36): objs=301 size=936B /10/18S (2|25|36): objs=157 size=197B /10/19N (2|25|36): objs=12445 size=69.11KiB /10/20S (2|25|36): objs=160 size=225B /10/21N (2|25|36): objs=1209 size=4.81KiB /10/22S (2|25|36): objs=162 size=303B /10/23N (2|25|36): objs=591 size=2.18KiB /10/24S (2|25|36): objs=149 size=210B /10/25N (2|25|36): objs=1655 size=6.52KiB /10/26S (2|25|36): objs=169 size=128B /10/27N (2|25|36): objs=470 size=1.53KiB /10/28S (2|25|36): objs=156 size=123B /10/29N (2|25|36): objs=916 size=3.62KiB /10/30S (2|25|36): objs=162 size=262B /10/31N (2|25|36): objs=2461 size=10.87KiB /10/32S (2|25|36): objs=150 size=333B /10/33N (2|25|36): objs=2307 size=9.64KiB /10/34S (2|25|36): objs=172 size=267B /10/35N (2|25|36): objs=989 size=3.76KiB /11/0N (2|25|36): objs=39444 size=797.93KiB /11/1N (2|25|36): objs=19929 size=174.23KiB /11/2S (2|25|36): objs=147 size=330B /11/3N (2|25|36): objs=19652 size=188.09KiB /11/4N (2|25|36): objs=40300 size=934.28KiB /11/5N (2|25|36): objs=7431 size=36.59KiB /11/6S (2|25|36): objs=148 size=204B /11/7N (2|25|36): objs=615 size=2.15KiB /11/8S (2|25|36): objs=139 size=247B /11/9S (2|25|36): objs=151 size=117B /11/10S (2|25|36): objs=150 size=110B /11/11N (2|25|36): objs=2604 size=11.01KiB /11/12S (2|25|36): objs=143 size=229B /11/13N (2|25|36): objs=4884 size=22.52KiB /11/14S (2|25|36): objs=139 size=280B /11/15N (2|25|36): objs=1067 size=4.06KiB /11/16S (2|25|36): objs=139 size=198B /11/17N (2|25|36): objs=302 size=779B /11/18S (2|25|36): objs=138 size=281B /11/19N (2|25|36): objs=1650 size=6.63KiB /11/20S (2|25|36): objs=142 size=292B /11/21N (2|25|36): objs=612 size=2.36KiB /11/22S (2|25|36): objs=154 size=122B /11/23N (2|25|36): objs=314 size=788B /11/24S (2|25|36): objs=109 size=119B /11/25N (2|25|36): objs=4481 size=20.8KiB /11/26S (2|25|36): objs=149 size=203B /11/27N (2|25|36): objs=1657 size=7.01KiB /11/28S (2|25|36): objs=167 size=297B /11/29S (2|25|36): objs=175 size=224B /11/30S (2|25|36): objs=153 size=290B /11/31S (2|25|36): objs=153 size=175B /11/32S (2|25|36): objs=170 size=211B /11/33N (2|25|36): objs=3657 size=18.12KiB /11/34S (2|25|36): objs=160 size=271B /11/35N (2|25|36): objs=3995 size=18.07KiB /12/0N (2|25|36): objs=42004 size=931.84KiB /12/1N (2|25|36): objs=42003 size=1.02MiB /12/2N (2|25|36): objs=22510 size=233.36KiB /12/3S (2|25|36): objs=149 size=227B /12/4N (2|25|36): objs=18720 size=149.54KiB /12/5N (2|25|36): objs=6358 size=29.58KiB /12/6S (2|25|36): objs=153 size=292B /12/7N (2|25|36): objs=456 size=1.5KiB /12/8S (2|25|36): objs=148 size=200B /12/9N (2|25|36): objs=313 size=934B /12/10S (2|25|36): objs=168 size=248B /12/11N (2|25|36): objs=444 size=1.47KiB /12/12S (2|25|36): objs=143 size=181B /12/13N (2|25|36): objs=1540 size=6.62KiB /12/14S (2|25|36): objs=156 size=302B /12/15N (2|25|36): objs=2999 size=12.67KiB /12/16S (2|25|36): objs=148 size=287B /12/17N (2|25|36): objs=1040 size=4.37KiB /12/18S (2|25|36): objs=153 size=135B /12/19N (2|25|36): objs=2126 size=9.09KiB /12/20S (2|25|36): objs=158 size=193B /12/21N (2|25|36): objs=759 size=3.01KiB /12/22S (2|25|36): objs=152 size=184B /12/23N (2|25|36): objs=3375 size=14.48KiB /12/24S (2|25|36): objs=140 size=214B /12/25N (2|25|36): objs=758 size=2.96KiB /12/26S (2|25|36): objs=158 size=148B /12/27N (2|25|36): objs=1114 size=4.66KiB /12/28S (2|25|36): objs=174 size=228B /12/29N (2|25|36): objs=7528 size=40.04KiB /12/30S (2|25|36): objs=154 size=262B /12/31N (2|25|36): objs=324 size=1KiB /12/32S (2|25|36): objs=145 size=146B /12/33N (2|25|36): objs=3450 size=15.1KiB /12/34S (2|25|36): objs=169 size=179B /12/35N (2|25|36): objs=4930 size=22.46KiB /13/0N (2|25|36): objs=8537 size=38.95KiB /13/1S (2|25|36): objs=141 size=232B /13/2N (2|25|36): objs=30266 size=483.53KiB /13/3N (2|25|36): objs=38357 size=911.14KiB /13/4N (2|25|36): objs=34706 size=824.82KiB /13/5N (2|25|36): objs=14097 size=75.17KiB /13/6S (2|25|36): objs=140 size=178B /13/7N (2|25|36): objs=1568 size=6.31KiB /13/8S (2|25|36): objs=167 size=197B /13/9N (2|25|36): objs=467 size=1.51KiB /13/10S (2|25|36): objs=163 size=307B /13/11N (2|25|36): objs=5339 size=24.24KiB /13/12S (2|25|36): objs=164 size=224B /13/13N (2|25|36): objs=307 size=887B /13/14S (2|25|36): objs=142 size=228B /13/15N (2|25|36): objs=2215 size=9.19KiB /13/16S (2|25|36): objs=154 size=180B /13/17N (2|25|36): objs=309 size=834B /13/18S (2|25|36): objs=137 size=194B /13/19N (2|25|36): objs=1097 size=4.22KiB /13/20S (2|25|36): objs=153 size=276B /13/21N (2|25|36): objs=3649 size=16.77KiB /13/22S (2|25|36): objs=168 size=345B /13/23N (2|25|36): objs=579 size=2.05KiB /13/24S (2|25|36): objs=152 size=160B /13/25N (2|25|36): objs=5196 size=24.61KiB /13/26S (2|25|36): objs=144 size=321B /13/27N (2|25|36): objs=761 size=2.83KiB /13/28S (2|25|36): objs=158 size=150B /13/29S (2|25|36): objs=152 size=232B /13/30S (2|25|36): objs=148 size=93B /13/32S (2|25|36): objs=163 size=278B /13/33N (2|25|36): objs=295 size=944B /13/34S (2|25|36): objs=141 size=293B /13/35N (2|25|36): objs=634 size=2.21KiB /14/0N (2|25|36): objs=35855 size=839.09KiB /14/1S (2|25|36): objs=164 size=210B /14/2N (2|25|36): objs=3046 size=12.8KiB /14/3N (2|25|36): objs=34590 size=734.67KiB /14/4N (2|25|36): objs=40115 size=976.05KiB /14/5N (2|25|36): objs=14544 size=99.52KiB /14/6S (2|25|36): objs=156 size=276B /14/7N (2|25|36): objs=3749 size=17.22KiB /14/8S (2|25|36): objs=131 size=246B /14/10S (2|25|36): objs=159 size=315B /14/11N (2|25|36): objs=2313 size=9.6KiB /14/12S (2|25|36): objs=152 size=242B /14/14S (2|25|36): objs=143 size=332B /14/15N (2|25|36): objs=3305 size=14.2KiB /14/16S (2|25|36): objs=151 size=321B /14/17N (2|25|36): objs=906 size=3.5KiB /14/18S (2|25|36): objs=165 size=135B /14/19N (2|25|36): objs=607 size=2.23KiB /14/20S (2|25|36): objs=148 size=250B /14/21N (2|25|36): objs=1044 size=4.08KiB /14/22S (2|25|36): objs=165 size=231B /14/23N (2|25|36): objs=1240 size=4.9KiB /14/24S (2|25|36): objs=145 size=329B /14/25N (2|25|36): objs=1798 size=7.68KiB /14/26S (2|25|36): objs=166 size=132B /14/27N (2|25|36): objs=2137 size=9.17KiB /14/28S (2|25|36): objs=154 size=215B /14/29N (2|25|36): objs=276 size=773B /14/30S (2|25|36): objs=151 size=340B /14/31N (2|25|36): objs=2948 size=12.34KiB /14/32S (2|25|36): objs=143 size=268B /14/33N (2|25|36): objs=2472 size=10.2KiB /14/34S (2|25|36): objs=152 size=333B /14/35N (2|25|36): objs=1166 size=5.11KiB /15/0N (2|25|36): objs=15066 size=116.85KiB /15/1S (2|25|36): objs=150 size=205B /15/2N (2|25|36): objs=27131 size=445.19KiB /15/3N (2|25|36): objs=40109 size=897.44KiB /15/4N (2|25|36): objs=31425 size=595.62KiB /15/5S (2|25|36): objs=172 size=226B /15/6N (2|25|36): objs=7866 size=50.47KiB /15/7N (2|25|36): objs=762 size=2.88KiB /15/8S (2|25|36): objs=148 size=278B /15/9N (2|25|36): objs=6662 size=31.67KiB /15/10S (2|25|36): objs=137 size=170B /15/11N (2|25|36): objs=6091 size=29.34KiB /15/12S (2|25|36): objs=128 size=180B /15/13N (2|25|36): objs=9125 size=49.04KiB /15/14S (2|25|36): objs=145 size=133B /15/15S (2|25|36): objs=158 size=127B /15/16S (2|25|36): objs=142 size=123B /15/17N (2|25|36): objs=1088 size=4.62KiB /15/18S (2|25|36): objs=165 size=281B /15/19N (2|25|36): objs=777 size=2.95KiB /15/20S (2|25|36): objs=162 size=255B /15/21N (2|25|36): objs=3132 size=13.75KiB /15/22S (2|25|36): objs=152 size=86B /15/23N (2|25|36): objs=616 size=2.35KiB /15/24S (2|25|36): objs=163 size=284B /15/25N (2|25|36): objs=453 size=1.53KiB /15/26S (2|25|36): objs=134 size=186B /15/27N (2|25|36): objs=1252 size=4.88KiB /15/28S (2|25|36): objs=164 size=93B /15/30S (2|25|36): objs=141 size=238B /15/31N (2|25|36): objs=6520 size=33.17KiB /15/32S (2|25|36): objs=151 size=182B /15/33N (2|25|36): objs=674 size=2.69KiB /15/34S (2|25|36): objs=142 size=180B /15/35N (2|25|36): objs=3060 size=13.31KiB /16/0N (2|25|36): objs=43359 size=1.11MiB /16/1N (2|25|36): objs=38045 size=858.5KiB /16/2N (2|25|36): objs=30372 size=621.36KiB /16/3S (2|25|36): objs=146 size=153B /16/4N (2|25|36): objs=1301 size=5.24KiB /16/5S (2|25|36): objs=139 size=311B /16/6N (2|25|36): objs=7142 size=38.01KiB /16/7S (2|25|36): objs=160 size=323B /16/8N (2|25|36): objs=1887 size=7.83KiB /16/9N (2|25|36): objs=3392 size=14.28KiB /16/10S (2|25|36): objs=161 size=296B /16/11N (2|25|36): objs=629 size=2.47KiB /16/12S (2|25|36): objs=143 size=101B /16/13N (2|25|36): objs=317 size=929B /16/14S (2|25|36): objs=133 size=321B /16/15N (2|25|36): objs=889 size=3.43KiB /16/16S (2|25|36): objs=178 size=276B /16/17N (2|25|36): objs=4687 size=21.66KiB /16/18S (2|25|36): objs=149 size=291B /16/19N (2|25|36): objs=1946 size=7.86KiB /16/20S (2|25|36): objs=163 size=211B /16/21N (2|25|36): objs=4800 size=21.72KiB /16/22S (2|25|36): objs=156 size=289B /16/23N (2|25|36): objs=3147 size=13.83KiB /16/24S (2|25|36): objs=161 size=249B /16/25N (2|25|36): objs=3109 size=13.26KiB /16/26S (2|25|36): objs=152 size=155B /16/27N (2|25|36): objs=4135 size=20.57KiB /16/28S (2|25|36): objs=162 size=117B /16/29N (2|25|36): objs=4569 size=22.48KiB /16/30S (2|25|36): objs=150 size=135B /16/31N (2|25|36): objs=314 size=1.1KiB /16/32S (2|25|36): objs=145 size=142B /16/33N (2|25|36): objs=1834 size=8.07KiB /16/34S (2|25|36): objs=135 size=279B /16/35N (2|25|36): objs=2762 size=11.46KiB /17/0N (2|25|36): objs=35189 size=550.34KiB /17/1N (2|25|36): objs=38114 size=707.34KiB /17/2N (2|25|36): objs=39806 size=948.85KiB /17/3S (2|25|36): objs=143 size=173B /17/4S (2|25|36): objs=144 size=213B /17/5N (2|25|36): objs=1216 size=4.8KiB /17/6S (2|25|36): objs=147 size=325B /17/7N (2|25|36): objs=3676 size=15.69KiB /17/8S (2|25|36): objs=160 size=330B /17/9N (2|25|36): objs=3607 size=15.57KiB /17/10S (2|25|36): objs=146 size=286B /17/11N (2|25|36): objs=5100 size=23.8KiB /17/12S (2|25|36): objs=131 size=123B /17/13N (2|25|36): objs=760 size=2.9KiB /17/14S (2|25|36): objs=163 size=248B /17/15N (2|25|36): objs=1317 size=5.22KiB /17/16S (2|25|36): objs=160 size=195B /17/17N (2|25|36): objs=4502 size=21.45KiB /17/18S (2|25|36): objs=143 size=212B /17/19N (2|25|36): objs=4334 size=19.12KiB /17/20S (2|25|36): objs=140 size=255B /17/21N (2|25|36): objs=3704 size=17.18KiB /17/22S (2|25|36): objs=145 size=222B /17/24S (2|25|36): objs=163 size=287B /17/25N (2|25|36): objs=2186 size=9.17KiB /17/26S (2|25|36): objs=149 size=166B /17/27N (2|25|36): objs=1072 size=4.14KiB /17/28S (2|25|36): objs=143 size=167B /17/29S (2|25|36): objs=147 size=123B /17/30S (2|25|36): objs=162 size=315B /17/31N (2|25|36): objs=4062 size=17.77KiB /17/32S (2|25|36): objs=153 size=101B /17/33N (2|25|36): objs=1222 size=4.87KiB /17/34S (2|25|36): objs=141 size=86B /17/35N (2|25|36): objs=2652 size=11.56KiB /18/0N (2|25|36): objs=36119 size=726.35KiB /18/1N (2|25|36): objs=41551 size=1007.82KiB /18/2N (2|25|36): objs=40469 size=975.51KiB /18/3N (2|25|36): objs=9003 size=42.96KiB /18/4S (2|25|36): objs=161 size=199B /18/5N (2|25|36): objs=2154 size=8.91KiB /18/6S (2|25|36): objs=153 size=314B /18/7N (2|25|36): objs=2379 size=10.06KiB /18/8S (2|25|36): objs=178 size=243B /18/9N (2|25|36): objs=755 size=2.83KiB /18/10S (2|25|36): objs=172 size=279B /18/11N (2|25|36): objs=1373 size=5.66KiB /18/12S (2|25|36): objs=160 size=331B /18/13N (2|25|36): objs=618 size=2.16KiB /18/14S (2|25|36): objs=145 size=332B /18/15N (2|25|36): objs=473 size=1.58KiB /18/16S (2|25|36): objs=145 size=175B /18/17N (2|25|36): objs=2388 size=11.21KiB /18/18S (2|25|36): objs=154 size=103B /18/19N (2|25|36): objs=1511 size=6.53KiB /18/20S (2|25|36): objs=147 size=118B /18/21N (2|25|36): objs=2467 size=11.58KiB /18/22S (2|25|36): objs=154 size=128B /18/23N (2|25|36): objs=940 size=3.7KiB /18/24S (2|25|36): objs=160 size=296B /18/25N (2|25|36): objs=741 size=2.73KiB /18/26S (2|25|36): objs=136 size=316B /18/27N (2|25|36): objs=1478 size=6.05KiB /18/28S (2|25|36): objs=155 size=102B /18/29N (2|25|36): objs=1735 size=7.27KiB /18/30S (2|25|36): objs=148 size=182B /18/31N (2|25|36): objs=3194 size=13.72KiB /18/32S (2|25|36): objs=176 size=145B /18/33N (2|25|36): objs=1054 size=4.49KiB /18/34S (2|25|36): objs=147 size=276B /18/35N (2|25|36): objs=1728 size=7.14KiB /19/0N (2|25|36): objs=40807 size=867.71KiB /19/1N (2|25|36): objs=40674 size=898.24KiB /19/2N (2|25|36): objs=38148 size=851.74KiB /19/3S (2|25|36): objs=170 size=237B /19/4N (2|25|36): objs=2294 size=9.76KiB /19/5N (2|25|36): objs=270 size=942B /19/6S (2|25|36): objs=153 size=112B /19/7N (2|25|36): objs=1540 size=6.49KiB /19/8S (2|25|36): objs=157 size=293B /19/9N (2|25|36): objs=461 size=1.58KiB /19/10S (2|25|36): objs=172 size=114B /19/11N (2|25|36): objs=2169 size=9.29KiB /19/12S (2|25|36): objs=157 size=272B /19/13N (2|25|36): objs=1047 size=4.02KiB /19/14S (2|25|36): objs=154 size=184B /19/15N (2|25|36): objs=6256 size=31.11KiB /19/16S (2|25|36): objs=146 size=93B /19/18S (2|25|36): objs=163 size=301B /19/19N (2|25|36): objs=5403 size=24KiB /19/20S (2|25|36): objs=137 size=182B /19/22S (2|25|36): objs=171 size=141B /19/23N (2|25|36): objs=685 size=2.49KiB /19/24S (2|25|36): objs=147 size=145B /19/25N (2|25|36): objs=1835 size=7.7KiB /19/26S (2|25|36): objs=159 size=117B /19/27N (2|25|36): objs=618 size=2.12KiB /19/28S (2|25|36): objs=139 size=131B /19/29N (2|25|36): objs=3387 size=14.55KiB /19/30S (2|25|36): objs=153 size=190B /19/31N (2|25|36): objs=7340 size=34.55KiB /19/32S (2|25|36): objs=167 size=160B /19/33N (2|25|36): objs=941 size=3.55KiB /19/34S (2|25|36): objs=146 size=241B /20/0N (2|25|36): objs=41386 size=1013.11KiB /20/1N (2|25|36): objs=42109 size=1.08MiB /20/2N (2|25|36): objs=38818 size=879.87KiB /20/3N (2|25|36): objs=8203 size=45.53KiB /20/4S (2|25|36): objs=150 size=304B /20/6S (2|25|36): objs=160 size=247B /20/7N (2|25|36): objs=279 size=869B /20/8S (2|25|36): objs=146 size=295B /20/9N (2|25|36): objs=624 size=2.16KiB /20/10S (2|25|36): objs=146 size=95B /20/11N (2|25|36): objs=322 size=878B /20/12S (2|25|36): objs=150 size=313B /20/14S (2|25|36): objs=151 size=271B /20/15N (2|25|36): objs=465 size=1.6KiB /20/16S (2|25|36): objs=147 size=139B /20/17N (2|25|36): objs=754 size=3.09KiB /20/18S (2|25|36): objs=154 size=257B /20/19N (2|25|36): objs=2693 size=11.75KiB /20/20S (2|25|36): objs=158 size=306B /20/21N (2|25|36): objs=2820 size=11.79KiB /20/22S (2|25|36): objs=176 size=232B /20/23N (2|25|36): objs=1950 size=8.01KiB /20/24S (2|25|36): objs=153 size=257B /20/25N (2|25|36): objs=3500 size=15.23KiB /20/26S (2|25|36): objs=152 size=159B /20/27N (2|25|36): objs=6264 size=28.49KiB /20/28S (2|25|36): objs=167 size=300B /20/29N (2|25|36): objs=3154 size=13.76KiB /20/30S (2|25|36): objs=159 size=151B /20/31N (2|25|36): objs=922 size=3.56KiB /20/32S (2|25|36): objs=137 size=231B /20/34S (2|25|36): objs=145 size=280B /20/35N (2|25|36): objs=4417 size=19KiB /21/0N (2|25|36): objs=19139 size=147.67KiB /21/1S (2|25|36): objs=155 size=326B /21/2N (2|25|36): objs=18572 size=207KiB /21/3N (2|25|36): objs=43407 size=1.01MiB /21/4N (2|25|36): objs=40004 size=966.86KiB /21/5N (2|25|36): objs=8749 size=46.02KiB /21/6S (2|25|36): objs=154 size=222B /21/7N (2|25|36): objs=1376 size=5.36KiB /21/8S (2|25|36): objs=137 size=299B /21/9N (2|25|36): objs=4055 size=19.9KiB /21/10S (2|25|36): objs=154 size=100B /21/11N (2|25|36): objs=1830 size=7.63KiB /21/12S (2|25|36): objs=133 size=241B /21/13N (2|25|36): objs=3473 size=14.88KiB /21/14S (2|25|36): objs=165 size=286B /21/15N (2|25|36): objs=1873 size=8.3KiB /21/16S (2|25|36): objs=186 size=233B /21/17N (2|25|36): objs=1078 size=4.44KiB /21/18S (2|25|36): objs=171 size=133B /21/19N (2|25|36): objs=323 size=871B /21/20S (2|25|36): objs=152 size=183B /21/21N (2|25|36): objs=620 size=2.28KiB /21/22S (2|25|36): objs=147 size=339B /21/23N (2|25|36): objs=1736 size=7.08KiB /21/24S (2|25|36): objs=163 size=181B /21/25N (2|25|36): objs=3411 size=14.67KiB /21/26S (2|25|36): objs=146 size=192B /21/27N (2|25|36): objs=1042 size=4.19KiB /21/28S (2|25|36): objs=134 size=188B /21/29N (2|25|36): objs=624 size=2.33KiB /21/30S (2|25|36): objs=144 size=211B /21/31N (2|25|36): objs=895 size=3.7KiB /21/32S (2|25|36): objs=142 size=317B /21/33N (2|25|36): objs=1657 size=7KiB /21/34S (2|25|36): objs=143 size=205B /21/35N (2|25|36): objs=328 size=939B /22/0N (2|25|36): objs=32586 size=632.12KiB /22/1N (2|25|36): objs=41313 size=1.04MiB /22/2N (2|25|36): objs=35825 size=756.61KiB /22/3N (2|25|36): objs=3227 size=14.56KiB /22/4S (2|25|36): objs=143 size=115B /22/5N (2|25|36): objs=316 size=965B /22/6S (2|25|36): objs=137 size=269B /22/7S (2|25|36): objs=151 size=238B /22/8S (2|25|36): objs=173 size=179B /22/9N (2|25|36): objs=321 size=1018B /22/10S (2|25|36): objs=163 size=95B /22/11N (2|25|36): objs=3645 size=16.27KiB /22/12S (2|25|36): objs=153 size=321B /22/13N (2|25|36): objs=816 size=2.85KiB /22/14S (2|25|36): objs=149 size=268B /22/16S (2|25|36): objs=152 size=315B /22/17N (2|25|36): objs=2531 size=11.14KiB /22/18S (2|25|36): objs=144 size=160B /22/19N (2|25|36): objs=665 size=2.42KiB /22/20S (2|25|36): objs=178 size=253B /22/21N (2|25|36): objs=862 size=3.34KiB /22/22S (2|25|36): objs=162 size=223B /22/23N (2|25|36): objs=8012 size=38.8KiB /22/24S (2|25|36): objs=172 size=215B /22/25N (2|25|36): objs=1332 size=5.24KiB /22/26S (2|25|36): objs=157 size=313B /22/27N (2|25|36): objs=1563 size=6.56KiB /22/28S (2|25|36): objs=156 size=99B /22/29N (2|25|36): objs=4369 size=21.26KiB /22/30S (2|25|36): objs=148 size=345B /22/31N (2|25|36): objs=483 size=1.68KiB /22/32S (2|25|36): objs=154 size=141B /22/33N (2|25|36): objs=3599 size=16.14KiB /22/34S (2|25|36): objs=155 size=329B /22/35N (2|25|36): objs=1557 size=6.44KiB /23/0N (2|25|36): objs=40841 size=965.39KiB /23/1N (2|25|36): objs=38448 size=802.19KiB /23/2N (2|25|36): objs=40808 size=829.27KiB /23/3N (2|25|36): objs=17639 size=169.13KiB /23/4S (2|25|36): objs=186 size=364B /23/5N (2|25|36): objs=1036 size=4.01KiB /23/6S (2|25|36): objs=182 size=269B /23/7N (2|25|36): objs=5814 size=27.52KiB /23/8S (2|25|36): objs=158 size=271B /23/9N (2|25|36): objs=1825 size=7.85KiB /23/10S (2|25|36): objs=157 size=257B /23/11N (2|25|36): objs=3318 size=15.38KiB /23/12S (2|25|36): objs=163 size=299B /23/13N (2|25|36): objs=1684 size=6.65KiB /23/14S (2|25|36): objs=148 size=99B /23/15N (2|25|36): objs=2692 size=12.53KiB /23/16S (2|25|36): objs=149 size=268B /23/18S (2|25|36): objs=161 size=151B /23/19S (2|25|36): objs=140 size=264B /23/20S (2|25|36): objs=163 size=193B /23/21N (2|25|36): objs=2271 size=10.1KiB /23/22S (2|25|36): objs=134 size=325B /23/23N (2|25|36): objs=1372 size=5.58KiB /23/24S (2|25|36): objs=160 size=275B /23/26S (2|25|36): objs=135 size=168B /23/27N (2|25|36): objs=892 size=3.45KiB /23/28S (2|25|36): objs=139 size=161B /23/30S (2|25|36): objs=132 size=216B /23/31N (2|25|36): objs=619 size=2.08KiB /23/32S (2|25|36): objs=168 size=302B /23/33S (2|25|36): objs=147 size=219B /23/34S (2|25|36): objs=154 size=84B /23/35N (2|25|36): objs=4110 size=18.26KiB /24/0N (2|25|36): objs=37729 size=696.86KiB /24/1N (2|25|36): objs=37608 size=726.61KiB /24/2N (2|25|36): objs=4296 size=18.63KiB /24/3S (2|25|36): objs=138 size=107B /24/4N (2|25|36): objs=34967 size=657.47KiB /24/5N (2|25|36): objs=11751 size=65.05KiB /24/6S (2|25|36): objs=146 size=138B /24/7N (2|25|36): objs=2131 size=9.12KiB /24/8S (2|25|36): objs=150 size=93B /24/9N (2|25|36): objs=2010 size=8.28KiB /24/10S (2|25|36): objs=147 size=301B /24/11S (2|25|36): objs=147 size=325B /24/12S (2|25|36): objs=141 size=243B /24/13N (2|25|36): objs=2811 size=12.94KiB /24/14S (2|25|36): objs=146 size=111B /24/15N (2|25|36): objs=1430 size=5.88KiB /24/16S (2|25|36): objs=157 size=300B /24/17N (2|25|36): objs=1081 size=4.28KiB /24/18S (2|25|36): objs=148 size=130B /24/19N (2|25|36): objs=3415 size=14.47KiB /24/20S (2|25|36): objs=151 size=123B /24/22S (2|25|36): objs=154 size=94B /24/23N (2|25|36): objs=4479 size=19.16KiB /24/24S (2|25|36): objs=155 size=319B /24/25S (2|25|36): objs=170 size=270B /24/26S (2|25|36): objs=164 size=331B /24/27N (2|25|36): objs=1816 size=8.28KiB /24/28S (2|25|36): objs=141 size=331B /24/29N (2|25|36): objs=2471 size=10.72KiB /24/30S (2|25|36): objs=142 size=242B /24/31N (2|25|36): objs=1422 size=5.62KiB /24/32S (2|25|36): objs=141 size=177B /24/33N (2|25|36): objs=3476 size=14.75KiB /24/34S (2|25|36): objs=171 size=115B /24/35N (2|25|36): objs=569 size=2.12KiB /25/0N (2|25|36): objs=37548 size=769.48KiB /25/1N (2|25|36): objs=37551 size=892.63KiB /25/2N (2|25|36): objs=34754 size=656.28KiB /25/3N (2|25|36): objs=12787 size=76.21KiB /25/4S (2|25|36): objs=149 size=321B /25/5N (2|25|36): objs=1080 size=4.35KiB /25/6S (2|25|36): objs=152 size=228B /25/8S (2|25|36): objs=152 size=277B /25/9N (2|25|36): objs=471 size=1.55KiB /25/10S (2|25|36): objs=170 size=272B /25/11N (2|25|36): objs=2476 size=10.24KiB /25/12S (2|25|36): objs=154 size=227B /25/13N (2|25|36): objs=2326 size=10.29KiB /25/14S (2|25|36): objs=152 size=169B /25/15S (2|25|36): objs=152 size=149B /25/16S (2|25|36): objs=157 size=223B /25/17N (2|25|36): objs=325 size=923B /25/18S (2|25|36): objs=155 size=275B /25/19N (2|25|36): objs=5237 size=26.51KiB /25/20S (2|25|36): objs=169 size=136B /25/21N (2|25|36): objs=464 size=1.69KiB /25/22S (2|25|36): objs=177 size=192B /25/23N (2|25|36): objs=324 size=806B /25/24S (2|25|36): objs=152 size=269B /25/25N (2|25|36): objs=2010 size=8.55KiB /25/26S (2|25|36): objs=147 size=154B /25/27N (2|25|36): objs=290 size=863B /25/28S (2|25|36): objs=153 size=270B /25/29N (2|25|36): objs=4283 size=19.82KiB /25/30S (2|25|36): objs=142 size=252B /25/31N (2|25|36): objs=893 size=3.64KiB /25/32S (2|25|36): objs=157 size=347B /25/33N (2|25|36): objs=2899 size=12.71KiB /25/34S (2|25|36): objs=165 size=157B /25/35S (2|25|36): objs=162 size=245B /26/0N (2|25|36): objs=45355 size=1.14MiB /26/1N (2|25|36): objs=39638 size=912.91KiB /26/2N (2|25|36): objs=11850 size=67.2KiB /26/3S (2|25|36): objs=152 size=273B /26/4N (2|25|36): objs=22426 size=259.36KiB /26/5S (2|25|36): objs=165 size=314B /26/6N (2|25|36): objs=3586 size=17.24KiB /26/7N (2|25|36): objs=6628 size=34.93KiB /26/8S (2|25|36): objs=146 size=183B /26/9N (2|25|36): objs=3505 size=14.72KiB /26/10S (2|25|36): objs=127 size=317B /26/11N (2|25|36): objs=717 size=2.79KiB /26/12S (2|25|36): objs=152 size=140B /26/13N (2|25|36): objs=4299 size=21.12KiB /26/14S (2|25|36): objs=145 size=206B /26/15N (2|25|36): objs=1049 size=4.15KiB /26/16S (2|25|36): objs=162 size=238B /26/17N (2|25|36): objs=1764 size=7.49KiB /26/18S (2|25|36): objs=150 size=240B /26/19N (2|25|36): objs=496 size=1.72KiB /26/20S (2|25|36): objs=167 size=311B /26/21N (2|25|36): objs=5101 size=23.88KiB /26/22S (2|25|36): objs=132 size=143B /26/23N (2|25|36): objs=4943 size=23.34KiB /26/24S (2|25|36): objs=151 size=215B /26/25N (2|25|36): objs=2521 size=10.65KiB /26/26S (2|25|36): objs=148 size=193B /26/27N (2|25|36): objs=1393 size=5.87KiB /26/28S (2|25|36): objs=163 size=354B /26/29N (2|25|36): objs=3585 size=16.73KiB /26/30S (2|25|36): objs=139 size=178B /26/31N (2|25|36): objs=454 size=1.53KiB /26/32S (2|25|36): objs=163 size=234B /26/33N (2|25|36): objs=778 size=2.95KiB /26/34S (2|25|36): objs=133 size=187B /26/35N (2|25|36): objs=579 size=2.11KiB /27/0N (2|25|36): objs=37076 size=702.52KiB /27/1N (2|25|36): objs=36186 size=701.22KiB /27/2N (2|25|36): objs=40670 size=975.29KiB /27/3N (2|25|36): objs=5818 size=24.96KiB /27/4S (2|25|36): objs=144 size=150B /27/6S (2|25|36): objs=160 size=240B /27/7N (2|25|36): objs=727 size=2.5KiB /27/8S (2|25|36): objs=145 size=90B /27/9N (2|25|36): objs=1081 size=4.08KiB /27/10S (2|25|36): objs=148 size=209B /27/11N (2|25|36): objs=8617 size=44.34KiB /27/12S (2|25|36): objs=164 size=282B /27/13N (2|25|36): objs=3343 size=14.61KiB /27/14S (2|25|36): objs=168 size=190B /27/15N (2|25|36): objs=1309 size=5.36KiB /27/16S (2|25|36): objs=123 size=252B /27/17N (2|25|36): objs=1200 size=4.78KiB /27/18S (2|25|36): objs=150 size=139B /27/19N (2|25|36): objs=2731 size=11.66KiB /27/20S (2|25|36): objs=146 size=215B /27/21N (2|25|36): objs=2252 size=9.8KiB /27/22S (2|25|36): objs=151 size=335B /27/23N (2|25|36): objs=1221 size=4.95KiB /27/24S (2|25|36): objs=135 size=315B /27/25N (2|25|36): objs=1526 size=6.26KiB /27/26S (2|25|36): objs=150 size=213B /27/27N (2|25|36): objs=1626 size=7.26KiB /27/28S (2|25|36): objs=161 size=275B /27/29N (2|25|36): objs=2309 size=9.57KiB /27/30S (2|25|36): objs=167 size=303B /27/32S (2|25|36): objs=146 size=181B /27/33N (2|25|36): objs=928 size=3.58KiB /27/34S (2|25|36): objs=141 size=323B /27/35N (2|25|36): objs=779 size=3.04KiB /28/0N (2|25|36): objs=36469 size=793.47KiB /28/1N (2|25|36): objs=39848 size=1.02MiB /28/2N (2|25|36): objs=41093 size=907.37KiB /28/3N (2|25|36): objs=2182 size=8.91KiB /28/4S (2|25|36): objs=142 size=183B /28/5N (2|25|36): objs=4050 size=17.6KiB /28/6S (2|25|36): objs=138 size=327B /28/8S (2|25|36): objs=135 size=268B /28/9N (2|25|36): objs=1566 size=6.58KiB /28/10S (2|25|36): objs=140 size=132B /28/11N (2|25|36): objs=1415 size=5.68KiB /28/12S (2|25|36): objs=157 size=277B /28/13N (2|25|36): objs=3324 size=14.73KiB /28/14S (2|25|36): objs=135 size=142B /28/15N (2|25|36): objs=1958 size=8.03KiB /28/16S (2|25|36): objs=150 size=275B /28/17N (2|25|36): objs=428 size=1.49KiB /28/18S (2|25|36): objs=139 size=95B /28/20S (2|25|36): objs=157 size=325B /28/21N (2|25|36): objs=8076 size=42.96KiB /28/22S (2|25|36): objs=139 size=184B /28/23N (2|25|36): objs=2192 size=9.04KiB /28/24S (2|25|36): objs=136 size=216B /28/25N (2|25|36): objs=2389 size=10.63KiB /28/26S (2|25|36): objs=141 size=255B /28/27N (2|25|36): objs=4736 size=21.79KiB /28/28S (2|25|36): objs=146 size=249B /28/29S (2|25|36): objs=163 size=182B /28/30S (2|25|36): objs=147 size=96B /28/31N (2|25|36): objs=1296 size=5.2KiB /28/32S (2|25|36): objs=157 size=134B /28/34S (2|25|36): objs=165 size=154B /28/35N (2|25|36): objs=4408 size=19.4KiB /29/0N (2|25|36): objs=38474 size=774.02KiB /29/1N (2|25|36): objs=17738 size=129.45KiB /29/2S (2|25|36): objs=148 size=274B /29/3N (2|25|36): objs=18190 size=114.72KiB /29/4N (2|25|36): objs=38014 size=833.83KiB /29/5N (2|25|36): objs=17943 size=145.36KiB /29/6S (2|25|36): objs=146 size=311B /29/7N (2|25|36): objs=1257 size=5.08KiB /29/8S (2|25|36): objs=145 size=240B /29/9N (2|25|36): objs=1070 size=4.44KiB /29/10S (2|25|36): objs=143 size=321B /29/11N (2|25|36): objs=895 size=3.68KiB /29/12S (2|25|36): objs=137 size=108B /29/13N (2|25|36): objs=746 size=2.92KiB /29/14S (2|25|36): objs=147 size=271B /29/15N (2|25|36): objs=2259 size=9.75KiB /29/16S (2|25|36): objs=164 size=226B /29/17N (2|25|36): objs=463 size=1.68KiB /29/18S (2|25|36): objs=136 size=129B /29/19N (2|25|36): objs=947 size=3.46KiB /29/20S (2|25|36): objs=161 size=105B /29/21N (2|25|36): objs=1967 size=8.28KiB /29/22S (2|25|36): objs=150 size=111B /29/23N (2|25|36): objs=3143 size=13.58KiB /29/24S (2|25|36): objs=158 size=243B /29/25N (2|25|36): objs=2898 size=12.33KiB /29/26S (2|25|36): objs=172 size=268B /29/27N (2|25|36): objs=275 size=825B /29/28S (2|25|36): objs=151 size=275B /29/29N (2|25|36): objs=1874 size=8.74KiB /29/30S (2|25|36): objs=158 size=175B /29/31N (2|25|36): objs=268 size=687B /29/32S (2|25|36): objs=135 size=98B /29/33N (2|25|36): objs=314 size=820B /29/34S (2|25|36): objs=142 size=200B /29/35N (2|25|36): objs=3553 size=15.67KiB /30/0N (2|25|36): objs=39463 size=838.21KiB /30/1N (2|25|36): objs=23319 size=222.83KiB /30/2S (2|25|36): objs=141 size=178B /30/3N (2|25|36): objs=12582 size=77.42KiB /30/4N (2|25|36): objs=44794 size=1.03MiB /30/5N (2|25|36): objs=14472 size=100.8KiB /30/6S (2|25|36): objs=134 size=195B /30/7N (2|25|36): objs=3978 size=17.26KiB /30/8S (2|25|36): objs=151 size=256B /30/9N (2|25|36): objs=1932 size=8.14KiB /30/10S (2|25|36): objs=165 size=150B /30/11N (2|25|36): objs=3878 size=16.68KiB /30/12S (2|25|36): objs=162 size=168B /30/13N (2|25|36): objs=456 size=1.53KiB /30/14S (2|25|36): objs=151 size=209B /30/15N (2|25|36): objs=296 size=941B /30/16S (2|25|36): objs=140 size=182B /30/17N (2|25|36): objs=3701 size=16.16KiB /30/18S (2|25|36): objs=159 size=265B /30/19N (2|25|36): objs=1009 size=3.89KiB /30/20S (2|25|36): objs=146 size=107B /30/22S (2|25|36): objs=150 size=182B /30/23N (2|25|36): objs=594 size=2.24KiB /30/24S (2|25|36): objs=165 size=347B /30/26S (2|25|36): objs=144 size=163B /30/28S (2|25|36): objs=156 size=271B /30/29S (2|25|36): objs=128 size=125B /30/30S (2|25|36): objs=156 size=309B /30/31N (2|25|36): objs=2480 size=10.54KiB /30/32S (2|25|36): objs=181 size=97B /30/33N (2|25|36): objs=1401 size=5.81KiB /30/34S (2|25|36): objs=152 size=343B /30/35N (2|25|36): objs=911 size=3.43KiB /31/0N (2|25|36): objs=40591 size=879.74KiB /31/1N (2|25|36): objs=39597 size=878.12KiB /31/2N (2|25|36): objs=39902 size=834.53KiB /31/3N (2|25|36): objs=7061 size=33.62KiB /31/4S (2|25|36): objs=166 size=303B /31/5N (2|25|36): objs=316 size=1017B /31/6S (2|25|36): objs=155 size=219B /31/7N (2|25|36): objs=300 size=767B /31/8S (2|25|36): objs=154 size=127B /31/9S (2|25|36): objs=137 size=158B /31/10S (2|25|36): objs=138 size=181B /31/11N (2|25|36): objs=4120 size=20.05KiB /31/12S (2|25|36): objs=158 size=170B /31/13N (2|25|36): objs=1045 size=4.02KiB /31/14S (2|25|36): objs=148 size=98B /31/15N (2|25|36): objs=2256 size=9.58KiB /31/16S (2|25|36): objs=144 size=128B /31/17N (2|25|36): objs=2915 size=12.8KiB /31/18S (2|25|36): objs=141 size=223B /31/20S (2|25|36): objs=148 size=210B /31/21N (2|25|36): objs=2896 size=12.39KiB /31/22S (2|25|36): objs=147 size=274B /31/23N (2|25|36): objs=3374 size=14.53KiB /31/24S (2|25|36): objs=146 size=97B /31/25N (2|25|36): objs=1934 size=8.18KiB /31/26S (2|25|36): objs=129 size=115B /31/27N (2|25|36): objs=1451 size=5.75KiB /31/28S (2|25|36): objs=149 size=119B /31/29N (2|25|36): objs=582 size=2.17KiB /31/30S (2|25|36): objs=142 size=282B /31/31N (2|25|36): objs=2097 size=8.82KiB /31/32S (2|25|36): objs=165 size=335B /31/33S (2|25|36): objs=163 size=348B /31/34S (2|25|36): objs=149 size=265B /31/35N (2|25|36): objs=4696 size=20.47KiB com.milaboratory.util.sorting.HashSorterTest > test2 SKIPPED com.milaboratory.util.NSequenceWithQualityPrintHelperTest > test1 SKIPPED com.milaboratory.util.ByteStringTest > testSpeed1 STANDARD_OUT Time per hash: 667ns Addition to hash set (per operation): 2.66us Hash set removal (per operation): 1.35us a WARNING: A terminally deprecated method in java.lang.System has been called WARNING: System::setSecurityManager has been called by org.gradle.api.internal.tasks.testing.worker.TestWorker (file:/usr/share/gradle/lib/plugins/gradle-testing-base-4.4.1.jar) WARNING: Please consider reporting this to the maintainers of org.gradle.api.internal.tasks.testing.worker.TestWorker WARNING: System::setSecurityManager will be removed in a future release Gradle Test Executor 1 finished executing tests. Finished generating test XML results (0.554 secs) into: /build/reproducible-path/milib-2.2.0+dfsg/build/test-results/test Generating HTML test report... Finished generating test html results (0.617 secs) into: /build/reproducible-path/milib-2.2.0+dfsg/build/reports/tests/test :test (Thread[Task worker for ':',5,main]) completed. Took 8 mins 29.213 secs. BUILD SUCCESSFUL in 9m 15s 5 actionable tasks: 3 executed, 2 up-to-date create-stamp debian/debhelper-build-stamp dh_prep dh_auto_install --destdir=debian/libmilib-java/ mh_install jh_installjavadoc dh_installdocs dh_installchangelogs dh_perl dh_link