I: pbuilder: network access will be disabled during build
I: Current time: Fri May 17 07:56:08 -12 2024
I: pbuilder-time-stamp: 1715975768
I: Building the build Environment
I: extracting base tarball [/var/cache/pbuilder/unstable-reproducible-base.tgz]
I: copying local configuration
W: --override-config is not set; not updating apt.conf Read the manpage for details.
I: mounting /proc filesystem
I: mounting /sys filesystem
I: creating /{dev,run}/shm
I: mounting /dev/pts filesystem
I: redirecting /dev/ptmx to /dev/pts/ptmx
I: policy-rc.d already exists
I: Copying source file
I: copying [milib_2.2.0+dfsg-1.dsc]
I: copying [./milib_2.2.0+dfsg.orig.tar.xz]
I: copying [./milib_2.2.0+dfsg-1.debian.tar.xz]
I: Extracting source
gpgv: Signature made Fri Dec 30 14:08:01 2022 
gpgv:                using RSA key 33CB284313E90BD27DCB4523600316A6DC277476
gpgv: Can't check signature: No public key
dpkg-source: warning: cannot verify inline signature for ./milib_2.2.0+dfsg-1.dsc: no acceptable signature found
dpkg-source: info: extracting milib in milib-2.2.0+dfsg
dpkg-source: info: unpacking milib_2.2.0+dfsg.orig.tar.xz
dpkg-source: info: unpacking milib_2.2.0+dfsg-1.debian.tar.xz
dpkg-source: info: using patch list from debian/patches/series
dpkg-source: info: applying build_gradle.patch
dpkg-source: info: applying guava_interface.patch
dpkg-source: info: applying deactivate_test_reading_build_properties.patch
dpkg-source: info: applying flaky_test.patch
I: Not using root during the build.
I: Installing the build-deps
I: user script /srv/workspace/pbuilder/31058/tmp/hooks/D02_print_environment starting
I: set
  BUILDDIR='/build/reproducible-path'
  BUILDUSERGECOS='first user,first room,first work-phone,first home-phone,first other'
  BUILDUSERNAME='pbuilder1'
  BUILD_ARCH='armhf'
  DEBIAN_FRONTEND='noninteractive'
  DEB_BUILD_OPTIONS='buildinfo=+all reproducible=+all parallel=5 '
  DISTRIBUTION='unstable'
  HOME='/root'
  HOST_ARCH='armhf'
  IFS=' 	
  '
  INVOCATION_ID='479bc79ca9774295bc6c521af405ed08'
  LANG='C'
  LANGUAGE='en_US:en'
  LC_ALL='C'
  MAIL='/var/mail/root'
  OPTIND='1'
  PATH='/usr/sbin:/usr/bin:/sbin:/bin:/usr/games'
  PBCURRENTCOMMANDLINEOPERATION='build'
  PBUILDER_OPERATION='build'
  PBUILDER_PKGDATADIR='/usr/share/pbuilder'
  PBUILDER_PKGLIBDIR='/usr/lib/pbuilder'
  PBUILDER_SYSCONFDIR='/etc'
  PPID='31058'
  PS1='# '
  PS2='> '
  PS4='+ '
  PWD='/'
  SHELL='/bin/bash'
  SHLVL='2'
  SUDO_COMMAND='/usr/bin/timeout -k 18.1h 18h /usr/bin/ionice -c 3 /usr/bin/nice /usr/sbin/pbuilder --build --configfile /srv/reproducible-results/rbuild-debian/r-b-build.mp6MxaNR/pbuilderrc_lS8X --distribution unstable --hookdir /etc/pbuilder/first-build-hooks --debbuildopts -b --basetgz /var/cache/pbuilder/unstable-reproducible-base.tgz --buildresult /srv/reproducible-results/rbuild-debian/r-b-build.mp6MxaNR/b1 --logfile b1/build.log milib_2.2.0+dfsg-1.dsc'
  SUDO_GID='114'
  SUDO_UID='109'
  SUDO_USER='jenkins'
  TERM='unknown'
  TZ='/usr/share/zoneinfo/Etc/GMT+12'
  USER='root'
  _='/usr/bin/systemd-run'
  http_proxy='http://10.0.0.15:3142/'
I: uname -a
  Linux ff64a 6.1.0-21-arm64 #1 SMP Debian 6.1.90-1 (2024-05-03) aarch64 GNU/Linux
I: ls -l /bin
  lrwxrwxrwx 1 root root 7 May 16 07:45 /bin -> usr/bin
I: user script /srv/workspace/pbuilder/31058/tmp/hooks/D02_print_environment finished
 -> Attempting to satisfy build-dependencies
 -> Creating pbuilder-satisfydepends-dummy package
Package: pbuilder-satisfydepends-dummy
Version: 0.invalid.0
Architecture: armhf
Maintainer: Debian Pbuilder Team <pbuilder-maint@lists.alioth.debian.org>
Description: Dummy package to satisfy dependencies with aptitude - created by pbuilder
 This package was created automatically by pbuilder to satisfy the
 build-dependencies of the package being currently built.
Depends: debhelper-compat (= 13), default-jdk, gradle-debian-helper, javahelper, maven-repo-helper, junit4, libcommons-compress-java, libcommons-io-java, libcommons-math3-java, libguava-java, libjackson2-annotations-java, libjackson2-core-java, libjackson2-databind-java, libjcommander-java, liblz4-java, libmockito-java, libredberry-pipe-java, libtrove3-java
dpkg-deb: building package 'pbuilder-satisfydepends-dummy' in '/tmp/satisfydepends-aptitude/pbuilder-satisfydepends-dummy.deb'.
Selecting previously unselected package pbuilder-satisfydepends-dummy.
(Reading database ... 19464 files and directories currently installed.)
Preparing to unpack .../pbuilder-satisfydepends-dummy.deb ...
Unpacking pbuilder-satisfydepends-dummy (0.invalid.0) ...
dpkg: pbuilder-satisfydepends-dummy: dependency problems, but configuring anyway as you requested:
 pbuilder-satisfydepends-dummy depends on debhelper-compat (= 13); however:
  Package debhelper-compat is not installed.
 pbuilder-satisfydepends-dummy depends on default-jdk; however:
  Package default-jdk is not installed.
 pbuilder-satisfydepends-dummy depends on gradle-debian-helper; however:
  Package gradle-debian-helper is not installed.
 pbuilder-satisfydepends-dummy depends on javahelper; however:
  Package javahelper is not installed.
 pbuilder-satisfydepends-dummy depends on maven-repo-helper; however:
  Package maven-repo-helper is not installed.
 pbuilder-satisfydepends-dummy depends on junit4; however:
  Package junit4 is not installed.
 pbuilder-satisfydepends-dummy depends on libcommons-compress-java; however:
  Package libcommons-compress-java is not installed.
 pbuilder-satisfydepends-dummy depends on libcommons-io-java; however:
  Package libcommons-io-java is not installed.
 pbuilder-satisfydepends-dummy depends on libcommons-math3-java; however:
  Package libcommons-math3-java is not installed.
 pbuilder-satisfydepends-dummy depends on libguava-java; however:
  Package libguava-java is not installed.
 pbuilder-satisfydepends-dummy depends on libjackson2-annotations-java; however:
  Package libjackson2-annotations-java is not installed.
 pbuilder-satisfydepends-dummy depends on libjackson2-core-java; however:
  Package libjackson2-core-java is not installed.
 pbuilder-satisfydepends-dummy depends on libjackson2-databind-java; however:
  Package libjackson2-databind-java is not installed.
 pbuilder-satisfydepends-dummy depends on libjcommander-java; however:
  Package libjcommander-java is not installed.
 pbuilder-satisfydepends-dummy depends on liblz4-java; however:
  Package liblz4-java is not installed.
 pbuilder-satisfydepends-dummy depends on libmockito-java; however:
  Package libmockito-java is not installed.
 pbuilder-satisfydepends-dummy depends on libredberry-pipe-java; however:
  Package libredberry-pipe-java is not installed.
 pbuilder-satisfydepends-dummy depends on libtrove3-java; however:
  Package libtrove3-java is not installed.

Setting up pbuilder-satisfydepends-dummy (0.invalid.0) ...
Reading package lists...
Building dependency tree...
Reading state information...
Initializing package states...
Writing extended state information...
Building tag database...
pbuilder-satisfydepends-dummy is already installed at the requested version (0.invalid.0)
pbuilder-satisfydepends-dummy is already installed at the requested version (0.invalid.0)
The following NEW packages will be installed:
  adwaita-icon-theme{a} ant{a} ant-optional{a} antlr{a} at-spi2-common{a} autoconf{a} automake{a} autopoint{a} autotools-dev{a} binfmt-support{a} bnd{a} bsdextrautils{a} ca-certificates{a} ca-certificates-java{a} dctrl-tools{a} debhelper{a} default-jdk{a} default-jdk-headless{a} default-jre{a} default-jre-headless{a} devscripts{a} dh-autoreconf{a} dh-strip-nondeterminism{a} dirmngr{a} dwz{a} fastjar{a} file{a} fontconfig{a} fontconfig-config{a} fonts-dejavu-core{a} fonts-dejavu-mono{a} gettext{a} gettext-base{a} gnupg{a} gnupg-l10n{a} gnupg-utils{a} gpg{a} gpg-agent{a} gpg-wks-client{a} gpgconf{a} gpgsm{a} gradle{a} gradle-debian-helper{a} groff-base{a} groovy{a} gtk-update-icon-cache{a} hicolor-icon-theme{a} intltool-debian{a} ivy{a} jarwrapper{a} java-common{a} java-wrappers{a} javahelper{a} junit4{a} libantlr-java{a} libaopalliance-java{a} libapache-pom-java{a} libarchive-zip-perl{a} libasm-java{a} libasound2-data{a} libasound2t64{a} libassuan0{a} libatinject-jsr330-api-java{a} libatk1.0-0t64{a} libavahi-client3{a} libavahi-common-data{a} libavahi-common3{a} libb-hooks-op-check-perl{a} libbcel-java{a} libbcpg-java{a} libbcprov-java{a} libbrotli1{a} libbsd0{a} libbsf-java{a} libbsh-java{a} libbyte-buddy-java{a} libcairo2{a} libcdi-api-java{a} libclass-method-modifiers-perl{a} libclass-xsaccessor-perl{a} libclone-perl{a} libcom-err2{a} libcommons-cli-java{a} libcommons-codec-java{a} libcommons-collections3-java{a} libcommons-compress-java{a} libcommons-io-java{a} libcommons-lang-java{a} libcommons-lang3-java{a} libcommons-logging-java{a} libcommons-math3-java{a} libcommons-parent-java{a} libcups2t64{a} libdatrie1{a} libdbus-1-3{a} libdd-plist-java{a} libdebhelper-perl{a} libdeflate0{a} libdevel-callchecker-perl{a} libdom4j-java{a} libdrm-amdgpu1{a} libdrm-common{a} libdrm-nouveau2{a} libdrm-radeon1{a} libdrm2{a} libdynaloader-functions-perl{a} libeclipse-jdt-annotation-java{a} libedit2{a} libel-api-java{a} libelf1t64{a} libencode-locale-perl{a} liberror-prone-java{a} libexpat1{a} libfelix-framework-java{a} libfelix-gogo-runtime-java{a} libfelix-resolver-java{a} libfile-dirlist-perl{a} libfile-homedir-perl{a} libfile-listing-perl{a} libfile-stripnondeterminism-perl{a} libfile-touch-perl{a} libfile-which-perl{a} libfindbugs-java{a} libfontconfig1{a} libfreetype6{a} libfribidi0{a} libgdk-pixbuf-2.0-0{a} libgdk-pixbuf2.0-common{a} libgeronimo-annotation-1.3-spec-java{a} libgeronimo-interceptor-3.0-spec-java{a} libgif7{a} libgl1{a} libgl1-mesa-dri{a} libglapi-mesa{a} libglib2.0-0t64{a} libglvnd0{a} libglx-mesa0{a} libglx0{a} libgoogle-gson-java{a} libgradle-core-java{a} libgradle-plugins-java{a} libgraphite2-3{a} libgssapi-krb5-2{a} libgtk2.0-0t64{a} libgtk2.0-common{a} libguava-java{a} libguice-java{a} libhamcrest-java{a} libharfbuzz0b{a} libhawtjni-runtime-java{a} libhtml-parser-perl{a} libhtml-tagset-perl{a} libhtml-tree-perl{a} libhttp-cookies-perl{a} libhttp-date-perl{a} libhttp-message-perl{a} libhttp-negotiate-perl{a} libhttpclient-java{a} libhttpcore-java{a} libicu72{a} libimport-into-perl{a} libio-html-perl{a} libio-pty-perl{a} libio-socket-ssl-perl{a} libipc-run-perl{a} libjackson2-annotations-java{a} libjackson2-core-java{a} libjackson2-databind-java{a} libjansi-java{a} libjansi-native-java{a} libjansi1-java{a} libjarjar-java{a} libjatl-java{a} libjavaewah-java{a} libjaxen-java{a} libjbig0{a} libjcifs-java{a} libjcip-annotations-java{a} libjcommander-java{a} libjetty9-java{a} libjformatstring-java{a} libjgit-java{a} libjline2-java{a} libjna-java{a} libjna-jni{a} libjpeg62-turbo{a} libjs-jquery{a} libjsch-java{a} libjsoup-java{a} libjsp-api-java{a} libjsr305-java{a} libjzlib-java{a} libk5crypto3{a} libkeyutils1{a} libkrb5-3{a} libkrb5support0{a} libkryo-java{a} libksba8{a} liblcms2-2{a} libldap-2.5-0{a} liblerc4{a} libllvm17t64{a} liblogback-java{a} liblwp-mediatypes-perl{a} liblwp-protocol-https-perl{a} liblz4-java{a} liblz4-jni{a} libmagic-mgc{a} libmagic1t64{a} libmaven-parent-java{a} libmaven-resolver-java{a} libmaven-shared-utils-java{a} libmaven3-core-java{a} libminlog-java{a} libmockito-java{a} libmodule-runtime-perl{a} libmoo-perl{a} libnative-platform-java{a} libnative-platform-jni{a} libnekohtml-java{a} libnet-http-perl{a} libnet-ssleay-perl{a} libnpth0t64{a} libnspr4{a} libnss3{a} libobjenesis-java{a} libosgi-annotation-java{a} libosgi-compendium-java{a} libosgi-core-java{a} libpango-1.0-0{a} libpangocairo-1.0-0{a} libpangoft2-1.0-0{a} libparams-classify-perl{a} libpcsclite1{a} libpipeline1{a} libpixman-1-0{a} libplexus-cipher-java{a} libplexus-classworlds-java{a} libplexus-component-annotations-java{a} libplexus-container-default-java{a} libplexus-interpolation-java{a} libplexus-sec-dispatcher-java{a} libplexus-utils2-java{a} libpng16-16t64{a} libpolyglot-maven-java{a} libpython3-stdlib{a} libpython3.11-minimal{a} libpython3.11-stdlib{a} libqdox-java{a} libreadline8t64{a} libredberry-pipe-java{a} libreflectasm-java{a} librhino-java{a} librole-tiny-perl{a} libsasl2-2{a} libsasl2-modules-db{a} libsensors-config{a} libsensors5{a} libservlet-api-java{a} libsharpyuv0{a} libsimple-http-java{a} libsisu-inject-java{a} libsisu-plexus-java{a} libslf4j-java{a} libsub-override-perl{a} libsub-quote-perl{a} libthai-data{a} libthai0{a} libtiff6{a} libtimedate-perl{a} libtool{a} libtrove3-java{a} libtry-tiny-perl{a} libuchardet0{a} liburi-perl{a} libvulkan1{a} libwagon-file-java{a} libwagon-http-java{a} libwagon-provider-api-java{a} libwebp7{a} libwebsocket-api-java{a} libwww-perl{a} libwww-robotrules-perl{a} libx11-6{a} libx11-data{a} libx11-xcb1{a} libxau6{a} libxbean-reflect-java{a} libxcb-dri2-0{a} libxcb-dri3-0{a} libxcb-glx0{a} libxcb-present0{a} libxcb-randr0{a} libxcb-render0{a} libxcb-shm0{a} libxcb-sync1{a} libxcb-xfixes0{a} libxcb1{a} libxcomposite1{a} libxcursor1{a} libxdamage1{a} libxdmcp6{a} libxerces2-java{a} libxext6{a} libxfixes3{a} libxi6{a} libxinerama1{a} libxml-commons-external-java{a} libxml-commons-resolver1.1-java{a} libxml2{a} libxpp3-java{a} libxrandr2{a} libxrender1{a} libxshmfence1{a} libxstream-java{a} libxtst6{a} libxxf86vm1{a} libxz-java{a} libyaml-snake-java{a} libz3-4{a} m4{a} man-db{a} maven-repo-helper{a} media-types{a} netbase{a} openjdk-17-jdk{a} openjdk-17-jdk-headless{a} openjdk-17-jre{a} openjdk-17-jre-headless{a} openssl{a} patchutils{a} perl-openssl-defaults{a} pinentry-curses{a} po-debconf{a} python3{a} python3-minimal{a} python3.11{a} python3.11-minimal{a} readline-common{a} sensible-utils{a} shared-mime-info{a} testng{a} tzdata{a} unzip{a} wdiff{a} x11-common{a} 
The following packages are RECOMMENDED but will NOT be installed:
  alsa-topology-conf alsa-ucm-conf curl dbus debian-keyring dput dput-ng dupload equivs fonts-dejavu-extra javascript-common krb5-locales libarchive-cpio-perl libatk-wrapper-java-jni libbindex-java libdata-dump-perl libdistro-info-perl libgail-common libgdk-pixbuf2.0-bin libgit-wrapper-perl libgitlab-api-v4-perl libglib2.0-data libgpars-groovy-java libgtk2.0-bin libhtml-form-perl libhtml-format-perl libhttp-daemon-perl libio-compress-brotli-perl libjson-perl libldap-common liblist-compare-perl libltdl-dev libmail-sendmail-perl libmailtools-perl libnamespace-clean-perl libreflectasm-java-doc librsvg2-common libsasl2-modules libsoap-lite-perl libstring-shellquote-perl libxstring-perl libxt-dev licensecheck lintian lynx mesa-vulkan-drivers pristine-tar python3-apt python3-debian python3-magic python3-requests python3-unidiff python3-xdg strace wget xdg-user-dirs 
0 packages upgraded, 346 newly installed, 0 to remove and 0 not upgraded.
Need to get 286 MB of archives. After unpacking 714 MB will be used.
Writing extended state information...
Get: 1 http://deb.debian.org/debian unstable/main armhf libpipeline1 armhf 1.5.7-2 [33.3 kB]
Get: 2 http://deb.debian.org/debian unstable/main armhf binfmt-support armhf 2.2.2-7 [55.3 kB]
Get: 3 http://deb.debian.org/debian unstable/main armhf libpython3.11-minimal armhf 3.11.9-1 [805 kB]
Get: 4 http://deb.debian.org/debian unstable/main armhf libexpat1 armhf 2.6.2-1 [83.5 kB]
Get: 5 http://deb.debian.org/debian unstable/main armhf python3.11-minimal armhf 3.11.9-1 [1600 kB]
Get: 6 http://deb.debian.org/debian unstable/main armhf python3-minimal armhf 3.11.8-1 [26.3 kB]
Get: 7 http://deb.debian.org/debian unstable/main armhf media-types all 10.1.0 [26.9 kB]
Get: 8 http://deb.debian.org/debian unstable/main armhf netbase all 6.4 [12.8 kB]
Get: 9 http://deb.debian.org/debian unstable/main armhf tzdata all 2024a-4 [255 kB]
Get: 10 http://deb.debian.org/debian unstable/main armhf readline-common all 8.2-4 [69.3 kB]
Get: 11 http://deb.debian.org/debian unstable/main armhf libreadline8t64 armhf 8.2-4 [145 kB]
Get: 12 http://deb.debian.org/debian unstable/main armhf libpython3.11-stdlib armhf 3.11.9-1 [1704 kB]
Get: 13 http://deb.debian.org/debian unstable/main armhf python3.11 armhf 3.11.9-1 [602 kB]
Get: 14 http://deb.debian.org/debian unstable/main armhf libpython3-stdlib armhf 3.11.8-1 [9332 B]
Get: 15 http://deb.debian.org/debian unstable/main armhf python3 armhf 3.11.8-1 [27.4 kB]
Get: 16 http://deb.debian.org/debian unstable/main armhf sensible-utils all 0.0.22 [22.4 kB]
Get: 17 http://deb.debian.org/debian unstable/main armhf openssl armhf 3.2.1-3 [1326 kB]
Get: 18 http://deb.debian.org/debian unstable/main armhf ca-certificates all 20240203 [158 kB]
Get: 19 http://deb.debian.org/debian unstable/main armhf libmagic-mgc armhf 1:5.45-3 [314 kB]
Get: 20 http://deb.debian.org/debian unstable/main armhf libmagic1t64 armhf 1:5.45-3 [98.1 kB]
Get: 21 http://deb.debian.org/debian unstable/main armhf file armhf 1:5.45-3 [42.0 kB]
Get: 22 http://deb.debian.org/debian unstable/main armhf gettext-base armhf 0.21-14+b1 [157 kB]
Get: 23 http://deb.debian.org/debian unstable/main armhf libuchardet0 armhf 0.0.8-1+b1 [65.7 kB]
Get: 24 http://deb.debian.org/debian unstable/main armhf groff-base armhf 1.23.0-4 [1090 kB]
Get: 25 http://deb.debian.org/debian unstable/main armhf bsdextrautils armhf 2.40.1-1 [85.8 kB]
Get: 26 http://deb.debian.org/debian unstable/main armhf man-db armhf 2.12.1-1 [1375 kB]
Get: 27 http://deb.debian.org/debian unstable/main armhf libgdk-pixbuf2.0-common all 2.42.12+dfsg-1 [311 kB]
Get: 28 http://deb.debian.org/debian unstable/main armhf libglib2.0-0t64 armhf 2.80.2-1 [1314 kB]
Get: 29 http://deb.debian.org/debian unstable/main armhf libicu72 armhf 72.1-4+b1 [9070 kB]
Get: 30 http://deb.debian.org/debian unstable/main armhf libxml2 armhf 2.9.14+dfsg-1.3+b3 [598 kB]
Get: 31 http://deb.debian.org/debian unstable/main armhf shared-mime-info armhf 2.4-4 [753 kB]
Get: 32 http://deb.debian.org/debian unstable/main armhf libjpeg62-turbo armhf 1:2.1.5-3 [143 kB]
Get: 33 http://deb.debian.org/debian unstable/main armhf libpng16-16t64 armhf 1.6.43-5 [262 kB]
Get: 34 http://deb.debian.org/debian unstable/main armhf libdeflate0 armhf 1.20-1 [35.9 kB]
Get: 35 http://deb.debian.org/debian unstable/main armhf libjbig0 armhf 2.1-6.1+b1 [27.3 kB]
Get: 36 http://deb.debian.org/debian unstable/main armhf liblerc4 armhf 4.0.0+ds-4+b1 [137 kB]
Get: 37 http://deb.debian.org/debian unstable/main armhf libsharpyuv0 armhf 1.4.0-0.1 [111 kB]
Get: 38 http://deb.debian.org/debian unstable/main armhf libwebp7 armhf 1.4.0-0.1 [265 kB]
Get: 39 http://deb.debian.org/debian unstable/main armhf libtiff6 armhf 4.5.1+git230720-4 [301 kB]
Get: 40 http://deb.debian.org/debian unstable/main armhf libgdk-pixbuf-2.0-0 armhf 2.42.12+dfsg-1 [123 kB]
Get: 41 http://deb.debian.org/debian unstable/main armhf gtk-update-icon-cache armhf 3.24.41-4 [45.6 kB]
Get: 42 http://deb.debian.org/debian unstable/main armhf hicolor-icon-theme all 0.17-2 [11.4 kB]
Get: 43 http://deb.debian.org/debian unstable/main armhf adwaita-icon-theme all 46.0-1 [614 kB]
Get: 44 http://deb.debian.org/debian unstable/main armhf ca-certificates-java all 20240118 [11.6 kB]
Get: 45 http://deb.debian.org/debian unstable/main armhf java-common all 0.75 [6640 B]
Get: 46 http://deb.debian.org/debian unstable/main armhf liblcms2-2 armhf 2.14-2+b1 [126 kB]
Get: 47 http://deb.debian.org/debian unstable/main armhf libnspr4 armhf 2:4.35-1.1+b1 [87.2 kB]
Get: 48 http://deb.debian.org/debian unstable/main armhf libnss3 armhf 2:3.100-1 [1221 kB]
Get: 49 http://deb.debian.org/debian unstable/main armhf libpcsclite1 armhf 2.2.1-1 [50.9 kB]
Get: 50 http://deb.debian.org/debian unstable/main armhf openjdk-17-jre-headless armhf 17.0.11+9-1 [38.2 MB]
Get: 51 http://deb.debian.org/debian unstable/main armhf default-jre-headless armhf 2:1.17-75 [3068 B]
Get: 52 http://deb.debian.org/debian unstable/main armhf ant all 1.10.14-1 [2162 kB]
Get: 53 http://deb.debian.org/debian unstable/main armhf ant-optional all 1.10.14-1 [455 kB]
Get: 54 http://deb.debian.org/debian unstable/main armhf libantlr-java all 2.7.7+dfsg-13 [458 kB]
Get: 55 http://deb.debian.org/debian unstable/main armhf antlr all 2.7.7+dfsg-13 [8272 B]
Get: 56 http://deb.debian.org/debian unstable/main armhf at-spi2-common all 2.52.0-1 [166 kB]
Get: 57 http://deb.debian.org/debian unstable/main armhf m4 armhf 1.4.19-4 [264 kB]
Get: 58 http://deb.debian.org/debian unstable/main armhf autoconf all 2.71-3 [332 kB]
Get: 59 http://deb.debian.org/debian unstable/main armhf autotools-dev all 20220109.1 [51.6 kB]
Get: 60 http://deb.debian.org/debian unstable/main armhf automake all 1:1.16.5-1.3 [823 kB]
Get: 61 http://deb.debian.org/debian unstable/main armhf autopoint all 0.21-14 [496 kB]
Get: 62 http://deb.debian.org/debian unstable/main armhf unzip armhf 6.0-28 [152 kB]
Get: 63 http://deb.debian.org/debian unstable/main armhf java-wrappers all 0.4 [8916 B]
Get: 64 http://deb.debian.org/debian unstable/main armhf libhamcrest-java all 2.2-2 [121 kB]
Get: 65 http://deb.debian.org/debian unstable/main armhf junit4 all 4.13.2-4 [349 kB]
Get: 66 http://deb.debian.org/debian unstable/main armhf libfelix-framework-java all 4.6.1-2.1 [569 kB]
Get: 67 http://deb.debian.org/debian unstable/main armhf libfelix-gogo-runtime-java all 0.16.2-1.1 [114 kB]
Get: 68 http://deb.debian.org/debian unstable/main armhf libosgi-annotation-java all 8.1.0-1 [9436 B]
Get: 69 http://deb.debian.org/debian unstable/main armhf libosgi-core-java all 8.0.0-2 [182 kB]
Get: 70 http://deb.debian.org/debian unstable/main armhf libfelix-resolver-java all 1.16.0-1 [180 kB]
Get: 71 http://deb.debian.org/debian unstable/main armhf libhawtjni-runtime-java all 1.18-1 [36.3 kB]
Get: 72 http://deb.debian.org/debian unstable/main armhf libjansi-native-java all 1.8-2 [26.0 kB]
Get: 73 http://deb.debian.org/debian unstable/main armhf libjansi1-java all 1.18-3 [66.5 kB]
Get: 74 http://deb.debian.org/debian unstable/main armhf libjline2-java all 2.14.6-5 [151 kB]
Get: 75 http://deb.debian.org/debian unstable/main armhf libosgi-compendium-java all 7.0.0-1 [477 kB]
Get: 76 http://deb.debian.org/debian unstable/main armhf libslf4j-java all 1.7.32-1 [144 kB]
Get: 77 http://deb.debian.org/debian unstable/main armhf libxz-java all 1.9-1 [143 kB]
Get: 78 http://deb.debian.org/debian unstable/main armhf libyaml-snake-java all 1.33-2 [321 kB]
Get: 79 http://deb.debian.org/debian unstable/main armhf bnd all 5.0.1-5 [10.1 MB]
Get: 80 http://deb.debian.org/debian unstable/main armhf dctrl-tools armhf 2.24-3 [96.0 kB]
Get: 81 http://deb.debian.org/debian unstable/main armhf libdebhelper-perl all 13.15.3 [88.0 kB]
Get: 82 http://deb.debian.org/debian unstable/main armhf libtool all 2.4.7-7 [517 kB]
Get: 83 http://deb.debian.org/debian unstable/main armhf dh-autoreconf all 20 [17.1 kB]
Get: 84 http://deb.debian.org/debian unstable/main armhf libarchive-zip-perl all 1.68-1 [104 kB]
Get: 85 http://deb.debian.org/debian unstable/main armhf libsub-override-perl all 0.10-1 [10.6 kB]
Get: 86 http://deb.debian.org/debian unstable/main armhf libfile-stripnondeterminism-perl all 1.13.1-1 [19.4 kB]
Get: 87 http://deb.debian.org/debian unstable/main armhf dh-strip-nondeterminism all 1.13.1-1 [8620 B]
Get: 88 http://deb.debian.org/debian unstable/main armhf libelf1t64 armhf 0.191-1+b1 [183 kB]
Get: 89 http://deb.debian.org/debian unstable/main armhf dwz armhf 0.15-1+b2 [106 kB]
Get: 90 http://deb.debian.org/debian unstable/main armhf gettext armhf 0.21-14+b1 [1230 kB]
Get: 91 http://deb.debian.org/debian unstable/main armhf intltool-debian all 0.35.0+20060710.6 [22.9 kB]
Get: 92 http://deb.debian.org/debian unstable/main armhf po-debconf all 1.0.21+nmu1 [248 kB]
Get: 93 http://deb.debian.org/debian unstable/main armhf debhelper all 13.15.3 [901 kB]
Get: 94 http://deb.debian.org/debian unstable/main armhf libgtk2.0-common all 2.24.33-4 [2661 kB]
Get: 95 http://deb.debian.org/debian unstable/main armhf libatk1.0-0t64 armhf 2.52.0-1 [44.0 kB]
Get: 96 http://deb.debian.org/debian unstable/main armhf libbrotli1 armhf 1.1.0-2+b3 [284 kB]
Get: 97 http://deb.debian.org/debian unstable/main armhf libfreetype6 armhf 2.13.2+dfsg-1+b4 [372 kB]
Get: 98 http://deb.debian.org/debian unstable/main armhf fonts-dejavu-mono all 2.37-8 [489 kB]
Get: 99 http://deb.debian.org/debian unstable/main armhf fonts-dejavu-core all 2.37-8 [840 kB]
Get: 100 http://deb.debian.org/debian unstable/main armhf fontconfig-config armhf 2.15.0-1.1 [317 kB]
Get: 101 http://deb.debian.org/debian unstable/main armhf libfontconfig1 armhf 2.15.0-1.1 [370 kB]
Get: 102 http://deb.debian.org/debian unstable/main armhf libpixman-1-0 armhf 0.42.2-1+b1 [476 kB]
Get: 103 http://deb.debian.org/debian unstable/main armhf libxau6 armhf 1:1.0.9-1+b1 [17.4 kB]
Get: 104 http://deb.debian.org/debian unstable/main armhf libbsd0 armhf 0.12.2-1 [127 kB]
Get: 105 http://deb.debian.org/debian unstable/main armhf libxdmcp6 armhf 1:1.1.2-3+b1 [23.0 kB]
Get: 106 http://deb.debian.org/debian unstable/main armhf libxcb1 armhf 1.17.0-1 [140 kB]
Get: 107 http://deb.debian.org/debian unstable/main armhf libx11-data all 2:1.8.7-1 [328 kB]
Get: 108 http://deb.debian.org/debian unstable/main armhf libx11-6 armhf 2:1.8.7-1+b1 [739 kB]
Get: 109 http://deb.debian.org/debian unstable/main armhf libxcb-render0 armhf 1.17.0-1 [114 kB]
Get: 110 http://deb.debian.org/debian unstable/main armhf libxcb-shm0 armhf 1.17.0-1 [105 kB]
Get: 111 http://deb.debian.org/debian unstable/main armhf libxext6 armhf 2:1.3.4-1+b1 [47.8 kB]
Get: 112 http://deb.debian.org/debian unstable/main armhf libxrender1 armhf 1:0.9.10-1.1+b1 [24.9 kB]
Get: 113 http://deb.debian.org/debian unstable/main armhf libcairo2 armhf 1.18.0-3+b1 [442 kB]
Get: 114 http://deb.debian.org/debian unstable/main armhf libavahi-common-data armhf 0.8-13+b2 [112 kB]
Get: 115 http://deb.debian.org/debian unstable/main armhf libavahi-common3 armhf 0.8-13+b2 [40.2 kB]
Get: 116 http://deb.debian.org/debian unstable/main armhf libdbus-1-3 armhf 1.14.10-4+b1 [181 kB]
Get: 117 http://deb.debian.org/debian unstable/main armhf libavahi-client3 armhf 0.8-13+b2 [43.4 kB]
Get: 118 http://deb.debian.org/debian unstable/main armhf libkrb5support0 armhf 1.20.1-6+b1 [30.6 kB]
Get: 119 http://deb.debian.org/debian unstable/main armhf libcom-err2 armhf 1.47.1~rc2-1 [21.8 kB]
Get: 120 http://deb.debian.org/debian unstable/main armhf libk5crypto3 armhf 1.20.1-6+b1 [75.5 kB]
Get: 121 http://deb.debian.org/debian unstable/main armhf libkeyutils1 armhf 1.6.3-3 [7908 B]
Get: 122 http://deb.debian.org/debian unstable/main armhf libkrb5-3 armhf 1.20.1-6+b1 [290 kB]
Get: 123 http://deb.debian.org/debian unstable/main armhf libgssapi-krb5-2 armhf 1.20.1-6+b1 [112 kB]
Get: 124 http://deb.debian.org/debian unstable/main armhf libcups2t64 armhf 2.4.7-1.2+b1 [213 kB]
Get: 125 http://deb.debian.org/debian unstable/main armhf fontconfig armhf 2.15.0-1.1 [461 kB]
Get: 126 http://deb.debian.org/debian unstable/main armhf libfribidi0 armhf 1.0.13-3+b1 [69.4 kB]
Get: 127 http://deb.debian.org/debian unstable/main armhf libgraphite2-3 armhf 1.3.14-2 [63.2 kB]
Get: 128 http://deb.debian.org/debian unstable/main armhf libharfbuzz0b armhf 8.3.0-2+b1 [2156 kB]
Get: 129 http://deb.debian.org/debian unstable/main armhf libthai-data all 0.1.29-2 [168 kB]
Get: 130 http://deb.debian.org/debian unstable/main armhf libdatrie1 armhf 0.2.13-3 [34.4 kB]
Get: 131 http://deb.debian.org/debian unstable/main armhf libthai0 armhf 0.1.29-2 [45.8 kB]
Get: 132 http://deb.debian.org/debian unstable/main armhf libpango-1.0-0 armhf 1.52.2+ds-1 [195 kB]
Get: 133 http://deb.debian.org/debian unstable/main armhf libpangoft2-1.0-0 armhf 1.52.2+ds-1 [41.8 kB]
Get: 134 http://deb.debian.org/debian unstable/main armhf libpangocairo-1.0-0 armhf 1.52.2+ds-1 [31.2 kB]
Get: 135 http://deb.debian.org/debian unstable/main armhf libxcomposite1 armhf 1:0.4.5-1+b1 [14.4 kB]
Get: 136 http://deb.debian.org/debian unstable/main armhf libxfixes3 armhf 1:6.0.0-2+b1 [18.6 kB]
Get: 137 http://deb.debian.org/debian unstable/main armhf libxcursor1 armhf 1:1.2.1-1+b1 [33.2 kB]
Get: 138 http://deb.debian.org/debian unstable/main armhf libxdamage1 armhf 1:1.1.6-1+b1 [14.8 kB]
Get: 139 http://deb.debian.org/debian unstable/main armhf libxi6 armhf 2:1.8.1-1 [73.8 kB]
Get: 140 http://deb.debian.org/debian unstable/main armhf libxinerama1 armhf 2:1.1.4-3+b1 [15.6 kB]
Get: 141 http://deb.debian.org/debian unstable/main armhf libxrandr2 armhf 2:1.5.4-1 [33.0 kB]
Get: 142 http://deb.debian.org/debian unstable/main armhf libgtk2.0-0t64 armhf 2.24.33-4 [1556 kB]
Get: 143 http://deb.debian.org/debian unstable/main armhf libglvnd0 armhf 1.7.0-1+b1 [52.2 kB]
Get: 144 http://deb.debian.org/debian unstable/main armhf libdrm-common all 2.4.120-2 [7688 B]
Get: 145 http://deb.debian.org/debian unstable/main armhf libdrm2 armhf 2.4.120-2 [33.8 kB]
Get: 146 http://deb.debian.org/debian unstable/main armhf libglapi-mesa armhf 24.0.7-1 [43.1 kB]
Get: 147 http://deb.debian.org/debian unstable/main armhf libx11-xcb1 armhf 2:1.8.7-1+b1 [232 kB]
Get: 148 http://deb.debian.org/debian unstable/main armhf libxcb-dri2-0 armhf 1.17.0-1 [106 kB]
Get: 149 http://deb.debian.org/debian unstable/main armhf libxcb-dri3-0 armhf 1.17.0-1 [106 kB]
Get: 150 http://deb.debian.org/debian unstable/main armhf libxcb-glx0 armhf 1.17.0-1 [120 kB]
Get: 151 http://deb.debian.org/debian unstable/main armhf libxcb-present0 armhf 1.17.0-1 [105 kB]
Get: 152 http://deb.debian.org/debian unstable/main armhf libxcb-randr0 armhf 1.17.0-1 [115 kB]
Get: 153 http://deb.debian.org/debian unstable/main armhf libxcb-sync1 armhf 1.17.0-1 [108 kB]
Get: 154 http://deb.debian.org/debian unstable/main armhf libxcb-xfixes0 armhf 1.17.0-1 [109 kB]
Get: 155 http://deb.debian.org/debian unstable/main armhf libxshmfence1 armhf 1.3-1+b1 [8628 B]
Get: 156 http://deb.debian.org/debian unstable/main armhf libxxf86vm1 armhf 1:1.1.4-1+b2 [20.2 kB]
Get: 157 http://deb.debian.org/debian unstable/main armhf libvulkan1 armhf 1.3.280.0-1 [108 kB]
Get: 158 http://deb.debian.org/debian unstable/main armhf libdrm-amdgpu1 armhf 2.4.120-2 [20.0 kB]
Get: 159 http://deb.debian.org/debian unstable/main armhf libdrm-nouveau2 armhf 2.4.120-2 [16.9 kB]
Get: 160 http://deb.debian.org/debian unstable/main armhf libdrm-radeon1 armhf 2.4.120-2 [19.5 kB]
Get: 161 http://deb.debian.org/debian unstable/main armhf libedit2 armhf 3.1-20230828-1+b1 [77.6 kB]
Get: 162 http://deb.debian.org/debian unstable/main armhf libz3-4 armhf 4.8.12-3.1+b2 [6324 kB]
Get: 163 http://deb.debian.org/debian unstable/main armhf libllvm17t64 armhf 1:17.0.6-12 [21.6 MB]
Get: 164 http://deb.debian.org/debian unstable/main armhf libsensors-config all 1:3.6.0-9 [14.6 kB]
Get: 165 http://deb.debian.org/debian unstable/main armhf libsensors5 armhf 1:3.6.0-9 [31.9 kB]
Get: 166 http://deb.debian.org/debian unstable/main armhf libgl1-mesa-dri armhf 24.0.7-1 [6476 kB]
Get: 167 http://deb.debian.org/debian unstable/main armhf libglx-mesa0 armhf 24.0.7-1 [130 kB]
Get: 168 http://deb.debian.org/debian unstable/main armhf libglx0 armhf 1.7.0-1+b1 [32.6 kB]
Get: 169 http://deb.debian.org/debian unstable/main armhf libgl1 armhf 1.7.0-1+b1 [91.1 kB]
Get: 170 http://deb.debian.org/debian unstable/main armhf libasound2-data all 1.2.11-1 [20.9 kB]
Get: 171 http://deb.debian.org/debian unstable/main armhf libasound2t64 armhf 1.2.11-1+b1 [316 kB]
Get: 172 http://deb.debian.org/debian unstable/main armhf libgif7 armhf 5.2.2-1 [41.2 kB]
Get: 173 http://deb.debian.org/debian unstable/main armhf x11-common all 1:7.7+23 [252 kB]
Get: 174 http://deb.debian.org/debian unstable/main armhf libxtst6 armhf 2:1.2.3-1.1+b1 [24.2 kB]
Get: 175 http://deb.debian.org/debian unstable/main armhf openjdk-17-jre armhf 17.0.11+9-1 [163 kB]
Get: 176 http://deb.debian.org/debian unstable/main armhf default-jre armhf 2:1.17-75 [1056 B]
Get: 177 http://deb.debian.org/debian unstable/main armhf openjdk-17-jdk-headless armhf 17.0.11+9-1 [67.5 MB]