jh_installlibs jh_classpath jh_manifest jh_depends dh_strip_nondeterminism dh_compress dh_fixperms dh_missing dh_installdeb dh_gencontrol dh_md5sums dh_builddeb dpkg-deb: building package 'libmilib-java' in '../libmilib-java_2.2.0+dfsg-1_all.deb'. dpkg-genbuildinfo --build=binary -O../milib_2.2.0+dfsg-1_armhf.buildinfo dpkg-genchanges --build=binary -O../milib_2.2.0+dfsg-1_armhf.changes dpkg-genchanges: info: binary-only upload (no source code included) dpkg-source --after-build . dpkg-buildpackage: info: binary-only upload (no source included) dpkg-genchanges: info: including full source code in upload I: copying local configuration I: unmounting dev/ptmx filesystem I: unmounting dev/pts filesystem I: unmounting dev/shm filesystem I: unmounting proc filesystem I: unmounting sys filesystem I: cleaning the build env I: removing directory /srv/workspace/pbuilder/12854 and its subdirectories I: Current time: Mon Mar 25 04:43:42 -12 2024 I: pbuilder-time-stamp: 1711385022 Mon Mar 25 16:43:59 UTC 2024 I: 1st build successful. Starting 2nd build on remote node virt32c-armhf-rb.debian.net. Mon Mar 25 16:43:59 UTC 2024 I: Preparing to do remote build '2' on virt32c-armhf-rb.debian.net. Mon Mar 25 16:58:39 UTC 2024 I: Deleting $TMPDIR on virt32c-armhf-rb.debian.net. Mon Mar 25 16:58:41 UTC 2024 I: milib_2.2.0+dfsg-1_armhf.changes: Format: 1.8 Date: Fri, 30 Dec 2022 14:38:35 +0100 Source: milib Binary: libmilib-java Architecture: all Version: 2.2.0+dfsg-1 Distribution: unstable Urgency: medium Maintainer: Debian Med Packaging Team Changed-By: Pierre Gruet Description: libmilib-java - library for Next Generation Sequencing (NGS) data processing Changes: milib (2.2.0+dfsg-1) unstable; urgency=medium . * New upstream version 2.2.0+dfsg * Refreshing patches * Raising Standards version to 4.6.2 (no change) Checksums-Sha1: 8751ab750ded5a1e80da958bf1f6ba5121a4050f 776412 libmilib-java_2.2.0+dfsg-1_all.deb 47dba725397fb928a9a06df1185c452bd53afddb 15260 milib_2.2.0+dfsg-1_armhf.buildinfo Checksums-Sha256: 9d263103a291a0df5e0be2923c16eb848bfcb61a35f98a56b0647d804db1c5d7 776412 libmilib-java_2.2.0+dfsg-1_all.deb e3ddae6d898b74e780bfb41d19201fb13c74510620efb936a00bf823767d5578 15260 milib_2.2.0+dfsg-1_armhf.buildinfo Files: 3e12dbbef8c0dc2929397086181e17b8 776412 java optional libmilib-java_2.2.0+dfsg-1_all.deb fad633c699b37943e911032bdc3758b7 15260 java optional milib_2.2.0+dfsg-1_armhf.buildinfo Mon Mar 25 16:58:42 UTC 2024 I: diffoscope 261 will be used to compare the two builds: Running as unit: rb-diffoscope-armhf_32-11865.service # Profiling output for: /usr/bin/diffoscope --timeout 7200 --html /srv/reproducible-results/rbuild-debian/r-b-build.Xe9poXtK/milib_2.2.0+dfsg-1.diffoscope.html --text /srv/reproducible-results/rbuild-debian/r-b-build.Xe9poXtK/milib_2.2.0+dfsg-1.diffoscope.txt --json /srv/reproducible-results/rbuild-debian/r-b-build.Xe9poXtK/milib_2.2.0+dfsg-1.diffoscope.json --profile=- /srv/reproducible-results/rbuild-debian/r-b-build.Xe9poXtK/b1/milib_2.2.0+dfsg-1_armhf.changes /srv/reproducible-results/rbuild-debian/r-b-build.Xe9poXtK/b2/milib_2.2.0+dfsg-1_armhf.changes ## command (total time: 0.000s) 0.000s 1 call cmp (internal) ## has_same_content_as (total time: 0.000s) 0.000s 1 call abc.DotChangesFile ## main (total time: 0.325s) 0.325s 2 calls outputs 0.000s 1 call cleanup ## recognizes (total time: 0.022s) 0.022s 12 calls diffoscope.comparators.binary.FilesystemFile ## specialize (total time: 0.000s) 0.000s 1 call specialize Finished with result: success Main processes terminated with: code=exited/status=0 Service runtime: 616ms CPU time consumed: 615ms Mon Mar 25 16:58:43 UTC 2024 I: diffoscope 261 found no differences in the changes files, and a .buildinfo file also exists. Mon Mar 25 16:58:43 UTC 2024 I: milib from trixie built successfully and reproducibly on armhf. Mon Mar 25 16:58:45 UTC 2024 I: Submitting .buildinfo files to external archives: Mon Mar 25 16:58:45 UTC 2024 I: Submitting 16K b1/milib_2.2.0+dfsg-1_armhf.buildinfo.asc Mon Mar 25 16:58:47 UTC 2024 I: Submitting 16K b2/milib_2.2.0+dfsg-1_armhf.buildinfo.asc Mon Mar 25 16:58:47 UTC 2024 I: Done submitting .buildinfo files to http://buildinfo.debian.net/api/submit. Mon Mar 25 16:58:47 UTC 2024 I: Done submitting .buildinfo files. Mon Mar 25 16:58:47 UTC 2024 I: Removing signed milib_2.2.0+dfsg-1_armhf.buildinfo.asc files: removed './b1/milib_2.2.0+dfsg-1_armhf.buildinfo.asc' removed './b2/milib_2.2.0+dfsg-1_armhf.buildinfo.asc'