Get: 178 http://deb.debian.org/debian unstable/main armhf default-jdk-headless armhf 2:1.17-75 [1108 B]
Get: 179 http://deb.debian.org/debian unstable/main armhf openjdk-17-jdk armhf 17.0.11+9-1 [10.1 kB]
Get: 180 http://deb.debian.org/debian unstable/main armhf default-jdk armhf 2:1.17-75 [1068 B]
Get: 181 http://deb.debian.org/debian unstable/main armhf libassuan0 armhf 2.5.6-1+b1 [43.8 kB]
Get: 182 http://deb.debian.org/debian unstable/main armhf gpgconf armhf 2.2.43-6 [103 kB]
Get: 183 http://deb.debian.org/debian unstable/main armhf libksba8 armhf 1.6.6-1 [112 kB]
Get: 184 http://deb.debian.org/debian unstable/main armhf libsasl2-modules-db armhf 2.1.28+dfsg1-6 [18.0 kB]
Get: 185 http://deb.debian.org/debian unstable/main armhf libsasl2-2 armhf 2.1.28+dfsg1-6 [50.1 kB]
Get: 186 http://deb.debian.org/debian unstable/main armhf libldap-2.5-0 armhf 2.5.17+dfsg-1 [161 kB]
Get: 187 http://deb.debian.org/debian unstable/main armhf libnpth0t64 armhf 1.6-3.1 [16.9 kB]
Get: 188 http://deb.debian.org/debian unstable/main armhf dirmngr armhf 2.2.43-6 [320 kB]
Get: 189 http://deb.debian.org/debian unstable/main armhf gnupg-l10n all 2.2.43-6 [701 kB]
Get: 190 http://deb.debian.org/debian unstable/main armhf gnupg-utils armhf 2.2.43-6 [425 kB]
Get: 191 http://deb.debian.org/debian unstable/main armhf gpg armhf 2.2.43-6 [458 kB]
Get: 192 http://deb.debian.org/debian unstable/main armhf pinentry-curses armhf 1.2.1-3+b2 [74.2 kB]
Get: 193 http://deb.debian.org/debian unstable/main armhf gpg-agent armhf 2.2.43-6 [208 kB]
Get: 194 http://deb.debian.org/debian unstable/main armhf gpg-wks-client armhf 2.2.43-6 [85.2 kB]
Get: 195 http://deb.debian.org/debian unstable/main armhf gpgsm armhf 2.2.43-6 [215 kB]
Get: 196 http://deb.debian.org/debian unstable/main armhf gnupg all 2.2.43-6 [374 kB]
Get: 197 http://deb.debian.org/debian unstable/main armhf libfile-dirlist-perl all 0.05-3 [7600 B]
Get: 198 http://deb.debian.org/debian unstable/main armhf libfile-which-perl all 1.27-2 [15.1 kB]
Get: 199 http://deb.debian.org/debian unstable/main armhf libfile-homedir-perl all 1.006-2 [42.4 kB]
Get: 200 http://deb.debian.org/debian unstable/main armhf libfile-touch-perl all 0.12-2 [8816 B]
Get: 201 http://deb.debian.org/debian unstable/main armhf libio-pty-perl armhf 1:1.20-1+b1 [33.9 kB]
Get: 202 http://deb.debian.org/debian unstable/main armhf libipc-run-perl all 20231003.0-2 [101 kB]
Get: 203 http://deb.debian.org/debian unstable/main armhf libclass-method-modifiers-perl all 2.15-1 [18.0 kB]
Get: 204 http://deb.debian.org/debian unstable/main armhf libclass-xsaccessor-perl armhf 1.19-4+b3 [35.4 kB]
Get: 205 http://deb.debian.org/debian unstable/main armhf libb-hooks-op-check-perl armhf 0.22-3+b1 [10.2 kB]
Get: 206 http://deb.debian.org/debian unstable/main armhf libdynaloader-functions-perl all 0.003-3 [12.7 kB]
Get: 207 http://deb.debian.org/debian unstable/main armhf libdevel-callchecker-perl armhf 0.009-1 [15.7 kB]
Get: 208 http://deb.debian.org/debian unstable/main armhf libparams-classify-perl armhf 0.015-2+b3 [21.3 kB]
Get: 209 http://deb.debian.org/debian unstable/main armhf libmodule-runtime-perl all 0.016-2 [19.6 kB]
Get: 210 http://deb.debian.org/debian unstable/main armhf libimport-into-perl all 1.002005-2 [11.3 kB]
Get: 211 http://deb.debian.org/debian unstable/main armhf librole-tiny-perl all 2.002004-1 [21.4 kB]
Get: 212 http://deb.debian.org/debian unstable/main armhf libsub-quote-perl all 2.006008-1 [21.8 kB]
Get: 213 http://deb.debian.org/debian unstable/main armhf libmoo-perl all 2.005005-1 [58.0 kB]
Get: 214 http://deb.debian.org/debian unstable/main armhf libencode-locale-perl all 1.05-3 [12.9 kB]
Get: 215 http://deb.debian.org/debian unstable/main armhf libtimedate-perl all 2.3300-2 [39.3 kB]
Get: 216 http://deb.debian.org/debian unstable/main armhf libhttp-date-perl all 6.06-1 [10.7 kB]
Get: 217 http://deb.debian.org/debian unstable/main armhf libfile-listing-perl all 6.16-1 [12.4 kB]
Get: 218 http://deb.debian.org/debian unstable/main armhf libhtml-tagset-perl all 3.24-1 [14.7 kB]
Get: 219 http://deb.debian.org/debian unstable/main armhf liburi-perl all 5.28-1 [98.6 kB]
Get: 220 http://deb.debian.org/debian unstable/main armhf libhtml-parser-perl armhf 3.82-1 [95.6 kB]
Get: 221 http://deb.debian.org/debian unstable/main armhf libhtml-tree-perl all 5.07-3 [211 kB]
Get: 222 http://deb.debian.org/debian unstable/main armhf libclone-perl armhf 0.46-1+b2 [13.1 kB]
Get: 223 http://deb.debian.org/debian unstable/main armhf libio-html-perl all 1.004-3 [16.2 kB]
Get: 224 http://deb.debian.org/debian unstable/main armhf liblwp-mediatypes-perl all 6.04-2 [20.2 kB]
Get: 225 http://deb.debian.org/debian unstable/main armhf libhttp-message-perl all 6.45-1 [82.0 kB]
Get: 226 http://deb.debian.org/debian unstable/main armhf libhttp-cookies-perl all 6.11-1 [19.1 kB]
Get: 227 http://deb.debian.org/debian unstable/main armhf libhttp-negotiate-perl all 6.01-2 [13.1 kB]
Get: 228 http://deb.debian.org/debian unstable/main armhf perl-openssl-defaults armhf 7+b2 [6708 B]
Get: 229 http://deb.debian.org/debian unstable/main armhf libnet-ssleay-perl armhf 1.94-1+b1 [319 kB]
Get: 230 http://deb.debian.org/debian unstable/main armhf libio-socket-ssl-perl all 2.085-1 [218 kB]
Get: 231 http://deb.debian.org/debian unstable/main armhf libnet-http-perl all 6.23-1 [23.9 kB]
Get: 232 http://deb.debian.org/debian unstable/main armhf liblwp-protocol-https-perl all 6.14-1 [10.8 kB]
Get: 233 http://deb.debian.org/debian unstable/main armhf libtry-tiny-perl all 0.31-2 [22.6 kB]
Get: 234 http://deb.debian.org/debian unstable/main armhf libwww-robotrules-perl all 6.02-1 [12.9 kB]
Get: 235 http://deb.debian.org/debian unstable/main armhf libwww-perl all 6.77-1 [183 kB]
Get: 236 http://deb.debian.org/debian unstable/main armhf patchutils armhf 0.4.2-1 [72.5 kB]
Get: 237 http://deb.debian.org/debian unstable/main armhf wdiff armhf 1.2.2-6 [118 kB]
Get: 238 http://deb.debian.org/debian unstable/main armhf devscripts all 2.23.7 [1068 kB]
Get: 239 http://deb.debian.org/debian unstable/main armhf fastjar armhf 2:0.98-7 [43.9 kB]
Get: 240 http://deb.debian.org/debian unstable/main armhf ivy all 2.5.2-1 [1295 kB]
Get: 241 http://deb.debian.org/debian unstable/main armhf libasm-java all 9.7-1 [394 kB]
Get: 242 http://deb.debian.org/debian unstable/main armhf libbsf-java all 1:2.4.0-8 [76.3 kB]
Get: 243 http://deb.debian.org/debian unstable/main armhf libcommons-cli-java all 1.6.0-1 [60.4 kB]
Get: 244 http://deb.debian.org/debian unstable/main armhf libapache-pom-java all 29-2 [5276 B]
Get: 245 http://deb.debian.org/debian unstable/main armhf libcommons-parent-java all 56-1 [10.8 kB]
Get: 246 http://deb.debian.org/debian unstable/main armhf libcommons-logging-java all 1.3.0-1 [68.6 kB]
Get: 247 http://deb.debian.org/debian unstable/main armhf libjansi-java all 2.4.1-2 [100 kB]
Get: 248 http://deb.debian.org/debian unstable/main armhf libjsp-api-java all 2.3.4-3 [53.7 kB]
Get: 249 http://deb.debian.org/debian unstable/main armhf libqdox-java all 1.12.1-3 [172 kB]
Get: 250 http://deb.debian.org/debian unstable/main armhf libservlet-api-java all 4.0.1-2 [81.0 kB]
Get: 251 http://deb.debian.org/debian unstable/main armhf libxpp3-java all 1.1.4c-3 [292 kB]
Get: 252 http://deb.debian.org/debian unstable/main armhf libxstream-java all 1.4.20-1 [565 kB]
Get: 253 http://deb.debian.org/debian unstable/main armhf groovy all 2.4.21-10 [12.8 MB]
Get: 254 http://deb.debian.org/debian unstable/main armhf libatinject-jsr330-api-java all 1.0+ds1-5 [5312 B]
Get: 255 http://deb.debian.org/debian unstable/main armhf libcommons-collections3-java all 3.2.2-3 [530 kB]
Get: 256 http://deb.debian.org/debian unstable/main armhf libcommons-compress-java all 1.25.0-1 [635 kB]
Get: 257 http://deb.debian.org/debian unstable/main armhf libcommons-io-java all 2.16.1-1 [480 kB]
Get: 258 http://deb.debian.org/debian unstable/main armhf libcommons-lang-java all 2.6-10 [273 kB]
Get: 259 http://deb.debian.org/debian unstable/main armhf liberror-prone-java all 2.18.0-1 [22.5 kB]
Get: 260 http://deb.debian.org/debian unstable/main armhf libjsr305-java all 0.1~+svn49-11 [26.9 kB]
Get: 261 http://deb.debian.org/debian unstable/main armhf libguava-java all 32.0.1-1 [2708 kB]
Get: 262 http://deb.debian.org/debian unstable/main armhf libcommons-codec-java all 1.16.0-1 [297 kB]
Get: 263 http://deb.debian.org/debian unstable/main armhf libhttpcore-java all 4.4.16-1 [636 kB]
Get: 264 http://deb.debian.org/debian unstable/main armhf libhttpclient-java all 4.5.14-1 [1247 kB]
Get: 265 http://deb.debian.org/debian unstable/main armhf libjarjar-java all 1.4+svn142-12 [205 kB]
Get: 266 http://deb.debian.org/debian unstable/main armhf libjcip-annotations-java all 20060626-6 [11.8 kB]
Get: 267 http://deb.debian.org/debian unstable/main armhf libjna-jni armhf 5.14.0-1 [60.1 kB]
Get: 268 http://deb.debian.org/debian unstable/main armhf libjna-java all 5.14.0-1 [237 kB]
Get: 269 http://deb.debian.org/debian unstable/main armhf libjzlib-java all 1.1.3-3 [79.4 kB]
Get: 270 http://deb.debian.org/debian unstable/main armhf libjsch-java all 0.1.55-1 [298 kB]
Get: 271 http://deb.debian.org/debian unstable/main armhf libminlog-java all 1.3.0-1.1 [7928 B]
Get: 272 http://deb.debian.org/debian unstable/main armhf libobjenesis-java all 3.3-3 [41.3 kB]
Get: 273 http://deb.debian.org/debian unstable/main armhf libreflectasm-java all 1.11.9+dfsg-4 [25.0 kB]
Get: 274 http://deb.debian.org/debian unstable/main armhf libkryo-java all 2.20-7 [158 kB]
Get: 275 http://deb.debian.org/debian unstable/main armhf liblogback-java all 1:1.2.11-5 [701 kB]
Get: 276 http://deb.debian.org/debian unstable/main armhf libnative-platform-jni armhf 0.14-6 [10.2 kB]
Get: 277 http://deb.debian.org/debian unstable/main armhf libnative-platform-java all 0.14-6 [69.8 kB]
Get: 278 http://deb.debian.org/debian unstable/main armhf libxml-commons-external-java all 1.4.01-6 [240 kB]
Get: 279 http://deb.debian.org/debian unstable/main armhf libxml-commons-resolver1.1-java all 1.2-11 [98.3 kB]
Get: 280 http://deb.debian.org/debian unstable/main armhf libxerces2-java all 2.12.2-1 [1440 kB]
Get: 281 http://deb.debian.org/debian unstable/main armhf libnekohtml-java all 1.9.22.noko2-0.1 [125 kB]
Get: 282 http://deb.debian.org/debian unstable/main armhf libxbean-reflect-java all 4.5-8 [133 kB]
Get: 283 http://deb.debian.org/debian unstable/main armhf libgradle-core-java all 4.4.1-20 [4293 kB]
Get: 284 http://deb.debian.org/debian unstable/main armhf libbcprov-java all 1.77-1 [5300 kB]
Get: 285 http://deb.debian.org/debian unstable/main armhf libbcpg-java all 1.77-1 [428 kB]
Get: 286 http://deb.debian.org/debian unstable/main armhf libbsh-java all 2.0b4-20 [291 kB]
Get: 287 http://deb.debian.org/debian unstable/main armhf libdd-plist-java all 1.20-1.1 [72.6 kB]
Get: 288 http://deb.debian.org/debian unstable/main armhf libjaxen-java all 1.1.6-4 [214 kB]
Get: 289 http://deb.debian.org/debian unstable/main armhf libdom4j-java all 2.1.4-1 [312 kB]
Get: 290 http://deb.debian.org/debian unstable/main armhf libbcel-java all 6.5.0-2 [634 kB]
Get: 291 http://deb.debian.org/debian unstable/main armhf libjformatstring-java all 0.10~20131207-2.1 [34.5 kB]
Get: 292 http://deb.debian.org/debian unstable/main armhf libfindbugs-java all 3.1.0~preview2-3 [3502 kB]
Get: 293 http://deb.debian.org/debian unstable/main armhf libgoogle-gson-java all 2.10.1-1 [262 kB]
Get: 294 http://deb.debian.org/debian unstable/main armhf libaopalliance-java all 20070526-7 [8572 B]
Get: 295 http://deb.debian.org/debian unstable/main armhf libguice-java all 4.2.3-2 [1435 kB]
Get: 296 http://deb.debian.org/debian unstable/main armhf libjatl-java all 0.2.3-1.1 [29.0 kB]
Get: 297 http://deb.debian.org/debian unstable/main armhf libjcifs-java all 1.3.19-2 [394 kB]
Get: 298 http://deb.debian.org/debian unstable/main armhf libeclipse-jdt-annotation-java all 2.2.700+eclipse4.26-2 [25.3 kB]
Get: 299 http://deb.debian.org/debian unstable/main armhf libjavaewah-java all 1.2.3-1 [159 kB]
Get: 300 http://deb.debian.org/debian unstable/main armhf libel-api-java all 3.0.0-3 [64.9 kB]
Get: 301 http://deb.debian.org/debian unstable/main armhf libwebsocket-api-java all 1.1-2 [40.1 kB]
Get: 302 http://deb.debian.org/debian unstable/main armhf libjetty9-java all 9.4.54-1 [2980 kB]
Get: 303 http://deb.debian.org/debian unstable/main armhf libjgit-java all 6.7.0-1 [3153 kB]
Get: 304 http://deb.debian.org/debian unstable/main armhf libjs-jquery all 3.6.1+dfsg+~3.5.14-1 [326 kB]
Get: 305 http://deb.debian.org/debian unstable/main armhf libcommons-lang3-java all 3.14.0-1 [621 kB]
Get: 306 http://deb.debian.org/debian unstable/main armhf libplexus-utils2-java all 3.4.2-1 [258 kB]
Get: 307 http://deb.debian.org/debian unstable/main armhf libwagon-provider-api-java all 3.5.3-1 [48.2 kB]
Get: 308 http://deb.debian.org/debian unstable/main armhf libmaven-resolver-java all 1.6.3-1 [548 kB]
Get: 309 http://deb.debian.org/debian unstable/main armhf libgeronimo-annotation-1.3-spec-java all 1.3-1 [11.1 kB]
Get: 310 http://deb.debian.org/debian unstable/main armhf libmaven-parent-java all 35-1 [6140 B]
Get: 311 http://deb.debian.org/debian unstable/main armhf libmaven-shared-utils-java all 3.3.4-1 [138 kB]
Get: 312 http://deb.debian.org/debian unstable/main armhf libplexus-cipher-java all 2.0-1 [14.9 kB]
Get: 313 http://deb.debian.org/debian unstable/main armhf libplexus-classworlds-java all 2.7.0-1 [50.6 kB]
Get: 314 http://deb.debian.org/debian unstable/main armhf libplexus-component-annotations-java all 2.1.1-1 [7660 B]
Get: 315 http://deb.debian.org/debian unstable/main armhf libplexus-interpolation-java all 1.26-1 [76.8 kB]
Get: 316 http://deb.debian.org/debian unstable/main armhf libplexus-sec-dispatcher-java all 2.0-3 [28.3 kB]
Get: 317 http://deb.debian.org/debian unstable/main armhf libgeronimo-interceptor-3.0-spec-java all 1.0.1-4 [8484 B]
Get: 318 http://deb.debian.org/debian unstable/main armhf libcdi-api-java all 1.2-3 [54.3 kB]
Get: 319 http://deb.debian.org/debian unstable/main armhf libsisu-inject-java all 0.3.4-2 [347 kB]
Get: 320 http://deb.debian.org/debian unstable/main armhf libsisu-plexus-java all 0.3.4-3 [181 kB]
Get: 321 http://deb.debian.org/debian unstable/main armhf libmaven3-core-java all 3.8.7-2 [1573 kB]
Get: 322 http://deb.debian.org/debian unstable/main armhf libplexus-container-default-java all 2.1.1-1 [193 kB]
Get: 323 http://deb.debian.org/debian unstable/main armhf libpolyglot-maven-java all 0.8~tobrien+git20120905-10 [74.9 kB]
Get: 324 http://deb.debian.org/debian unstable/main armhf librhino-java all 1.7.14-2.1 [1357 kB]
Get: 325 http://deb.debian.org/debian unstable/main armhf libsimple-http-java all 4.1.21-1.1 [211 kB]
Get: 326 http://deb.debian.org/debian unstable/main armhf libwagon-file-java all 3.5.3-1 [8388 B]
Get: 327 http://deb.debian.org/debian unstable/main armhf libjsoup-java all 1.15.3-1 [431 kB]
Get: 328 http://deb.debian.org/debian unstable/main armhf libwagon-http-java all 3.5.3-1 [49.5 kB]
Get: 329 http://deb.debian.org/debian unstable/main armhf libjcommander-java all 1.71-4 [73.0 kB]
Get: 330 http://deb.debian.org/debian unstable/main armhf testng all 6.9.12-4 [795 kB]
Get: 331 http://deb.debian.org/debian unstable/main armhf libgradle-plugins-java all 4.4.1-20 [5206 kB]
Get: 332 http://deb.debian.org/debian unstable/main armhf gradle all 4.4.1-20 [398 kB]
Get: 333 http://deb.debian.org/debian unstable/main armhf maven-repo-helper all 1.11 [142 kB]
Get: 334 http://deb.debian.org/debian unstable/main armhf gradle-debian-helper all 2.4 [24.5 kB]
Get: 335 http://deb.debian.org/debian unstable/main armhf jarwrapper all 0.79 [10.1 kB]
Get: 336 http://deb.debian.org/debian unstable/main armhf javahelper all 0.79 [84.6 kB]
Get: 337 http://deb.debian.org/debian unstable/main armhf libbyte-buddy-java all 1.14.13-1 [4709 kB]
Get: 338 http://deb.debian.org/debian unstable/main armhf libcommons-math3-java all 3.6.1-3 [2018 kB]
Get: 339 http://deb.debian.org/debian unstable/main armhf libjackson2-annotations-java all 2.14.0-1 [68.8 kB]
Get: 340 http://deb.debian.org/debian unstable/main armhf libjackson2-core-java all 2.14.1-1 [447 kB]
Get: 341 http://deb.debian.org/debian unstable/main armhf libjackson2-databind-java all 2.14.0-1 [1584 kB]
Get: 342 http://deb.debian.org/debian unstable/main armhf liblz4-jni armhf 1.8.0-4 [9672 B]
Get: 343 http://deb.debian.org/debian unstable/main armhf liblz4-java all 1.8.0-4 [116 kB]
Get: 344 http://deb.debian.org/debian unstable/main armhf libmockito-java all 2.23.0-2 [479 kB]
Get: 345 http://deb.debian.org/debian unstable/main armhf libredberry-pipe-java all 1.0.0~alpha0-3 [62.7 kB]
Get: 346 http://deb.debian.org/debian unstable/main armhf libtrove3-java all 3.0.3-5 [2146 kB]
Fetched 286 MB in 8s (37.2 MB/s)
debconf: delaying package configuration, since apt-utils is not installed
Selecting previously unselected package libpipeline1:armhf.
(Reading database ... 
(Reading database ... 5%
(Reading database ... 10%
(Reading database ... 15%
(Reading database ... 20%
(Reading database ... 25%
(Reading database ... 30%
(Reading database ... 35%
(Reading database ... 40%
(Reading database ... 45%
(Reading database ... 50%
(Reading database ... 55%
(Reading database ... 60%
(Reading database ... 65%
(Reading database ... 70%
(Reading database ... 75%
(Reading database ... 80%
(Reading database ... 85%
(Reading database ... 90%
(Reading database ... 95%
(Reading database ... 100%
(Reading database ... 19464 files and directories currently installed.)
Preparing to unpack .../libpipeline1_1.5.7-2_armhf.deb ...
Unpacking libpipeline1:armhf (1.5.7-2) ...
Selecting previously unselected package binfmt-support.
Preparing to unpack .../binfmt-support_2.2.2-7_armhf.deb ...
Unpacking binfmt-support (2.2.2-7) ...
Selecting previously unselected package libpython3.11-minimal:armhf.
Preparing to unpack .../libpython3.11-minimal_3.11.9-1_armhf.deb ...
Unpacking libpython3.11-minimal:armhf (3.11.9-1) ...
Selecting previously unselected package libexpat1:armhf.
Preparing to unpack .../libexpat1_2.6.2-1_armhf.deb ...
Unpacking libexpat1:armhf (2.6.2-1) ...
Selecting previously unselected package python3.11-minimal.
Preparing to unpack .../python3.11-minimal_3.11.9-1_armhf.deb ...
Unpacking python3.11-minimal (3.11.9-1) ...
Setting up libpython3.11-minimal:armhf (3.11.9-1) ...
Setting up libexpat1:armhf (2.6.2-1) ...
Setting up python3.11-minimal (3.11.9-1) ...
Selecting previously unselected package python3-minimal.
(Reading database ... 
(Reading database ... 5%
(Reading database ... 10%
(Reading database ... 15%
(Reading database ... 20%
(Reading database ... 25%
(Reading database ... 30%
(Reading database ... 35%
(Reading database ... 40%
(Reading database ... 45%
(Reading database ... 50%
(Reading database ... 55%
(Reading database ... 60%
(Reading database ... 65%
(Reading database ... 70%
(Reading database ... 75%
(Reading database ... 80%
(Reading database ... 85%
(Reading database ... 90%
(Reading database ... 95%
(Reading database ... 100%
(Reading database ... 19803 files and directories currently installed.)
Preparing to unpack .../0-python3-minimal_3.11.8-1_armhf.deb ...
Unpacking python3-minimal (3.11.8-1) ...
Selecting previously unselected package media-types.
Preparing to unpack .../1-media-types_10.1.0_all.deb ...
Unpacking media-types (10.1.0) ...
Selecting previously unselected package netbase.
Preparing to unpack .../2-netbase_6.4_all.deb ...
Unpacking netbase (6.4) ...
Selecting previously unselected package tzdata.
Preparing to unpack .../3-tzdata_2024a-4_all.deb ...
Unpacking tzdata (2024a-4) ...
Selecting previously unselected package readline-common.
Preparing to unpack .../4-readline-common_8.2-4_all.deb ...
Unpacking readline-common (8.2-4) ...
Selecting previously unselected package libreadline8t64:armhf.
Preparing to unpack .../5-libreadline8t64_8.2-4_armhf.deb ...
Adding 'diversion of /lib/arm-linux-gnueabihf/libhistory.so.8 to /lib/arm-linux-gnueabihf/libhistory.so.8.usr-is-merged by libreadline8t64'
Adding 'diversion of /lib/arm-linux-gnueabihf/libhistory.so.8.2 to /lib/arm-linux-gnueabihf/libhistory.so.8.2.usr-is-merged by libreadline8t64'
Adding 'diversion of /lib/arm-linux-gnueabihf/libreadline.so.8 to /lib/arm-linux-gnueabihf/libreadline.so.8.usr-is-merged by libreadline8t64'
Adding 'diversion of /lib/arm-linux-gnueabihf/libreadline.so.8.2 to /lib/arm-linux-gnueabihf/libreadline.so.8.2.usr-is-merged by libreadline8t64'
Unpacking libreadline8t64:armhf (8.2-4) ...
Selecting previously unselected package libpython3.11-stdlib:armhf.
Preparing to unpack .../6-libpython3.11-stdlib_3.11.9-1_armhf.deb ...
Unpacking libpython3.11-stdlib:armhf (3.11.9-1) ...
Selecting previously unselected package python3.11.
Preparing to unpack .../7-python3.11_3.11.9-1_armhf.deb ...
Unpacking python3.11 (3.11.9-1) ...
Selecting previously unselected package libpython3-stdlib:armhf.
Preparing to unpack .../8-libpython3-stdlib_3.11.8-1_armhf.deb ...
Unpacking libpython3-stdlib:armhf (3.11.8-1) ...
Setting up python3-minimal (3.11.8-1) ...
Selecting previously unselected package python3.
(Reading database ... 
(Reading database ... 5%
(Reading database ... 10%
(Reading database ... 15%
(Reading database ... 20%
(Reading database ... 25%
(Reading database ... 30%
(Reading database ... 35%
(Reading database ... 40%
(Reading database ... 45%
(Reading database ... 50%
(Reading database ... 55%
(Reading database ... 60%
(Reading database ... 65%
(Reading database ... 70%
(Reading database ... 75%
(Reading database ... 80%
(Reading database ... 85%
(Reading database ... 90%
(Reading database ... 95%
(Reading database ... 100%
(Reading database ... 20795 files and directories currently installed.)
Preparing to unpack .../000-python3_3.11.8-1_armhf.deb ...
Unpacking python3 (3.11.8-1) ...
Selecting previously unselected package sensible-utils.
Preparing to unpack .../001-sensible-utils_0.0.22_all.deb ...
Unpacking sensible-utils (0.0.22) ...
Selecting previously unselected package openssl.
Preparing to unpack .../002-openssl_3.2.1-3_armhf.deb ...
Unpacking openssl (3.2.1-3) ...
Selecting previously unselected package ca-certificates.
Preparing to unpack .../003-ca-certificates_20240203_all.deb ...
Unpacking ca-certificates (20240203) ...
Selecting previously unselected package libmagic-mgc.
Preparing to unpack .../004-libmagic-mgc_1%3a5.45-3_armhf.deb ...
Unpacking libmagic-mgc (1:5.45-3) ...
Selecting previously unselected package libmagic1t64:armhf.
Preparing to unpack .../005-libmagic1t64_1%3a5.45-3_armhf.deb ...
Unpacking libmagic1t64:armhf (1:5.45-3) ...
Selecting previously unselected package file.
Preparing to unpack .../006-file_1%3a5.45-3_armhf.deb ...
Unpacking file (1:5.45-3) ...
Selecting previously unselected package gettext-base.
Preparing to unpack .../007-gettext-base_0.21-14+b1_armhf.deb ...
Unpacking gettext-base (0.21-14+b1) ...
Selecting previously unselected package libuchardet0:armhf.
Preparing to unpack .../008-libuchardet0_0.0.8-1+b1_armhf.deb ...
Unpacking libuchardet0:armhf (0.0.8-1+b1) ...
Selecting previously unselected package groff-base.
Preparing to unpack .../009-groff-base_1.23.0-4_armhf.deb ...
Unpacking groff-base (1.23.0-4) ...
Selecting previously unselected package bsdextrautils.
Preparing to unpack .../010-bsdextrautils_2.40.1-1_armhf.deb ...
Unpacking bsdextrautils (2.40.1-1) ...
Selecting previously unselected package man-db.
Preparing to unpack .../011-man-db_2.12.1-1_armhf.deb ...
Unpacking man-db (2.12.1-1) ...
Selecting previously unselected package libgdk-pixbuf2.0-common.
Preparing to unpack .../012-libgdk-pixbuf2.0-common_2.42.12+dfsg-1_all.deb ...
Unpacking libgdk-pixbuf2.0-common (2.42.12+dfsg-1) ...
Selecting previously unselected package libglib2.0-0t64:armhf.
Preparing to unpack .../013-libglib2.0-0t64_2.80.2-1_armhf.deb ...
Unpacking libglib2.0-0t64:armhf (2.80.2-1) ...
Selecting previously unselected package libicu72:armhf.
Preparing to unpack .../014-libicu72_72.1-4+b1_armhf.deb ...
Unpacking libicu72:armhf (72.1-4+b1) ...
Selecting previously unselected package libxml2:armhf.
Preparing to unpack .../015-libxml2_2.9.14+dfsg-1.3+b3_armhf.deb ...
Unpacking libxml2:armhf (2.9.14+dfsg-1.3+b3) ...
Selecting previously unselected package shared-mime-info.
Preparing to unpack .../016-shared-mime-info_2.4-4_armhf.deb ...
Unpacking shared-mime-info (2.4-4) ...
Selecting previously unselected package libjpeg62-turbo:armhf.
Preparing to unpack .../017-libjpeg62-turbo_1%3a2.1.5-3_armhf.deb ...
Unpacking libjpeg62-turbo:armhf (1:2.1.5-3) ...
Selecting previously unselected package libpng16-16t64:armhf.
Preparing to unpack .../018-libpng16-16t64_1.6.43-5_armhf.deb ...
Unpacking libpng16-16t64:armhf (1.6.43-5) ...
Selecting previously unselected package libdeflate0:armhf.
Preparing to unpack .../019-libdeflate0_1.20-1_armhf.deb ...
Unpacking libdeflate0:armhf (1.20-1) ...
Selecting previously unselected package libjbig0:armhf.
Preparing to unpack .../020-libjbig0_2.1-6.1+b1_armhf.deb ...
Unpacking libjbig0:armhf (2.1-6.1+b1) ...
Selecting previously unselected package liblerc4:armhf.
Preparing to unpack .../021-liblerc4_4.0.0+ds-4+b1_armhf.deb ...
Unpacking liblerc4:armhf (4.0.0+ds-4+b1) ...
Selecting previously unselected package libsharpyuv0:armhf.
Preparing to unpack .../022-libsharpyuv0_1.4.0-0.1_armhf.deb ...
Unpacking libsharpyuv0:armhf (1.4.0-0.1) ...
Selecting previously unselected package libwebp7:armhf.
Preparing to unpack .../023-libwebp7_1.4.0-0.1_armhf.deb ...
Unpacking libwebp7:armhf (1.4.0-0.1) ...
Selecting previously unselected package libtiff6:armhf.
Preparing to unpack .../024-libtiff6_4.5.1+git230720-4_armhf.deb ...
Unpacking libtiff6:armhf (4.5.1+git230720-4) ...
Selecting previously unselected package libgdk-pixbuf-2.0-0:armhf.
Preparing to unpack .../025-libgdk-pixbuf-2.0-0_2.42.12+dfsg-1_armhf.deb ...
Unpacking libgdk-pixbuf-2.0-0:armhf (2.42.12+dfsg-1) ...
Selecting previously unselected package gtk-update-icon-cache.
Preparing to unpack .../026-gtk-update-icon-cache_3.24.41-4_armhf.deb ...
Unpacking gtk-update-icon-cache (3.24.41-4) ...
Selecting previously unselected package hicolor-icon-theme.
Preparing to unpack .../027-hicolor-icon-theme_0.17-2_all.deb ...
Unpacking hicolor-icon-theme (0.17-2) ...
Selecting previously unselected package adwaita-icon-theme.
Preparing to unpack .../028-adwaita-icon-theme_46.0-1_all.deb ...
Unpacking adwaita-icon-theme (46.0-1) ...
Selecting previously unselected package ca-certificates-java.
Preparing to unpack .../029-ca-certificates-java_20240118_all.deb ...
Unpacking ca-certificates-java (20240118) ...
Selecting previously unselected package java-common.
Preparing to unpack .../030-java-common_0.75_all.deb ...
Unpacking java-common (0.75) ...
Selecting previously unselected package liblcms2-2:armhf.
Preparing to unpack .../031-liblcms2-2_2.14-2+b1_armhf.deb ...
Unpacking liblcms2-2:armhf (2.14-2+b1) ...
Selecting previously unselected package libnspr4:armhf.
Preparing to unpack .../032-libnspr4_2%3a4.35-1.1+b1_armhf.deb ...
Unpacking libnspr4:armhf (2:4.35-1.1+b1) ...
Selecting previously unselected package libnss3:armhf.
Preparing to unpack .../033-libnss3_2%3a3.100-1_armhf.deb ...
Unpacking libnss3:armhf (2:3.100-1) ...
Selecting previously unselected package libpcsclite1:armhf.
Preparing to unpack .../034-libpcsclite1_2.2.1-1_armhf.deb ...
Unpacking libpcsclite1:armhf (2.2.1-1) ...
Selecting previously unselected package openjdk-17-jre-headless:armhf.
Preparing to unpack .../035-openjdk-17-jre-headless_17.0.11+9-1_armhf.deb ...
Unpacking openjdk-17-jre-headless:armhf (17.0.11+9-1) ...
Selecting previously unselected package default-jre-headless.
Preparing to unpack .../036-default-jre-headless_2%3a1.17-75_armhf.deb ...
Unpacking default-jre-headless (2:1.17-75) ...
Selecting previously unselected package ant.
Preparing to unpack .../037-ant_1.10.14-1_all.deb ...
Unpacking ant (1.10.14-1) ...
Selecting previously unselected package ant-optional.
Preparing to unpack .../038-ant-optional_1.10.14-1_all.deb ...
Unpacking ant-optional (1.10.14-1) ...
Selecting previously unselected package libantlr-java.
Preparing to unpack .../039-libantlr-java_2.7.7+dfsg-13_all.deb ...
Unpacking libantlr-java (2.7.7+dfsg-13) ...
Selecting previously unselected package antlr.
Preparing to unpack .../040-antlr_2.7.7+dfsg-13_all.deb ...
Unpacking antlr (2.7.7+dfsg-13) ...
Selecting previously unselected package at-spi2-common.
Preparing to unpack .../041-at-spi2-common_2.52.0-1_all.deb ...
Unpacking at-spi2-common (2.52.0-1) ...
Selecting previously unselected package m4.
Preparing to unpack .../042-m4_1.4.19-4_armhf.deb ...
Unpacking m4 (1.4.19-4) ...
Selecting previously unselected package autoconf.
Preparing to unpack .../043-autoconf_2.71-3_all.deb ...
Unpacking autoconf (2.71-3) ...
Selecting previously unselected package autotools-dev.
Preparing to unpack .../044-autotools-dev_20220109.1_all.deb ...
Unpacking autotools-dev (20220109.1) ...
Selecting previously unselected package automake.
Preparing to unpack .../045-automake_1%3a1.16.5-1.3_all.deb ...
Unpacking automake (1:1.16.5-1.3) ...
Selecting previously unselected package autopoint.
Preparing to unpack .../046-autopoint_0.21-14_all.deb ...
Unpacking autopoint (0.21-14) ...
Selecting previously unselected package unzip.
Preparing to unpack .../047-unzip_6.0-28_armhf.deb ...
Unpacking unzip (6.0-28) ...
Selecting previously unselected package java-wrappers.
Preparing to unpack .../048-java-wrappers_0.4_all.deb ...
Unpacking java-wrappers (0.4) ...
Selecting previously unselected package libhamcrest-java.
Preparing to unpack .../049-libhamcrest-java_2.2-2_all.deb ...
Unpacking libhamcrest-java (2.2-2) ...
Selecting previously unselected package junit4.
Preparing to unpack .../050-junit4_4.13.2-4_all.deb ...
Unpacking junit4 (4.13.2-4) ...
Selecting previously unselected package libfelix-framework-java.
Preparing to unpack .../051-libfelix-framework-java_4.6.1-2.1_all.deb ...
Unpacking libfelix-framework-java (4.6.1-2.1) ...
Selecting previously unselected package libfelix-gogo-runtime-java.
Preparing to unpack .../052-libfelix-gogo-runtime-java_0.16.2-1.1_all.deb ...
Unpacking libfelix-gogo-runtime-java (0.16.2-1.1) ...
Selecting previously unselected package libosgi-annotation-java.
Preparing to unpack .../053-libosgi-annotation-java_8.1.0-1_all.deb ...
Unpacking libosgi-annotation-java (8.1.0-1) ...
Selecting previously unselected package libosgi-core-java.
Preparing to unpack .../054-libosgi-core-java_8.0.0-2_all.deb ...
Unpacking libosgi-core-java (8.0.0-2) ...
Selecting previously unselected package libfelix-resolver-java.
Preparing to unpack .../055-libfelix-resolver-java_1.16.0-1_all.deb ...
Unpacking libfelix-resolver-java (1.16.0-1) ...
Selecting previously unselected package libhawtjni-runtime-java.
Preparing to unpack .../056-libhawtjni-runtime-java_1.18-1_all.deb ...
Unpacking libhawtjni-runtime-java (1.18-1) ...
Selecting previously unselected package libjansi-native-java.
Preparing to unpack .../057-libjansi-native-java_1.8-2_all.deb ...
Unpacking libjansi-native-java (1.8-2) ...
Selecting previously unselected package libjansi1-java.
Preparing to unpack .../058-libjansi1-java_1.18-3_all.deb ...
Unpacking libjansi1-java (1.18-3) ...
Selecting previously unselected package libjline2-java.
Preparing to unpack .../059-libjline2-java_2.14.6-5_all.deb ...
Unpacking libjline2-java (2.14.6-5) ...
Selecting previously unselected package libosgi-compendium-java.
Preparing to unpack .../060-libosgi-compendium-java_7.0.0-1_all.deb ...
Unpacking libosgi-compendium-java (7.0.0-1) ...
Selecting previously unselected package libslf4j-java.
Preparing to unpack .../061-libslf4j-java_1.7.32-1_all.deb ...
Unpacking libslf4j-java (1.7.32-1) ...
Selecting previously unselected package libxz-java.
Preparing to unpack .../062-libxz-java_1.9-1_all.deb ...
Unpacking libxz-java (1.9-1) ...
Selecting previously unselected package libyaml-snake-java.
Preparing to unpack .../063-libyaml-snake-java_1.33-2_all.deb ...
Unpacking libyaml-snake-java (1.33-2) ...
Selecting previously unselected package bnd.
Preparing to unpack .../064-bnd_5.0.1-5_all.deb ...
Unpacking bnd (5.0.1-5) ...
Selecting previously unselected package dctrl-tools.
Preparing to unpack .../065-dctrl-tools_2.24-3_armhf.deb ...
Unpacking dctrl-tools (2.24-3) ...
Selecting previously unselected package libdebhelper-perl.
Preparing to unpack .../066-libdebhelper-perl_13.15.3_all.deb ...
Unpacking libdebhelper-perl (13.15.3) ...
Selecting previously unselected package libtool.
Preparing to unpack .../067-libtool_2.4.7-7_all.deb ...
Unpacking libtool (2.4.7-7) ...
Selecting previously unselected package dh-autoreconf.
Preparing to unpack .../068-dh-autoreconf_20_all.deb ...
Unpacking dh-autoreconf (20) ...
Selecting previously unselected package libarchive-zip-perl.
Preparing to unpack .../069-libarchive-zip-perl_1.68-1_all.deb ...
Unpacking libarchive-zip-perl (1.68-1) ...
Selecting previously unselected package libsub-override-perl.
Preparing to unpack .../070-libsub-override-perl_0.10-1_all.deb ...
Unpacking libsub-override-perl (0.10-1) ...
Selecting previously unselected package libfile-stripnondeterminism-perl.
Preparing to unpack .../071-libfile-stripnondeterminism-perl_1.13.1-1_all.deb ...
Unpacking libfile-stripnondeterminism-perl (1.13.1-1) ...
Selecting previously unselected package dh-strip-nondeterminism.
Preparing to unpack .../072-dh-strip-nondeterminism_1.13.1-1_all.deb ...
Unpacking dh-strip-nondeterminism (1.13.1-1) ...
Selecting previously unselected package libelf1t64:armhf.
Preparing to unpack .../073-libelf1t64_0.191-1+b1_armhf.deb ...
Unpacking libelf1t64:armhf (0.191-1+b1) ...
Selecting previously unselected package dwz.
Preparing to unpack .../074-dwz_0.15-1+b2_armhf.deb ...
Unpacking dwz (0.15-1+b2) ...
Selecting previously unselected package gettext.
Preparing to unpack .../075-gettext_0.21-14+b1_armhf.deb ...
Unpacking gettext (0.21-14+b1) ...
Selecting previously unselected package intltool-debian.
Preparing to unpack .../076-intltool-debian_0.35.0+20060710.6_all.deb ...
Unpacking intltool-debian (0.35.0+20060710.6) ...
Selecting previously unselected package po-debconf.
Preparing to unpack .../077-po-debconf_1.0.21+nmu1_all.deb ...
Unpacking po-debconf (1.0.21+nmu1) ...
Selecting previously unselected package debhelper.
Preparing to unpack .../078-debhelper_13.15.3_all.deb ...
Unpacking debhelper (13.15.3) ...
Selecting previously unselected package libgtk2.0-common.
Preparing to unpack .../079-libgtk2.0-common_2.24.33-4_all.deb ...
Unpacking libgtk2.0-common (2.24.33-4) ...
Selecting previously unselected package libatk1.0-0t64:armhf.
Preparing to unpack .../080-libatk1.0-0t64_2.52.0-1_armhf.deb ...
Unpacking libatk1.0-0t64:armhf (2.52.0-1) ...
Selecting previously unselected package libbrotli1:armhf.
Preparing to unpack .../081-libbrotli1_1.1.0-2+b3_armhf.deb ...
Unpacking libbrotli1:armhf (1.1.0-2+b3) ...
Selecting previously unselected package libfreetype6:armhf.
Preparing to unpack .../082-libfreetype6_2.13.2+dfsg-1+b4_armhf.deb ...
Unpacking libfreetype6:armhf (2.13.2+dfsg-1+b4) ...
Selecting previously unselected package fonts-dejavu-mono.
Preparing to unpack .../083-fonts-dejavu-mono_2.37-8_all.deb ...
Unpacking fonts-dejavu-mono (2.37-8) ...
Selecting previously unselected package fonts-dejavu-core.
Preparing to unpack .../084-fonts-dejavu-core_2.37-8_all.deb ...
Unpacking fonts-dejavu-core (2.37-8) ...
Selecting previously unselected package fontconfig-config.
Preparing to unpack .../085-fontconfig-config_2.15.0-1.1_armhf.deb ...
Unpacking fontconfig-config (2.15.0-1.1) ...
Selecting previously unselected package libfontconfig1:armhf.
Preparing to unpack .../086-libfontconfig1_2.15.0-1.1_armhf.deb ...
Unpacking libfontconfig1:armhf (2.15.0-1.1) ...
Selecting previously unselected package libpixman-1-0:armhf.
Preparing to unpack .../087-libpixman-1-0_0.42.2-1+b1_armhf.deb ...
Unpacking libpixman-1-0:armhf (0.42.2-1+b1) ...
Selecting previously unselected package libxau6:armhf.
Preparing to unpack .../088-libxau6_1%3a1.0.9-1+b1_armhf.deb ...
Unpacking libxau6:armhf (1:1.0.9-1+b1) ...
Selecting previously unselected package libbsd0:armhf.
Preparing to unpack .../089-libbsd0_0.12.2-1_armhf.deb ...
Unpacking libbsd0:armhf (0.12.2-1) ...
Selecting previously unselected package libxdmcp6:armhf.
Preparing to unpack .../090-libxdmcp6_1%3a1.1.2-3+b1_armhf.deb ...
Unpacking libxdmcp6:armhf (1:1.1.2-3+b1) ...
Selecting previously unselected package libxcb1:armhf.
Preparing to unpack .../091-libxcb1_1.17.0-1_armhf.deb ...
Unpacking libxcb1:armhf (1.17.0-1) ...
Selecting previously unselected package libx11-data.
Preparing to unpack .../092-libx11-data_2%3a1.8.7-1_all.deb ...
Unpacking libx11-data (2:1.8.7-1) ...
Selecting previously unselected package libx11-6:armhf.
Preparing to unpack .../093-libx11-6_2%3a1.8.7-1+b1_armhf.deb ...
Unpacking libx11-6:armhf (2:1.8.7-1+b1) ...
Selecting previously unselected package libxcb-render0:armhf.
Preparing to unpack .../094-libxcb-render0_1.17.0-1_armhf.deb ...
Unpacking libxcb-render0:armhf (1.17.0-1) ...
Selecting previously unselected package libxcb-shm0:armhf.
Preparing to unpack .../095-libxcb-shm0_1.17.0-1_armhf.deb ...
Unpacking libxcb-shm0:armhf (1.17.0-1) ...
Selecting previously unselected package libxext6:armhf.
Preparing to unpack .../096-libxext6_2%3a1.3.4-1+b1_armhf.deb ...
Unpacking libxext6:armhf (2:1.3.4-1+b1) ...
Selecting previously unselected package libxrender1:armhf.
Preparing to unpack .../097-libxrender1_1%3a0.9.10-1.1+b1_armhf.deb ...
Unpacking libxrender1:armhf (1:0.9.10-1.1+b1) ...
Selecting previously unselected package libcairo2:armhf.
Preparing to unpack .../098-libcairo2_1.18.0-3+b1_armhf.deb ...
Unpacking libcairo2:armhf (1.18.0-3+b1) ...
Selecting previously unselected package libavahi-common-data:armhf.
Preparing to unpack .../099-libavahi-common-data_0.8-13+b2_armhf.deb ...
Unpacking libavahi-common-data:armhf (0.8-13+b2) ...
Selecting previously unselected package libavahi-common3:armhf.
Preparing to unpack .../100-libavahi-common3_0.8-13+b2_armhf.deb ...
Unpacking libavahi-common3:armhf (0.8-13+b2) ...
Selecting previously unselected package libdbus-1-3:armhf.
Preparing to unpack .../101-libdbus-1-3_1.14.10-4+b1_armhf.deb ...
Unpacking libdbus-1-3:armhf (1.14.10-4+b1) ...
Selecting previously unselected package libavahi-client3:armhf.
Preparing to unpack .../102-libavahi-client3_0.8-13+b2_armhf.deb ...
Unpacking libavahi-client3:armhf (0.8-13+b2) ...
Selecting previously unselected package libkrb5support0:armhf.
Preparing to unpack .../103-libkrb5support0_1.20.1-6+b1_armhf.deb ...
Unpacking libkrb5support0:armhf (1.20.1-6+b1) ...
Selecting previously unselected package libcom-err2:armhf.
Preparing to unpack .../104-libcom-err2_1.47.1~rc2-1_armhf.deb ...
Unpacking libcom-err2:armhf (1.47.1~rc2-1) ...
Selecting previously unselected package libk5crypto3:armhf.
Preparing to unpack .../105-libk5crypto3_1.20.1-6+b1_armhf.deb ...
Unpacking libk5crypto3:armhf (1.20.1-6+b1) ...
Selecting previously unselected package libkeyutils1:armhf.
Preparing to unpack .../106-libkeyutils1_1.6.3-3_armhf.deb ...
Unpacking libkeyutils1:armhf (1.6.3-3) ...
Selecting previously unselected package libkrb5-3:armhf.
Preparing to unpack .../107-libkrb5-3_1.20.1-6+b1_armhf.deb ...
Unpacking libkrb5-3:armhf (1.20.1-6+b1) ...
Selecting previously unselected package libgssapi-krb5-2:armhf.
Preparing to unpack .../108-libgssapi-krb5-2_1.20.1-6+b1_armhf.deb ...
Unpacking libgssapi-krb5-2:armhf (1.20.1-6+b1) ...
Selecting previously unselected package libcups2t64:armhf.
Preparing to unpack .../109-libcups2t64_2.4.7-1.2+b1_armhf.deb ...
Unpacking libcups2t64:armhf (2.4.7-1.2+b1) ...
Selecting previously unselected package fontconfig.
Preparing to unpack .../110-fontconfig_2.15.0-1.1_armhf.deb ...
Unpacking fontconfig (2.15.0-1.1) ...
Selecting previously unselected package libfribidi0:armhf.
Preparing to unpack .../111-libfribidi0_1.0.13-3+b1_armhf.deb ...
Unpacking libfribidi0:armhf (1.0.13-3+b1) ...
Selecting previously unselected package libgraphite2-3:armhf.
Preparing to unpack .../112-libgraphite2-3_1.3.14-2_armhf.deb ...
Unpacking libgraphite2-3:armhf (1.3.14-2) ...
Selecting previously unselected package libharfbuzz0b:armhf.
Preparing to unpack .../113-libharfbuzz0b_8.3.0-2+b1_armhf.deb ...
Unpacking libharfbuzz0b:armhf (8.3.0-2+b1) ...
Selecting previously unselected package libthai-data.
Preparing to unpack .../114-libthai-data_0.1.29-2_all.deb ...
Unpacking libthai-data (0.1.29-2) ...
Selecting previously unselected package libdatrie1:armhf.
Preparing to unpack .../115-libdatrie1_0.2.13-3_armhf.deb ...
Unpacking libdatrie1:armhf (0.2.13-3) ...
Selecting previously unselected package libthai0:armhf.
Preparing to unpack .../116-libthai0_0.1.29-2_armhf.deb ...
Unpacking libthai0:armhf (0.1.29-2) ...
Selecting previously unselected package libpango-1.0-0:armhf.
Preparing to unpack .../117-libpango-1.0-0_1.52.2+ds-1_armhf.deb ...
Unpacking libpango-1.0-0:armhf (1.52.2+ds-1) ...
Selecting previously unselected package libpangoft2-1.0-0:armhf.
Preparing to unpack .../118-libpangoft2-1.0-0_1.52.2+ds-1_armhf.deb ...
Unpacking libpangoft2-1.0-0:armhf (1.52.2+ds-1) ...
Selecting previously unselected package libpangocairo-1.0-0:armhf.
Preparing to unpack .../119-libpangocairo-1.0-0_1.52.2+ds-1_armhf.deb ...
Unpacking libpangocairo-1.0-0:armhf (1.52.2+ds-1) ...
Selecting previously unselected package libxcomposite1:armhf.
Preparing to unpack .../120-libxcomposite1_1%3a0.4.5-1+b1_armhf.deb ...
Unpacking libxcomposite1:armhf (1:0.4.5-1+b1) ...
Selecting previously unselected package libxfixes3:armhf.
Preparing to unpack .../121-libxfixes3_1%3a6.0.0-2+b1_armhf.deb ...
Unpacking libxfixes3:armhf (1:6.0.0-2+b1) ...
Selecting previously unselected package libxcursor1:armhf.
Preparing to unpack .../122-libxcursor1_1%3a1.2.1-1+b1_armhf.deb ...
Unpacking libxcursor1:armhf (1:1.2.1-1+b1) ...
Selecting previously unselected package libxdamage1:armhf.
Preparing to unpack .../123-libxdamage1_1%3a1.1.6-1+b1_armhf.deb ...
Unpacking libxdamage1:armhf (1:1.1.6-1+b1) ...
Selecting previously unselected package libxi6:armhf.
Preparing to unpack .../124-libxi6_2%3a1.8.1-1_armhf.deb ...
Unpacking libxi6:armhf (2:1.8.1-1) ...
Selecting previously unselected package libxinerama1:armhf.
Preparing to unpack .../125-libxinerama1_2%3a1.1.4-3+b1_armhf.deb ...
Unpacking libxinerama1:armhf (2:1.1.4-3+b1) ...
Selecting previously unselected package libxrandr2:armhf.
Preparing to unpack .../126-libxrandr2_2%3a1.5.4-1_armhf.deb ...
Unpacking libxrandr2:armhf (2:1.5.4-1) ...
Selecting previously unselected package libgtk2.0-0t64:armhf.
Preparing to unpack .../127-libgtk2.0-0t64_2.24.33-4_armhf.deb ...
Unpacking libgtk2.0-0t64:armhf (2.24.33-4) ...
Selecting previously unselected package libglvnd0:armhf.
Preparing to unpack .../128-libglvnd0_1.7.0-1+b1_armhf.deb ...
Unpacking libglvnd0:armhf (1.7.0-1+b1) ...
Selecting previously unselected package libdrm-common.
Preparing to unpack .../129-libdrm-common_2.4.120-2_all.deb ...
Unpacking libdrm-common (2.4.120-2) ...
Selecting previously unselected package libdrm2:armhf.
Preparing to unpack .../130-libdrm2_2.4.120-2_armhf.deb ...
Unpacking libdrm2:armhf (2.4.120-2) ...
Selecting previously unselected package libglapi-mesa:armhf.
Preparing to unpack .../131-libglapi-mesa_24.0.7-1_armhf.deb ...
Unpacking libglapi-mesa:armhf (24.0.7-1) ...
Selecting previously unselected package libx11-xcb1:armhf.
Preparing to unpack .../132-libx11-xcb1_2%3a1.8.7-1+b1_armhf.deb ...
Unpacking libx11-xcb1:armhf (2:1.8.7-1+b1) ...
Selecting previously unselected package libxcb-dri2-0:armhf.
Preparing to unpack .../133-libxcb-dri2-0_1.17.0-1_armhf.deb ...
Unpacking libxcb-dri2-0:armhf (1.17.0-1) ...
Selecting previously unselected package libxcb-dri3-0:armhf.
Preparing to unpack .../134-libxcb-dri3-0_1.17.0-1_armhf.deb ...
Unpacking libxcb-dri3-0:armhf (1.17.0-1) ...
Selecting previously unselected package libxcb-glx0:armhf.
Preparing to unpack .../135-libxcb-glx0_1.17.0-1_armhf.deb ...
Unpacking libxcb-glx0:armhf (1.17.0-1) ...
Selecting previously unselected package libxcb-present0:armhf.
Preparing to unpack .../136-libxcb-present0_1.17.0-1_armhf.deb ...
Unpacking libxcb-present0:armhf (1.17.0-1) ...
Selecting previously unselected package libxcb-randr0:armhf.
Preparing to unpack .../137-libxcb-randr0_1.17.0-1_armhf.deb ...
Unpacking libxcb-randr0:armhf (1.17.0-1) ...
Selecting previously unselected package libxcb-sync1:armhf.
Preparing to unpack .../138-libxcb-sync1_1.17.0-1_armhf.deb ...
Unpacking libxcb-sync1:armhf (1.17.0-1) ...
Selecting previously unselected package libxcb-xfixes0:armhf.
Preparing to unpack .../139-libxcb-xfixes0_1.17.0-1_armhf.deb ...
Unpacking libxcb-xfixes0:armhf (1.17.0-1) ...
Selecting previously unselected package libxshmfence1:armhf.
Preparing to unpack .../140-libxshmfence1_1.3-1+b1_armhf.deb ...
Unpacking libxshmfence1:armhf (1.3-1+b1) ...
Selecting previously unselected package libxxf86vm1:armhf.
Preparing to unpack .../141-libxxf86vm1_1%3a1.1.4-1+b2_armhf.deb ...
Unpacking libxxf86vm1:armhf (1:1.1.4-1+b2) ...
Selecting previously unselected package libvulkan1:armhf.
Preparing to unpack .../142-libvulkan1_1.3.280.0-1_armhf.deb ...
Unpacking libvulkan1:armhf (1.3.280.0-1) ...
Selecting previously unselected package libdrm-amdgpu1:armhf.
Preparing to unpack .../143-libdrm-amdgpu1_2.4.120-2_armhf.deb ...
Unpacking libdrm-amdgpu1:armhf (2.4.120-2) ...
Selecting previously unselected package libdrm-nouveau2:armhf.
Preparing to unpack .../144-libdrm-nouveau2_2.4.120-2_armhf.deb ...
Unpacking libdrm-nouveau2:armhf (2.4.120-2) ...
Selecting previously unselected package libdrm-radeon1:armhf.
Preparing to unpack .../145-libdrm-radeon1_2.4.120-2_armhf.deb ...
Unpacking libdrm-radeon1:armhf (2.4.120-2) ...
Selecting previously unselected package libedit2:armhf.
Preparing to unpack .../146-libedit2_3.1-20230828-1+b1_armhf.deb ...
Unpacking libedit2:armhf (3.1-20230828-1+b1) ...
Selecting previously unselected package libz3-4:armhf.
Preparing to unpack .../147-libz3-4_4.8.12-3.1+b2_armhf.deb ...
Unpacking libz3-4:armhf (4.8.12-3.1+b2) ...
Selecting previously unselected package libllvm17t64:armhf.
Preparing to unpack .../148-libllvm17t64_1%3a17.0.6-12_armhf.deb ...
Unpacking libllvm17t64:armhf (1:17.0.6-12) ...
Selecting previously unselected package libsensors-config.
Preparing to unpack .../149-libsensors-config_1%3a3.6.0-9_all.deb ...
Unpacking libsensors-config (1:3.6.0-9) ...
Selecting previously unselected package libsensors5:armhf.
Preparing to unpack .../150-libsensors5_1%3a3.6.0-9_armhf.deb ...
Unpacking libsensors5:armhf (1:3.6.0-9) ...
Selecting previously unselected package libgl1-mesa-dri:armhf.
Preparing to unpack .../151-libgl1-mesa-dri_24.0.7-1_armhf.deb ...
Unpacking libgl1-mesa-dri:armhf (24.0.7-1) ...
Selecting previously unselected package libglx-mesa0:armhf.
Preparing to unpack .../152-libglx-mesa0_24.0.7-1_armhf.deb ...
Unpacking libglx-mesa0:armhf (24.0.7-1) ...
Selecting previously unselected package libglx0:armhf.
Preparing to unpack .../153-libglx0_1.7.0-1+b1_armhf.deb ...
Unpacking libglx0:armhf (1.7.0-1+b1) ...
Selecting previously unselected package libgl1:armhf.
Preparing to unpack .../154-libgl1_1.7.0-1+b1_armhf.deb ...
Unpacking libgl1:armhf (1.7.0-1+b1) ...
Selecting previously unselected package libasound2-data.
Preparing to unpack .../155-libasound2-data_1.2.11-1_all.deb ...
Unpacking libasound2-data (1.2.11-1) ...
Selecting previously unselected package libasound2t64:armhf.
Preparing to unpack .../156-libasound2t64_1.2.11-1+b1_armhf.deb ...
Unpacking libasound2t64:armhf (1.2.11-1+b1) ...
Selecting previously unselected package libgif7:armhf.
Preparing to unpack .../157-libgif7_5.2.2-1_armhf.deb ...
Unpacking libgif7:armhf (5.2.2-1) ...
Selecting previously unselected package x11-common.
Preparing to unpack .../158-x11-common_1%3a7.7+23_all.deb ...
Unpacking x11-common (1:7.7+23) ...
Selecting previously unselected package libxtst6:armhf.
Preparing to unpack .../159-libxtst6_2%3a1.2.3-1.1+b1_armhf.deb ...
Unpacking libxtst6:armhf (2:1.2.3-1.1+b1) ...
Selecting previously unselected package openjdk-17-jre:armhf.
Preparing to unpack .../160-openjdk-17-jre_17.0.11+9-1_armhf.deb ...
Unpacking openjdk-17-jre:armhf (17.0.11+9-1) ...
Selecting previously unselected package default-jre.
Preparing to unpack .../161-default-jre_2%3a1.17-75_armhf.deb ...
Unpacking default-jre (2:1.17-75) ...
Selecting previously unselected package openjdk-17-jdk-headless:armhf.
Preparing to unpack .../162-openjdk-17-jdk-headless_17.0.11+9-1_armhf.deb ...
Unpacking openjdk-17-jdk-headless:armhf (17.0.11+9-1) ...
Selecting previously unselected package default-jdk-headless.
Preparing to unpack .../163-default-jdk-headless_2%3a1.17-75_armhf.deb ...
Unpacking default-jdk-headless (2:1.17-75) ...
Selecting previously unselected package openjdk-17-jdk:armhf.
Preparing to unpack .../164-openjdk-17-jdk_17.0.11+9-1_armhf.deb ...
Unpacking openjdk-17-jdk:armhf (17.0.11+9-1) ...
Selecting previously unselected package default-jdk.
Preparing to unpack .../165-default-jdk_2%3a1.17-75_armhf.deb ...
Unpacking default-jdk (2:1.17-75) ...
Selecting previously unselected package libassuan0:armhf.
Preparing to unpack .../166-libassuan0_2.5.6-1+b1_armhf.deb ...
Unpacking libassuan0:armhf (2.5.6-1+b1) ...
Selecting previously unselected package gpgconf.
Preparing to unpack .../167-gpgconf_2.2.43-6_armhf.deb ...
Unpacking gpgconf (2.2.43-6) ...
Selecting previously unselected package libksba8:armhf.
Preparing to unpack .../168-libksba8_1.6.6-1_armhf.deb ...
Unpacking libksba8:armhf (1.6.6-1) ...
Selecting previously unselected package libsasl2-modules-db:armhf.
Preparing to unpack .../169-libsasl2-modules-db_2.1.28+dfsg1-6_armhf.deb ...
Unpacking libsasl2-modules-db:armhf (2.1.28+dfsg1-6) ...
Selecting previously unselected package libsasl2-2:armhf.
Preparing to unpack .../170-libsasl2-2_2.1.28+dfsg1-6_armhf.deb ...
Unpacking libsasl2-2:armhf (2.1.28+dfsg1-6) ...
Selecting previously unselected package libldap-2.5-0:armhf.
Preparing to unpack .../171-libldap-2.5-0_2.5.17+dfsg-1_armhf.deb ...
Unpacking libldap-2.5-0:armhf (2.5.17+dfsg-1) ...
Selecting previously unselected package libnpth0t64:armhf.
Preparing to unpack .../172-libnpth0t64_1.6-3.1_armhf.deb ...
Unpacking libnpth0t64:armhf (1.6-3.1) ...
Selecting previously unselected package dirmngr.
Preparing to unpack .../173-dirmngr_2.2.43-6_armhf.deb ...
Unpacking dirmngr (2.2.43-6) ...
Selecting previously unselected package gnupg-l10n.
Preparing to unpack .../174-gnupg-l10n_2.2.43-6_all.deb ...
Unpacking gnupg-l10n (2.2.43-6) ...
Selecting previously unselected package gnupg-utils.
Preparing to unpack .../175-gnupg-utils_2.2.43-6_armhf.deb ...
Unpacking gnupg-utils (2.2.43-6) ...
Selecting previously unselected package gpg.
Preparing to unpack .../176-gpg_2.2.43-6_armhf.deb ...
Unpacking gpg (2.2.43-6) ...
Selecting previously unselected package pinentry-curses.
Preparing to unpack .../177-pinentry-curses_1.2.1-3+b2_armhf.deb ...
Unpacking pinentry-curses (1.2.1-3+b2) ...
Selecting previously unselected package gpg-agent.
Preparing to unpack .../178-gpg-agent_2.2.43-6_armhf.deb ...
Unpacking gpg-agent (2.2.43-6) ...
Selecting previously unselected package gpg-wks-client.
Preparing to unpack .../179-gpg-wks-client_2.2.43-6_armhf.deb ...
Unpacking gpg-wks-client (2.2.43-6) ...
Selecting previously unselected package gpgsm.
Preparing to unpack .../180-gpgsm_2.2.43-6_armhf.deb ...
Unpacking gpgsm (2.2.43-6) ...
Selecting previously unselected package gnupg.
Preparing to unpack .../181-gnupg_2.2.43-6_all.deb ...
Unpacking gnupg (2.2.43-6) ...
Selecting previously unselected package libfile-dirlist-perl.
Preparing to unpack .../182-libfile-dirlist-perl_0.05-3_all.deb ...
Unpacking libfile-dirlist-perl (0.05-3) ...
Selecting previously unselected package libfile-which-perl.
Preparing to unpack .../183-libfile-which-perl_1.27-2_all.deb ...
Unpacking libfile-which-perl (1.27-2) ...
Selecting previously unselected package libfile-homedir-perl.
Preparing to unpack .../184-libfile-homedir-perl_1.006-2_all.deb ...
Unpacking libfile-homedir-perl (1.006-2) ...
Selecting previously unselected package libfile-touch-perl.
Preparing to unpack .../185-libfile-touch-perl_0.12-2_all.deb ...
Unpacking libfile-touch-perl (0.12-2) ...
Selecting previously unselected package libio-pty-perl.
Preparing to unpack .../186-libio-pty-perl_1%3a1.20-1+b1_armhf.deb ...
Unpacking libio-pty-perl (1:1.20-1+b1) ...
Selecting previously unselected package libipc-run-perl.
Preparing to unpack .../187-libipc-run-perl_20231003.0-2_all.deb ...
Unpacking libipc-run-perl (20231003.0-2) ...
Selecting previously unselected package libclass-method-modifiers-perl.
Preparing to unpack .../188-libclass-method-modifiers-perl_2.15-1_all.deb ...
Unpacking libclass-method-modifiers-perl (2.15-1) ...
Selecting previously unselected package libclass-xsaccessor-perl.
Preparing to unpack .../189-libclass-xsaccessor-perl_1.19-4+b3_armhf.deb ...
Unpacking libclass-xsaccessor-perl (1.19-4+b3) ...
Selecting previously unselected package libb-hooks-op-check-perl:armhf.
Preparing to unpack .../190-libb-hooks-op-check-perl_0.22-3+b1_armhf.deb ...
Unpacking libb-hooks-op-check-perl:armhf (0.22-3+b1) ...
Selecting previously unselected package libdynaloader-functions-perl.
Preparing to unpack .../191-libdynaloader-functions-perl_0.003-3_all.deb ...
Unpacking libdynaloader-functions-perl (0.003-3) ...
Selecting previously unselected package libdevel-callchecker-perl:armhf.
Preparing to unpack .../192-libdevel-callchecker-perl_0.009-1_armhf.deb ...
Unpacking libdevel-callchecker-perl:armhf (0.009-1) ...
Selecting previously unselected package libparams-classify-perl:armhf.
Preparing to unpack .../193-libparams-classify-perl_0.015-2+b3_armhf.deb ...
Unpacking libparams-classify-perl:armhf (0.015-2+b3) ...
Selecting previously unselected package libmodule-runtime-perl.
Preparing to unpack .../194-libmodule-runtime-perl_0.016-2_all.deb ...
Unpacking libmodule-runtime-perl (0.016-2) ...
Selecting previously unselected package libimport-into-perl.
Preparing to unpack .../195-libimport-into-perl_1.002005-2_all.deb ...
Unpacking libimport-into-perl (1.002005-2) ...
Selecting previously unselected package librole-tiny-perl.
Preparing to unpack .../196-librole-tiny-perl_2.002004-1_all.deb ...
Unpacking librole-tiny-perl (2.002004-1) ...
Selecting previously unselected package libsub-quote-perl.
Preparing to unpack .../197-libsub-quote-perl_2.006008-1_all.deb ...
Unpacking libsub-quote-perl (2.006008-1) ...
Selecting previously unselected package libmoo-perl.
Preparing to unpack .../198-libmoo-perl_2.005005-1_all.deb ...
Unpacking libmoo-perl (2.005005-1) ...
Selecting previously unselected package libencode-locale-perl.
Preparing to unpack .../199-libencode-locale-perl_1.05-3_all.deb ...
Unpacking libencode-locale-perl (1.05-3) ...
Selecting previously unselected package libtimedate-perl.
Preparing to unpack .../200-libtimedate-perl_2.3300-2_all.deb ...
Unpacking libtimedate-perl (2.3300-2) ...
Selecting previously unselected package libhttp-date-perl.
Preparing to unpack .../201-libhttp-date-perl_6.06-1_all.deb ...
Unpacking libhttp-date-perl (6.06-1) ...
Selecting previously unselected package libfile-listing-perl.
Preparing to unpack .../202-libfile-listing-perl_6.16-1_all.deb ...
Unpacking libfile-listing-perl (6.16-1) ...
Selecting previously unselected package libhtml-tagset-perl.
Preparing to unpack .../203-libhtml-tagset-perl_3.24-1_all.deb ...
Unpacking libhtml-tagset-perl (3.24-1) ...
Selecting previously unselected package liburi-perl.
Preparing to unpack .../204-liburi-perl_5.28-1_all.deb ...
Unpacking liburi-perl (5.28-1) ...
Selecting previously unselected package libhtml-parser-perl:armhf.
Preparing to unpack .../205-libhtml-parser-perl_3.82-1_armhf.deb ...
Unpacking libhtml-parser-perl:armhf (3.82-1) ...
Selecting previously unselected package libhtml-tree-perl.
Preparing to unpack .../206-libhtml-tree-perl_5.07-3_all.deb ...
Unpacking libhtml-tree-perl (5.07-3) ...
Selecting previously unselected package libclone-perl:armhf.
Preparing to unpack .../207-libclone-perl_0.46-1+b2_armhf.deb ...
Unpacking libclone-perl:armhf (0.46-1+b2) ...
Selecting previously unselected package libio-html-perl.
Preparing to unpack .../208-libio-html-perl_1.004-3_all.deb ...
Unpacking libio-html-perl (1.004-3) ...
Selecting previously unselected package liblwp-mediatypes-perl.
Preparing to unpack .../209-liblwp-mediatypes-perl_6.04-2_all.deb ...
Unpacking liblwp-mediatypes-perl (6.04-2) ...
Selecting previously unselected package libhttp-message-perl.
Preparing to unpack .../210-libhttp-message-perl_6.45-1_all.deb ...
Unpacking libhttp-message-perl (6.45-1) ...
Selecting previously unselected package libhttp-cookies-perl.
Preparing to unpack .../211-libhttp-cookies-perl_6.11-1_all.deb ...
Unpacking libhttp-cookies-perl (6.11-1) ...
Selecting previously unselected package libhttp-negotiate-perl.
Preparing to unpack .../212-libhttp-negotiate-perl_6.01-2_all.deb ...
Unpacking libhttp-negotiate-perl (6.01-2) ...
Selecting previously unselected package perl-openssl-defaults:armhf.
Preparing to unpack .../213-perl-openssl-defaults_7+b2_armhf.deb ...
Unpacking perl-openssl-defaults:armhf (7+b2) ...
Selecting previously unselected package libnet-ssleay-perl:armhf.
Preparing to unpack .../214-libnet-ssleay-perl_1.94-1+b1_armhf.deb ...
Unpacking libnet-ssleay-perl:armhf (1.94-1+b1) ...
Selecting previously unselected package libio-socket-ssl-perl.
Preparing to unpack .../215-libio-socket-ssl-perl_2.085-1_all.deb ...
Unpacking libio-socket-ssl-perl (2.085-1) ...
Selecting previously unselected package libnet-http-perl.
Preparing to unpack .../216-libnet-http-perl_6.23-1_all.deb ...
Unpacking libnet-http-perl (6.23-1) ...
Selecting previously unselected package liblwp-protocol-https-perl.
Preparing to unpack .../217-liblwp-protocol-https-perl_6.14-1_all.deb ...
Unpacking liblwp-protocol-https-perl (6.14-1) ...
Selecting previously unselected package libtry-tiny-perl.
Preparing to unpack .../218-libtry-tiny-perl_0.31-2_all.deb ...
Unpacking libtry-tiny-perl (0.31-2) ...
Selecting previously unselected package libwww-robotrules-perl.
Preparing to unpack .../219-libwww-robotrules-perl_6.02-1_all.deb ...
Unpacking libwww-robotrules-perl (6.02-1) ...
Selecting previously unselected package libwww-perl.
Preparing to unpack .../220-libwww-perl_6.77-1_all.deb ...
Unpacking libwww-perl (6.77-1) ...
Selecting previously unselected package patchutils.
Preparing to unpack .../221-patchutils_0.4.2-1_armhf.deb ...
Unpacking patchutils (0.4.2-1) ...
Selecting previously unselected package wdiff.
Preparing to unpack .../222-wdiff_1.2.2-6_armhf.deb ...
Unpacking wdiff (1.2.2-6) ...
Selecting previously unselected package devscripts.
Preparing to unpack .../223-devscripts_2.23.7_all.deb ...
Unpacking devscripts (2.23.7) ...
Selecting previously unselected package fastjar.
Preparing to unpack .../224-fastjar_2%3a0.98-7_armhf.deb ...
Unpacking fastjar (2:0.98-7) ...
Selecting previously unselected package ivy.
Preparing to unpack .../225-ivy_2.5.2-1_all.deb ...
Unpacking ivy (2.5.2-1) ...
Selecting previously unselected package libasm-java.
Preparing to unpack .../226-libasm-java_9.7-1_all.deb ...
Unpacking libasm-java (9.7-1) ...
Selecting previously unselected package libbsf-java.
Preparing to unpack .../227-libbsf-java_1%3a2.4.0-8_all.deb ...
Unpacking libbsf-java (1:2.4.0-8) ...
Selecting previously unselected package libcommons-cli-java.
Preparing to unpack .../228-libcommons-cli-java_1.6.0-1_all.deb ...
Unpacking libcommons-cli-java (1.6.0-1) ...
Selecting previously unselected package libapache-pom-java.
Preparing to unpack .../229-libapache-pom-java_29-2_all.deb ...
Unpacking libapache-pom-java (29-2) ...
Selecting previously unselected package libcommons-parent-java.
Preparing to unpack .../230-libcommons-parent-java_56-1_all.deb ...
Unpacking libcommons-parent-java (56-1) ...
Selecting previously unselected package libcommons-logging-java.
Preparing to unpack .../231-libcommons-logging-java_1.3.0-1_all.deb ...
Unpacking libcommons-logging-java (1.3.0-1) ...
Selecting previously unselected package libjansi-java.
Preparing to unpack .../232-libjansi-java_2.4.1-2_all.deb ...
Unpacking libjansi-java (2.4.1-2) ...
Selecting previously unselected package libjsp-api-java.
Preparing to unpack .../233-libjsp-api-java_2.3.4-3_all.deb ...
Unpacking libjsp-api-java (2.3.4-3) ...
Selecting previously unselected package libqdox-java.
Preparing to unpack .../234-libqdox-java_1.12.1-3_all.deb ...
Unpacking libqdox-java (1.12.1-3) ...
Selecting previously unselected package libservlet-api-java.
Preparing to unpack .../235-libservlet-api-java_4.0.1-2_all.deb ...
Unpacking libservlet-api-java (4.0.1-2) ...
Selecting previously unselected package libxpp3-java.
Preparing to unpack .../236-libxpp3-java_1.1.4c-3_all.deb ...
Unpacking libxpp3-java (1.1.4c-3) ...
Selecting previously unselected package libxstream-java.
Preparing to unpack .../237-libxstream-java_1.4.20-1_all.deb ...
Unpacking libxstream-java (1.4.20-1) ...
Selecting previously unselected package groovy.
Preparing to unpack .../238-groovy_2.4.21-10_all.deb ...
Unpacking groovy (2.4.21-10) ...
Selecting previously unselected package libatinject-jsr330-api-java.
Preparing to unpack .../239-libatinject-jsr330-api-java_1.0+ds1-5_all.deb ...
Unpacking libatinject-jsr330-api-java (1.0+ds1-5) ...
Selecting previously unselected package libcommons-collections3-java.
Preparing to unpack .../240-libcommons-collections3-java_3.2.2-3_all.deb ...
Unpacking libcommons-collections3-java (3.2.2-3) ...
Selecting previously unselected package libcommons-compress-java.
Preparing to unpack .../241-libcommons-compress-java_1.25.0-1_all.deb ...
Unpacking libcommons-compress-java (1.25.0-1) ...
Selecting previously unselected package libcommons-io-java.
Preparing to unpack .../242-libcommons-io-java_2.16.1-1_all.deb ...
Unpacking libcommons-io-java (2.16.1-1) ...
Selecting previously unselected package libcommons-lang-java.
Preparing to unpack .../243-libcommons-lang-java_2.6-10_all.deb ...
Unpacking libcommons-lang-java (2.6-10) ...
Selecting previously unselected package liberror-prone-java.
Preparing to unpack .../244-liberror-prone-java_2.18.0-1_all.deb ...
Unpacking liberror-prone-java (2.18.0-1) ...
Selecting previously unselected package libjsr305-java.
Preparing to unpack .../245-libjsr305-java_0.1~+svn49-11_all.deb ...
Unpacking libjsr305-java (0.1~+svn49-11) ...
Selecting previously unselected package libguava-java.
Preparing to unpack .../246-libguava-java_32.0.1-1_all.deb ...
Unpacking libguava-java (32.0.1-1) ...
Selecting previously unselected package libcommons-codec-java.
Preparing to unpack .../247-libcommons-codec-java_1.16.0-1_all.deb ...
Unpacking libcommons-codec-java (1.16.0-1) ...
Selecting previously unselected package libhttpcore-java.
Preparing to unpack .../248-libhttpcore-java_4.4.16-1_all.deb ...
Unpacking libhttpcore-java (4.4.16-1) ...
Selecting previously unselected package libhttpclient-java.
Preparing to unpack .../249-libhttpclient-java_4.5.14-1_all.deb ...
Unpacking libhttpclient-java (4.5.14-1) ...
Selecting previously unselected package libjarjar-java.
Preparing to unpack .../250-libjarjar-java_1.4+svn142-12_all.deb ...
Unpacking libjarjar-java (1.4+svn142-12) ...
Selecting previously unselected package libjcip-annotations-java.
Preparing to unpack .../251-libjcip-annotations-java_20060626-6_all.deb ...
Unpacking libjcip-annotations-java (20060626-6) ...
Selecting previously unselected package libjna-jni.
Preparing to unpack .../252-libjna-jni_5.14.0-1_armhf.deb ...
Unpacking libjna-jni (5.14.0-1) ...
Selecting previously unselected package libjna-java.
Preparing to unpack .../253-libjna-java_5.14.0-1_all.deb ...
Unpacking libjna-java (5.14.0-1) ...
Selecting previously unselected package libjzlib-java.
Preparing to unpack .../254-libjzlib-java_1.1.3-3_all.deb ...
Unpacking libjzlib-java (1.1.3-3) ...
Selecting previously unselected package libjsch-java.
Preparing to unpack .../255-libjsch-java_0.1.55-1_all.deb ...
Unpacking libjsch-java (0.1.55-1) ...
Selecting previously unselected package libminlog-java.
Preparing to unpack .../256-libminlog-java_1.3.0-1.1_all.deb ...
Unpacking libminlog-java (1.3.0-1.1) ...
Selecting previously unselected package libobjenesis-java.
Preparing to unpack .../257-libobjenesis-java_3.3-3_all.deb ...
Unpacking libobjenesis-java (3.3-3) ...
Selecting previously unselected package libreflectasm-java.
Preparing to unpack .../258-libreflectasm-java_1.11.9+dfsg-4_all.deb ...
Unpacking libreflectasm-java (1.11.9+dfsg-4) ...
Selecting previously unselected package libkryo-java.
Preparing to unpack .../259-libkryo-java_2.20-7_all.deb ...
Unpacking libkryo-java (2.20-7) ...
Selecting previously unselected package liblogback-java.
Preparing to unpack .../260-liblogback-java_1%3a1.2.11-5_all.deb ...
Unpacking liblogback-java (1:1.2.11-5) ...
Selecting previously unselected package libnative-platform-jni.
Preparing to unpack .../261-libnative-platform-jni_0.14-6_armhf.deb ...
Unpacking libnative-platform-jni (0.14-6) ...
Selecting previously unselected package libnative-platform-java.
Preparing to unpack .../262-libnative-platform-java_0.14-6_all.deb ...
Unpacking libnative-platform-java (0.14-6) ...
Selecting previously unselected package libxml-commons-external-java.
Preparing to unpack .../263-libxml-commons-external-java_1.4.01-6_all.deb ...
Unpacking libxml-commons-external-java (1.4.01-6) ...
Selecting previously unselected package libxml-commons-resolver1.1-java.
Preparing to unpack .../264-libxml-commons-resolver1.1-java_1.2-11_all.deb ...
Unpacking libxml-commons-resolver1.1-java (1.2-11) ...
Selecting previously unselected package libxerces2-java.
Preparing to unpack .../265-libxerces2-java_2.12.2-1_all.deb ...
Unpacking libxerces2-java (2.12.2-1) ...
Selecting previously unselected package libnekohtml-java.
Preparing to unpack .../266-libnekohtml-java_1.9.22.noko2-0.1_all.deb ...
Unpacking libnekohtml-java (1.9.22.noko2-0.1) ...
Selecting previously unselected package libxbean-reflect-java.
Preparing to unpack .../267-libxbean-reflect-java_4.5-8_all.deb ...
Unpacking libxbean-reflect-java (4.5-8) ...
Selecting previously unselected package libgradle-core-java.
Preparing to unpack .../268-libgradle-core-java_4.4.1-20_all.deb ...
Unpacking libgradle-core-java (4.4.1-20) ...
Selecting previously unselected package libbcprov-java.
Preparing to unpack .../269-libbcprov-java_1.77-1_all.deb ...
Unpacking libbcprov-java (1.77-1) ...
Selecting previously unselected package libbcpg-java.
Preparing to unpack .../270-libbcpg-java_1.77-1_all.deb ...
Unpacking libbcpg-java (1.77-1) ...
Selecting previously unselected package libbsh-java.
Preparing to unpack .../271-libbsh-java_2.0b4-20_all.deb ...
Unpacking libbsh-java (2.0b4-20) ...
Selecting previously unselected package libdd-plist-java.
Preparing to unpack .../272-libdd-plist-java_1.20-1.1_all.deb ...
Unpacking libdd-plist-java (1.20-1.1) ...
Selecting previously unselected package libjaxen-java.
Preparing to unpack .../273-libjaxen-java_1.1.6-4_all.deb ...
Unpacking libjaxen-java (1.1.6-4) ...
Selecting previously unselected package libdom4j-java.
Preparing to unpack .../274-libdom4j-java_2.1.4-1_all.deb ...
Unpacking libdom4j-java (2.1.4-1) ...
Selecting previously unselected package libbcel-java.
Preparing to unpack .../275-libbcel-java_6.5.0-2_all.deb ...
Unpacking libbcel-java (6.5.0-2) ...
Selecting previously unselected package libjformatstring-java.
Preparing to unpack .../276-libjformatstring-java_0.10~20131207-2.1_all.deb ...
Unpacking libjformatstring-java (0.10~20131207-2.1) ...
Selecting previously unselected package libfindbugs-java.
Preparing to unpack .../277-libfindbugs-java_3.1.0~preview2-3_all.deb ...
Unpacking libfindbugs-java (3.1.0~preview2-3) ...
Selecting previously unselected package libgoogle-gson-java.
Preparing to unpack .../278-libgoogle-gson-java_2.10.1-1_all.deb ...
Unpacking libgoogle-gson-java (2.10.1-1) ...
Selecting previously unselected package libaopalliance-java.
Preparing to unpack .../279-libaopalliance-java_20070526-7_all.deb ...
Unpacking libaopalliance-java (20070526-7) ...
Selecting previously unselected package libguice-java.
Preparing to unpack .../280-libguice-java_4.2.3-2_all.deb ...
Unpacking libguice-java (4.2.3-2) ...
Selecting previously unselected package libjatl-java.
Preparing to unpack .../281-libjatl-java_0.2.3-1.1_all.deb ...
Unpacking libjatl-java (0.2.3-1.1) ...
Selecting previously unselected package libjcifs-java.
Preparing to unpack .../282-libjcifs-java_1.3.19-2_all.deb ...
Unpacking libjcifs-java (1.3.19-2) ...
Selecting previously unselected package libeclipse-jdt-annotation-java.
Preparing to unpack .../283-libeclipse-jdt-annotation-java_2.2.700+eclipse4.26-2_all.deb ...
Unpacking libeclipse-jdt-annotation-java (2.2.700+eclipse4.26-2) ...
Selecting previously unselected package libjavaewah-java.
Preparing to unpack .../284-libjavaewah-java_1.2.3-1_all.deb ...
Unpacking libjavaewah-java (1.2.3-1) ...
Selecting previously unselected package libel-api-java.
Preparing to unpack .../285-libel-api-java_3.0.0-3_all.deb ...
Unpacking libel-api-java (3.0.0-3) ...
Selecting previously unselected package libwebsocket-api-java.
Preparing to unpack .../286-libwebsocket-api-java_1.1-2_all.deb ...
Unpacking libwebsocket-api-java (1.1-2) ...
Selecting previously unselected package libjetty9-java.
Preparing to unpack .../287-libjetty9-java_9.4.54-1_all.deb ...
Unpacking libjetty9-java (9.4.54-1) ...
Selecting previously unselected package libjgit-java.
Preparing to unpack .../288-libjgit-java_6.7.0-1_all.deb ...
Unpacking libjgit-java (6.7.0-1) ...
Selecting previously unselected package libjs-jquery.
Preparing to unpack .../289-libjs-jquery_3.6.1+dfsg+~3.5.14-1_all.deb ...
Unpacking libjs-jquery (3.6.1+dfsg+~3.5.14-1) ...
Selecting previously unselected package libcommons-lang3-java.
Preparing to unpack .../290-libcommons-lang3-java_3.14.0-1_all.deb ...
Unpacking libcommons-lang3-java (3.14.0-1) ...
Selecting previously unselected package libplexus-utils2-java.
Preparing to unpack .../291-libplexus-utils2-java_3.4.2-1_all.deb ...
Unpacking libplexus-utils2-java (3.4.2-1) ...
Selecting previously unselected package libwagon-provider-api-java.
Preparing to unpack .../292-libwagon-provider-api-java_3.5.3-1_all.deb ...
Unpacking libwagon-provider-api-java (3.5.3-1) ...
Selecting previously unselected package libmaven-resolver-java.
Preparing to unpack .../293-libmaven-resolver-java_1.6.3-1_all.deb ...
Unpacking libmaven-resolver-java (1.6.3-1) ...
Selecting previously unselected package libgeronimo-annotation-1.3-spec-java.
Preparing to unpack .../294-libgeronimo-annotation-1.3-spec-java_1.3-1_all.deb ...
Unpacking libgeronimo-annotation-1.3-spec-java (1.3-1) ...
Selecting previously unselected package libmaven-parent-java.
Preparing to unpack .../295-libmaven-parent-java_35-1_all.deb ...
Unpacking libmaven-parent-java (35-1) ...
Selecting previously unselected package libmaven-shared-utils-java.
Preparing to unpack .../296-libmaven-shared-utils-java_3.3.4-1_all.deb ...
Unpacking libmaven-shared-utils-java (3.3.4-1) ...
Selecting previously unselected package libplexus-cipher-java.
Preparing to unpack .../297-libplexus-cipher-java_2.0-1_all.deb ...
Unpacking libplexus-cipher-java (2.0-1) ...
Selecting previously unselected package libplexus-classworlds-java.
Preparing to unpack .../298-libplexus-classworlds-java_2.7.0-1_all.deb ...
Unpacking libplexus-classworlds-java (2.7.0-1) ...
Selecting previously unselected package libplexus-component-annotations-java.
Preparing to unpack .../299-libplexus-component-annotations-java_2.1.1-1_all.deb ...
Unpacking libplexus-component-annotations-java (2.1.1-1) ...
Selecting previously unselected package libplexus-interpolation-java.
Preparing to unpack .../300-libplexus-interpolation-java_1.26-1_all.deb ...
Unpacking libplexus-interpolation-java (1.26-1) ...
Selecting previously unselected package libplexus-sec-dispatcher-java.
Preparing to unpack .../301-libplexus-sec-dispatcher-java_2.0-3_all.deb ...
Unpacking libplexus-sec-dispatcher-java (2.0-3) ...
Selecting previously unselected package libgeronimo-interceptor-3.0-spec-java.
Preparing to unpack .../302-libgeronimo-interceptor-3.0-spec-java_1.0.1-4_all.deb ...
Unpacking libgeronimo-interceptor-3.0-spec-java (1.0.1-4) ...
Selecting previously unselected package libcdi-api-java.
Preparing to unpack .../303-libcdi-api-java_1.2-3_all.deb ...
Unpacking libcdi-api-java (1.2-3) ...
Selecting previously unselected package libsisu-inject-java.
Preparing to unpack .../304-libsisu-inject-java_0.3.4-2_all.deb ...
Unpacking libsisu-inject-java (0.3.4-2) ...
Selecting previously unselected package libsisu-plexus-java.
Preparing to unpack .../305-libsisu-plexus-java_0.3.4-3_all.deb ...
Unpacking libsisu-plexus-java (0.3.4-3) ...
Selecting previously unselected package libmaven3-core-java.
Preparing to unpack .../306-libmaven3-core-java_3.8.7-2_all.deb ...
Unpacking libmaven3-core-java (3.8.7-2) ...
Selecting previously unselected package libplexus-container-default-java.
Preparing to unpack .../307-libplexus-container-default-java_2.1.1-1_all.deb ...
Unpacking libplexus-container-default-java (2.1.1-1) ...
Selecting previously unselected package libpolyglot-maven-java.
Preparing to unpack .../308-libpolyglot-maven-java_0.8~tobrien+git20120905-10_all.deb ...
Unpacking libpolyglot-maven-java (0.8~tobrien+git20120905-10) ...
Selecting previously unselected package librhino-java.
Preparing to unpack .../309-librhino-java_1.7.14-2.1_all.deb ...
Unpacking librhino-java (1.7.14-2.1) ...
Selecting previously unselected package libsimple-http-java.
Preparing to unpack .../310-libsimple-http-java_4.1.21-1.1_all.deb ...
Unpacking libsimple-http-java (4.1.21-1.1) ...
Selecting previously unselected package libwagon-file-java.
Preparing to unpack .../311-libwagon-file-java_3.5.3-1_all.deb ...
Unpacking libwagon-file-java (3.5.3-1) ...
Selecting previously unselected package libjsoup-java.
Preparing to unpack .../312-libjsoup-java_1.15.3-1_all.deb ...
Unpacking libjsoup-java (1.15.3-1) ...
Selecting previously unselected package libwagon-http-java.
Preparing to unpack .../313-libwagon-http-java_3.5.3-1_all.deb ...
Unpacking libwagon-http-java (3.5.3-1) ...
Selecting previously unselected package libjcommander-java.
Preparing to unpack .../314-libjcommander-java_1.71-4_all.deb ...
Unpacking libjcommander-java (1.71-4) ...
Selecting previously unselected package testng.
Preparing to unpack .../315-testng_6.9.12-4_all.deb ...
Unpacking testng (6.9.12-4) ...
Selecting previously unselected package libgradle-plugins-java.
Preparing to unpack .../316-libgradle-plugins-java_4.4.1-20_all.deb ...
Unpacking libgradle-plugins-java (4.4.1-20) ...
Selecting previously unselected package gradle.
Preparing to unpack .../317-gradle_4.4.1-20_all.deb ...
Unpacking gradle (4.4.1-20) ...
Selecting previously unselected package maven-repo-helper.
Preparing to unpack .../318-maven-repo-helper_1.11_all.deb ...
Unpacking maven-repo-helper (1.11) ...
Selecting previously unselected package gradle-debian-helper.
Preparing to unpack .../319-gradle-debian-helper_2.4_all.deb ...
Unpacking gradle-debian-helper (2.4) ...
Selecting previously unselected package jarwrapper.
Preparing to unpack .../320-jarwrapper_0.79_all.deb ...
Unpacking jarwrapper (0.79) ...
Selecting previously unselected package javahelper.
Preparing to unpack .../321-javahelper_0.79_all.deb ...
Unpacking javahelper (0.79) ...
Selecting previously unselected package libbyte-buddy-java.
Preparing to unpack .../322-libbyte-buddy-java_1.14.13-1_all.deb ...
Unpacking libbyte-buddy-java (1.14.13-1) ...
Selecting previously unselected package libcommons-math3-java.
Preparing to unpack .../323-libcommons-math3-java_3.6.1-3_all.deb ...
Unpacking libcommons-math3-java (3.6.1-3) ...
Selecting previously unselected package libjackson2-annotations-java.
Preparing to unpack .../324-libjackson2-annotations-java_2.14.0-1_all.deb ...
Unpacking libjackson2-annotations-java (2.14.0-1) ...
Selecting previously unselected package libjackson2-core-java.
Preparing to unpack .../325-libjackson2-core-java_2.14.1-1_all.deb ...
Unpacking libjackson2-core-java (2.14.1-1) ...
Selecting previously unselected package libjackson2-databind-java.
Preparing to unpack .../326-libjackson2-databind-java_2.14.0-1_all.deb ...
Unpacking libjackson2-databind-java (2.14.0-1) ...
Selecting previously unselected package liblz4-jni.
Preparing to unpack .../327-liblz4-jni_1.8.0-4_armhf.deb ...
Unpacking liblz4-jni (1.8.0-4) ...
Selecting previously unselected package liblz4-java.
Preparing to unpack .../328-liblz4-java_1.8.0-4_all.deb ...
Unpacking liblz4-java (1.8.0-4) ...
Selecting previously unselected package libmockito-java.
Preparing to unpack .../329-libmockito-java_2.23.0-2_all.deb ...
Unpacking libmockito-java (2.23.0-2) ...
Selecting previously unselected package libredberry-pipe-java.
Preparing to unpack .../330-libredberry-pipe-java_1.0.0~alpha0-3_all.deb ...
Unpacking libredberry-pipe-java (1.0.0~alpha0-3) ...
Selecting previously unselected package libtrove3-java.
Preparing to unpack .../331-libtrove3-java_3.0.3-5_all.deb ...
Unpacking libtrove3-java (3.0.3-5) ...
Setting up libjcifs-java (1.3.19-2) ...
Setting up libbcprov-java (1.77-1) ...
Setting up libksba8:armhf (1.6.6-1) ...
Setting up media-types (10.1.0) ...
Setting up libpipeline1:armhf (1.5.7-2) ...
Setting up fastjar (2:0.98-7) ...
Setting up libgraphite2-3:armhf (1.3.14-2) ...
Setting up liblcms2-2:armhf (2.14-2+b1) ...
Setting up libpixman-1-0:armhf (0.42.2-1+b1) ...
Setting up libjcommander-java (1.71-4) ...
Setting up libjackson2-annotations-java (2.14.0-1) ...
Setting up wdiff (1.2.2-6) ...
Setting up libsharpyuv0:armhf (1.4.0-0.1) ...
Setting up libslf4j-java (1.7.32-1) ...
Setting up libfile-which-perl (1.27-2) ...
Setting up libxau6:armhf (1:1.0.9-1+b1) ...
Setting up libplexus-utils2-java (3.4.2-1) ...
Setting up libnpth0t64:armhf (1.6-3.1) ...
Setting up libredberry-pipe-java (1.0.0~alpha0-3) ...
Setting up libkeyutils1:armhf (1.6.3-3) ...
Setting up libplexus-classworlds-java (2.7.0-1) ...
Setting up libqdox-java (1.12.1-3) ...
Setting up libicu72:armhf (72.1-4+b1) ...
Setting up liblerc4:armhf (4.0.0+ds-4+b1) ...
Setting up libjsr305-java (0.1~+svn49-11) ...
Setting up libsimple-http-java (4.1.21-1.1) ...
Setting up bsdextrautils (2.40.1-1) ...
Setting up hicolor-icon-theme (0.17-2) ...
Setting up java-common (0.75) ...
Setting up libdynaloader-functions-perl (0.003-3) ...
Setting up libdatrie1:armhf (0.2.13-3) ...
Setting up libjcip-annotations-java (20060626-6) ...
Setting up libobjenesis-java (3.3-3) ...
Setting up libclass-method-modifiers-perl (2.15-1) ...
Setting up libaopalliance-java (20070526-7) ...
Setting up libcommons-cli-java (1.6.0-1) ...
Setting up libio-pty-perl (1:1.20-1+b1) ...
Setting up libmagic-mgc (1:5.45-3) ...
Setting up liblogback-java (1:1.2.11-5) ...
Setting up libclone-perl:armhf (0.46-1+b2) ...
Setting up libminlog-java (1.3.0-1.1) ...
Setting up libarchive-zip-perl (1.68-1) ...
Setting up libglvnd0:armhf (1.7.0-1+b1) ...
Setting up libgoogle-gson-java (2.10.1-1) ...
Setting up libhtml-tagset-perl (3.24-1) ...
Setting up unzip (6.0-28) ...
Setting up libdebhelper-perl (13.15.3) ...
Setting up libbrotli1:armhf (1.1.0-2+b3) ...
Setting up liblwp-mediatypes-perl (6.04-2) ...
Setting up libgdk-pixbuf2.0-common (2.42.12+dfsg-1) ...
Setting up libmagic1t64:armhf (1:5.45-3) ...
Setting up libasm-java (9.7-1) ...
Setting up x11-common (1:7.7+23) ...
invoke-rc.d: could not determine current runlevel
Setting up X socket directories... /tmp/.X11-unix /tmp/.ICE-unix.
Setting up libtry-tiny-perl (0.31-2) ...
Setting up libsensors-config (1:3.6.0-9) ...
Setting up libdeflate0:armhf (1.20-1) ...
Setting up perl-openssl-defaults:armhf (7+b2) ...
Setting up libdd-plist-java (1.20-1.1) ...
Setting up gettext-base (0.21-14+b1) ...
Setting up m4 (1.4.19-4) ...
Setting up libel-api-java (3.0.0-3) ...
Setting up libencode-locale-perl (1.05-3) ...
Setting up libplexus-component-annotations-java (2.1.1-1) ...
Setting up libcom-err2:armhf (1.47.1~rc2-1) ...
Setting up file (1:5.45-3) ...
Setting up libpolyglot-maven-java (0.8~tobrien+git20120905-10) ...
Setting up libfelix-gogo-runtime-java (0.16.2-1.1) ...
Setting up libassuan0:armhf (2.5.6-1+b1) ...
Setting up libjzlib-java (1.1.3-3) ...
Setting up libjbig0:armhf (2.1-6.1+b1) ...
Setting up libelf1t64:armhf (0.191-1+b1) ...
Setting up libkrb5support0:armhf (1.20.1-6+b1) ...
Setting up libsasl2-modules-db:armhf (2.1.28+dfsg1-6) ...
Setting up tzdata (2024a-4) ...

Current default time zone: 'Etc/UTC'
Local time is now:      Fri May 17 20:00:00 UTC 2024.
Universal Time is now:  Fri May 17 20:00:00 UTC 2024.
Run 'dpkg-reconfigure tzdata' if you wish to change it.

Setting up libgeronimo-annotation-1.3-spec-java (1.3-1) ...
Setting up libgeronimo-interceptor-3.0-spec-java (1.0.1-4) ...
Setting up libcommons-collections3-java (3.2.2-3) ...
Setting up libasound2-data (1.2.11-1) ...
Setting up libjsch-java (0.1.55-1) ...
Setting up libreflectasm-java (1.11.9+dfsg-4) ...
Setting up librhino-java (1.7.14-2.1) ...
Setting up autotools-dev (20220109.1) ...
Setting up libz3-4:armhf (4.8.12-3.1+b2) ...
Setting up libglib2.0-0t64:armhf (2.80.2-1) ...
No schema files found: doing nothing.
Setting up libbsf-java (1:2.4.0-8) ...
Setting up libosgi-annotation-java (8.1.0-1) ...
Setting up libjformatstring-java (0.10~20131207-2.1) ...
Setting up libasound2t64:armhf (1.2.11-1+b1) ...
Setting up libjavaewah-java (1.2.3-1) ...
Setting up libjpeg62-turbo:armhf (1:2.1.5-3) ...
Setting up libjaxen-java (1.1.6-4) ...
Setting up libx11-data (2:1.8.7-1) ...
Setting up libnspr4:armhf (2:4.35-1.1+b1) ...
Setting up gnupg-l10n (2.2.43-6) ...
Setting up libeclipse-jdt-annotation-java (2.2.700+eclipse4.26-2) ...
Setting up libjansi-java (2.4.1-2) ...
Setting up libapache-pom-java (29-2) ...
Setting up libavahi-common-data:armhf (0.8-13+b2) ...
Setting up libxpp3-java (1.1.4c-3) ...
Setting up libatinject-jsr330-api-java (1.0+ds1-5) ...
Setting up libdbus-1-3:armhf (1.14.10-4+b1) ...
Setting up libwebsocket-api-java (1.1-2) ...
Setting up libfribidi0:armhf (1.0.13-3+b1) ...
Setting up libplexus-interpolation-java (1.26-1) ...
Setting up fonts-dejavu-mono (2.37-8) ...
Setting up libpng16-16t64:armhf (1.6.43-5) ...
Setting up libxml-commons-resolver1.1-java (1.2-11) ...
Setting up libkryo-java (2.20-7) ...
Setting up libxz-java (1.9-1) ...
Setting up libio-html-perl (1.004-3) ...
Setting up libjna-jni (5.14.0-1) ...
Setting up autopoint (0.21-14) ...
Setting up binfmt-support (2.2.2-7) ...
invoke-rc.d: could not determine current runlevel
invoke-rc.d: policy-rc.d denied execution of start.
Setting up libb-hooks-op-check-perl:armhf (0.22-3+b1) ...
Setting up fonts-dejavu-core (2.37-8) ...
Setting up libfelix-framework-java (4.6.1-2.1) ...
Setting up libipc-run-perl (20231003.0-2) ...
Setting up libpcsclite1:armhf (2.2.1-1) ...
Setting up libsensors5:armhf (1:3.6.0-9) ...
Setting up libk5crypto3:armhf (1.20.1-6+b1) ...
Setting up libhamcrest-java (2.2-2) ...
Setting up libglapi-mesa:armhf (24.0.7-1) ...
Setting up libbsh-java (2.0b4-20) ...
Setting up libjsp-api-java (2.3.4-3) ...
Setting up libsasl2-2:armhf (2.1.28+dfsg1-6) ...
Setting up libvulkan1:armhf (1.3.280.0-1) ...
Setting up autoconf (2.71-3) ...
Setting up libwebp7:armhf (1.4.0-0.1) ...
Setting up libtimedate-perl (2.3300-2) ...
Setting up libgif7:armhf (5.2.2-1) ...
Setting up libjarjar-java (1.4+svn142-12) ...
Setting up libtrove3-java (3.0.3-5) ...
Setting up dwz (0.15-1+b2) ...
Setting up sensible-utils (0.0.22) ...
Setting up libxshmfence1:armhf (1.3-1+b1) ...
Setting up libjsoup-java (1.15.3-1) ...
Setting up at-spi2-common (2.52.0-1) ...
Setting up libtiff6:armhf (4.5.1+git230720-4) ...
Setting up libuchardet0:armhf (0.0.8-1+b1) ...
Setting up libxml-commons-external-java (1.4.01-6) ...
Setting up libjna-java (5.14.0-1) ...
Setting up libxbean-reflect-java (4.5-8) ...
Setting up libservlet-api-java (4.0.1-2) ...
Setting up librole-tiny-perl (2.002004-1) ...
Setting up libjackson2-core-java (2.14.1-1) ...
Setting up libsub-override-perl (0.10-1) ...
Setting up libthai-data (0.1.29-2) ...
Setting up netbase (6.4) ...
Setting up libcommons-math3-java (3.6.1-3) ...
Setting up libsub-quote-perl (2.006008-1) ...
Setting up libnative-platform-jni (0.14-6) ...
Setting up libclass-xsaccessor-perl (1.19-4+b3) ...
Setting up libgtk2.0-common (2.24.33-4) ...
Setting up libkrb5-3:armhf (1.20.1-6+b1) ...
Setting up liblz4-jni (1.8.0-4) ...
Setting up libhttpcore-java (4.4.16-1) ...
Setting up libbcpg-java (1.77-1) ...
Setting up libjs-jquery (3.6.1+dfsg+~3.5.14-1) ...
Setting up libxerces2-java (2.12.2-1) ...
Setting up libfile-dirlist-perl (0.05-3) ...
Setting up libfile-homedir-perl (1.006-2) ...
Setting up libantlr-java (2.7.7+dfsg-13) ...
Setting up libyaml-snake-java (1.33-2) ...
Setting up openssl (3.2.1-3) ...
Setting up libbsd0:armhf (0.12.2-1) ...
Setting up libdrm-common (2.4.120-2) ...
Setting up libcdi-api-java (1.2-3) ...
Setting up readline-common (8.2-4) ...
Setting up libhawtjni-runtime-java (1.18-1) ...
Setting up libxml2:armhf (2.9.14+dfsg-1.3+b3) ...
Setting up liburi-perl (5.28-1) ...
Setting up libfile-touch-perl (0.12-2) ...
Setting up dctrl-tools (2.24-3) ...
Setting up libjatl-java (0.2.3-1.1) ...
Setting up libnet-ssleay-perl:armhf (1.94-1+b1) ...
Setting up automake (1:1.16.5-1.3) ...
update-alternatives: using /usr/bin/automake-1.16 to provide /usr/bin/automake (automake) in auto mode
Setting up pinentry-curses (1.2.1-3+b2) ...
Setting up libdom4j-java (2.1.4-1) ...
Setting up libfile-stripnondeterminism-perl (1.13.1-1) ...
Setting up libwagon-provider-api-java (3.5.3-1) ...
Setting up libnative-platform-java (0.14-6) ...
Setting up libosgi-core-java (8.0.0-2) ...
Setting up libhttp-date-perl (6.06-1) ...
Setting up libxstream-java (1.4.20-1) ...
Setting up libnekohtml-java (1.9.22.noko2-0.1) ...
Setting up libxdmcp6:armhf (1:1.1.2-3+b1) ...
Setting up liblz4-java (1.8.0-4) ...
Setting up libxcb1:armhf (1.17.0-1) ...
Setting up gettext (0.21-14+b1) ...
Setting up libjetty9-java (9.4.54-1) ...
Setting up libxcb-xfixes0:armhf (1.17.0-1) ...
Setting up java-wrappers (0.4) ...
Setting up libatk1.0-0t64:armhf (2.52.0-1) ...
Setting up libfile-listing-perl (6.16-1) ...
Setting up libosgi-compendium-java (7.0.0-1) ...
Setting up jarwrapper (0.79) ...
Setting up libtool (2.4.7-7) ...
Setting up libxcb-render0:armhf (1.17.0-1) ...
Setting up fontconfig-config (2.15.0-1.1) ...
Setting up libxcb-glx0:armhf (1.17.0-1) ...
Setting up libmaven-parent-java (35-1) ...
Setting up libedit2:armhf (3.1-20230828-1+b1) ...
Setting up libcommons-parent-java (56-1) ...
Setting up libavahi-common3:armhf (0.8-13+b2) ...
Setting up libcommons-logging-java (1.3.0-1) ...
Setting up libnet-http-perl (6.23-1) ...
Setting up libsisu-inject-java (0.3.4-2) ...
Setting up libnss3:armhf (2:3.100-1) ...
Setting up libxcb-shm0:armhf (1.17.0-1) ...
Setting up libdevel-callchecker-perl:armhf (0.009-1) ...
Setting up libcommons-lang-java (2.6-10) ...
Setting up libldap-2.5-0:armhf (2.5.17+dfsg-1) ...
Setting up libjackson2-databind-java (2.14.0-1) ...
Setting up libplexus-cipher-java (2.0-1) ...
Setting up intltool-debian (0.35.0+20060710.6) ...
Setting up libxcb-present0:armhf (1.17.0-1) ...
Setting up dh-autoreconf (20) ...
Setting up patchutils (0.4.2-1) ...
Setting up libthai0:armhf (0.1.29-2) ...
Setting up ca-certificates (20240203) ...
Updating certificates in /etc/ssl/certs...
146 added, 0 removed; done.
Setting up libsisu-plexus-java (0.3.4-3) ...
Setting up libbcel-java (6.5.0-2) ...
Setting up libllvm17t64:armhf (1:17.0.6-12) ...
Setting up libfreetype6:armhf (2.13.2+dfsg-1+b4) ...
Setting up libxcb-sync1:armhf (1.17.0-1) ...
Setting up testng (6.9.12-4) ...
Setting up shared-mime-info (2.4-4) ...
Setting up libgssapi-krb5-2:armhf (1.20.1-6+b1) ...
Setting up libcommons-lang3-java (3.14.0-1) ...
Setting up libreadline8t64:armhf (8.2-4) ...
Setting up libxcb-dri2-0:armhf (1.17.0-1) ...
Setting up dh-strip-nondeterminism (1.13.1-1) ...
Setting up libwww-robotrules-perl (6.02-1) ...
Setting up libfelix-resolver-java (1.16.0-1) ...
Setting up libdrm2:armhf (2.4.120-2) ...
Setting up libjansi-native-java (1.8-2) ...
Setting up groff-base (1.23.0-4) ...
Setting up libxcb-randr0:armhf (1.17.0-1) ...
Setting up libhtml-parser-perl:armhf (3.82-1) ...
Setting up gpgconf (2.2.43-6) ...
Setting up libjansi1-java (1.18-3) ...
Setting up libplexus-sec-dispatcher-java (2.0-3) ...
Setting up libx11-6:armhf (2:1.8.7-1+b1) ...
Setting up libharfbuzz0b:armhf (8.3.0-2+b1) ...
Setting up libgdk-pixbuf-2.0-0:armhf (2.42.12+dfsg-1) ...
Setting up libfontconfig1:armhf (2.15.0-1.1) ...
Setting up ca-certificates-java (20240118) ...
No JRE found. Skipping Java certificates setup.
Setting up libwagon-file-java (3.5.3-1) ...
Setting up libcommons-codec-java (1.16.0-1) ...
Setting up libjline2-java (2.14.6-5) ...
Setting up libxcomposite1:armhf (1:0.4.5-1+b1) ...
Setting up libavahi-client3:armhf (0.8-13+b2) ...
Setting up libio-socket-ssl-perl (2.085-1) ...
Setting up gpg (2.2.43-6) ...
Setting up gnupg-utils (2.2.43-6) ...
Setting up libhttp-message-perl (6.45-1) ...
Setting up libdrm-amdgpu1:armhf (2.4.120-2) ...
Setting up libxcb-dri3-0:armhf (1.17.0-1) ...
Setting up gtk-update-icon-cache (3.24.41-4) ...
Setting up libx11-xcb1:armhf (2:1.8.7-1+b1) ...
Setting up libhttp-negotiate-perl (6.01-2) ...
Setting up fontconfig (2.15.0-1.1) ...
Regenerating fonts cache... done.
Setting up libdrm-nouveau2:armhf (2.4.120-2) ...
Setting up libfindbugs-java (3.1.0~preview2-3) ...
Setting up libxdamage1:armhf (1:1.1.6-1+b1) ...
Setting up gpg-agent (2.2.43-6) ...
Setting up libxrender1:armhf (1:0.9.10-1.1+b1) ...
Setting up libcommons-compress-java (1.25.0-1) ...
Setting up libhttp-cookies-perl (6.11-1) ...
Setting up libcommons-io-java (2.16.1-1) ...
Setting up libdrm-radeon1:armhf (2.4.120-2) ...
Setting up po-debconf (1.0.21+nmu1) ...
Setting up libhtml-tree-perl (5.07-3) ...
Setting up libpython3.11-stdlib:armhf (3.11.9-1) ...
Setting up libparams-classify-perl:armhf (0.015-2+b3) ...
Setting up gpgsm (2.2.43-6) ...
Setting up libpango-1.0-0:armhf (1.52.2+ds-1) ...
Setting up libgl1-mesa-dri:armhf (24.0.7-1) ...
Setting up libxext6:armhf (2:1.3.4-1+b1) ...
Setting up man-db (2.12.1-1) ...
Not building database; man-db/auto-update is not 'true'.
Setting up libcairo2:armhf (1.18.0-3+b1) ...
Setting up libxxf86vm1:armhf (1:1.1.4-1+b2) ...
Setting up dirmngr (2.2.43-6) ...
Setting up libmaven-resolver-java (1.6.3-1) ...
Setting up adwaita-icon-theme (46.0-1) ...
update-alternatives: using /usr/share/icons/Adwaita/cursor.theme to provide /usr/share/icons/default/index.theme (x-cursor-theme) in auto mode
Setting up libmodule-runtime-perl (0.016-2) ...
Setting up libxfixes3:armhf (1:6.0.0-2+b1) ...
Setting up libxinerama1:armhf (2:1.1.4-3+b1) ...
Setting up libxrandr2:armhf (2:1.5.4-1) ...
Setting up openjdk-17-jre-headless:armhf (17.0.11+9-1) ...
update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/java to provide /usr/bin/java (java) in auto mode
update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/jpackage to provide /usr/bin/jpackage (jpackage) in auto mode
update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/keytool to provide /usr/bin/keytool (keytool) in auto mode
update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/rmiregistry to provide /usr/bin/rmiregistry (rmiregistry) in auto mode
update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/lib/jexec to provide /usr/bin/jexec (jexec) in auto mode
Setting up libhttpclient-java (4.5.14-1) ...
Setting up libwagon-http-java (3.5.3-1) ...
Setting up libmaven-shared-utils-java (3.3.4-1) ...
Setting up libpangoft2-1.0-0:armhf (1.52.2+ds-1) ...
Setting up libcups2t64:armhf (2.4.7-1.2+b1) ...
Setting up libpangocairo-1.0-0:armhf (1.52.2+ds-1) ...
Setting up libpython3-stdlib:armhf (3.11.8-1) ...
Setting up python3.11 (3.11.9-1) ...
Setting up libjgit-java (6.7.0-1) ...
Setting up libglx-mesa0:armhf (24.0.7-1) ...
Setting up libxi6:armhf (2:1.8.1-1) ...
Setting up gpg-wks-client (2.2.43-6) ...
Setting up libglx0:armhf (1.7.0-1+b1) ...
Setting up libimport-into-perl (1.002005-2) ...
Setting up libxtst6:armhf (2:1.2.3-1.1+b1) ...
Setting up libmoo-perl (2.005005-1) ...
Setting up libxcursor1:armhf (1:1.2.1-1+b1) ...
Setting up debhelper (13.15.3) ...
Setting up python3 (3.11.8-1) ...
Setting up libgl1:armhf (1.7.0-1+b1) ...
Setting up libgtk2.0-0t64:armhf (2.24.33-4) ...
Setting up gnupg (2.2.43-6) ...
Setting up liberror-prone-java (2.18.0-1) ...
Setting up libwww-perl (6.77-1) ...
Setting up devscripts (2.23.7) ...
Setting up libguava-java (32.0.1-1) ...
Setting up javahelper (0.79) ...
Setting up libplexus-container-default-java (2.1.1-1) ...
Setting up liblwp-protocol-https-perl (6.14-1) ...
Setting up libguice-java (4.2.3-2) ...
Setting up libmaven3-core-java (3.8.7-2) ...
Setting up libbyte-buddy-java (1.14.13-1) ...
Setting up libmockito-java (2.23.0-2) ...
Processing triggers for libc-bin (2.38-11) ...
Processing triggers for ca-certificates-java (20240118) ...
Adding debian:ACCVRAIZ1.pem
Adding debian:AC_RAIZ_FNMT-RCM.pem
Adding debian:AC_RAIZ_FNMT-RCM_SERVIDORES_SEGUROS.pem
Adding debian:ANF_Secure_Server_Root_CA.pem
Adding debian:Actalis_Authentication_Root_CA.pem
Adding debian:AffirmTrust_Commercial.pem
Adding debian:AffirmTrust_Networking.pem
Adding debian:AffirmTrust_Premium.pem
Adding debian:AffirmTrust_Premium_ECC.pem
Adding debian:Amazon_Root_CA_1.pem
Adding debian:Amazon_Root_CA_2.pem
Adding debian:Amazon_Root_CA_3.pem
Adding debian:Amazon_Root_CA_4.pem
Adding debian:Atos_TrustedRoot_2011.pem
Adding debian:Atos_TrustedRoot_Root_CA_ECC_TLS_2021.pem
Adding debian:Atos_TrustedRoot_Root_CA_RSA_TLS_2021.pem
Adding debian:Autoridad_de_Certificacion_Firmaprofesional_CIF_A62634068.pem
Adding debian:BJCA_Global_Root_CA1.pem
Adding debian:BJCA_Global_Root_CA2.pem
Adding debian:Baltimore_CyberTrust_Root.pem
Adding debian:Buypass_Class_2_Root_CA.pem
Adding debian:Buypass_Class_3_Root_CA.pem
Adding debian:CA_Disig_Root_R2.pem
Adding debian:CFCA_EV_ROOT.pem
Adding debian:COMODO_Certification_Authority.pem
Adding debian:COMODO_ECC_Certification_Authority.pem
Adding debian:COMODO_RSA_Certification_Authority.pem
Adding debian:Certainly_Root_E1.pem
Adding debian:Certainly_Root_R1.pem
Adding debian:Certigna.pem
Adding debian:Certigna_Root_CA.pem
Adding debian:Certum_EC-384_CA.pem
Adding debian:Certum_Trusted_Network_CA.pem
Adding debian:Certum_Trusted_Network_CA_2.pem
Adding debian:Certum_Trusted_Root_CA.pem
Adding debian:CommScope_Public_Trust_ECC_Root-01.pem
Adding debian:CommScope_Public_Trust_ECC_Root-02.pem
Adding debian:CommScope_Public_Trust_RSA_Root-01.pem
Adding debian:CommScope_Public_Trust_RSA_Root-02.pem
Adding debian:Comodo_AAA_Services_root.pem
Adding debian:D-TRUST_BR_Root_CA_1_2020.pem
Adding debian:D-TRUST_EV_Root_CA_1_2020.pem
Adding debian:D-TRUST_Root_Class_3_CA_2_2009.pem
Adding debian:D-TRUST_Root_Class_3_CA_2_EV_2009.pem
Adding debian:DigiCert_Assured_ID_Root_CA.pem
Adding debian:DigiCert_Assured_ID_Root_G2.pem
Adding debian:DigiCert_Assured_ID_Root_G3.pem
Adding debian:DigiCert_Global_Root_CA.pem
Adding debian:DigiCert_Global_Root_G2.pem
Adding debian:DigiCert_Global_Root_G3.pem
Adding debian:DigiCert_High_Assurance_EV_Root_CA.pem
Adding debian:DigiCert_TLS_ECC_P384_Root_G5.pem
Adding debian:DigiCert_TLS_RSA4096_Root_G5.pem
Adding debian:DigiCert_Trusted_Root_G4.pem
Adding debian:Entrust.net_Premium_2048_Secure_Server_CA.pem
Adding debian:Entrust_Root_Certification_Authority.pem
Adding debian:Entrust_Root_Certification_Authority_-_EC1.pem
Adding debian:Entrust_Root_Certification_Authority_-_G2.pem
Adding debian:Entrust_Root_Certification_Authority_-_G4.pem
Adding debian:GDCA_TrustAUTH_R5_ROOT.pem
Adding debian:GLOBALTRUST_2020.pem
Adding debian:GTS_Root_R1.pem
Adding debian:GTS_Root_R2.pem
Adding debian:GTS_Root_R3.pem
Adding debian:GTS_Root_R4.pem
Adding debian:GlobalSign_ECC_Root_CA_-_R4.pem
Adding debian:GlobalSign_ECC_Root_CA_-_R5.pem
Adding debian:GlobalSign_Root_CA.pem
Adding debian:GlobalSign_Root_CA_-_R3.pem
Adding debian:GlobalSign_Root_CA_-_R6.pem
Adding debian:GlobalSign_Root_E46.pem
Adding debian:GlobalSign_Root_R46.pem
Adding debian:Go_Daddy_Class_2_CA.pem
Adding debian:Go_Daddy_Root_Certificate_Authority_-_G2.pem
Adding debian:HARICA_TLS_ECC_Root_CA_2021.pem
Adding debian:HARICA_TLS_RSA_Root_CA_2021.pem
Adding debian:Hellenic_Academic_and_Research_Institutions_ECC_RootCA_2015.pem
Adding debian:Hellenic_Academic_and_Research_Institutions_RootCA_2015.pem
Adding debian:HiPKI_Root_CA_-_G1.pem
Adding debian:Hongkong_Post_Root_CA_3.pem
Adding debian:ISRG_Root_X1.pem
Adding debian:ISRG_Root_X2.pem
Adding debian:IdenTrust_Commercial_Root_CA_1.pem
Adding debian:IdenTrust_Public_Sector_Root_CA_1.pem
Adding debian:Izenpe.com.pem
Adding debian:Microsec_e-Szigno_Root_CA_2009.pem
Adding debian:Microsoft_ECC_Root_Certificate_Authority_2017.pem
Adding debian:Microsoft_RSA_Root_Certificate_Authority_2017.pem
Adding debian:NAVER_Global_Root_Certification_Authority.pem
Adding debian:NetLock_Arany_=Class_Gold=_Főtanúsítvány.pem
Adding debian:OISTE_WISeKey_Global_Root_GB_CA.pem
Adding debian:OISTE_WISeKey_Global_Root_GC_CA.pem
Adding debian:QuoVadis_Root_CA_1_G3.pem
Adding debian:QuoVadis_Root_CA_2.pem
Adding debian:QuoVadis_Root_CA_2_G3.pem
Adding debian:QuoVadis_Root_CA_3.pem
Adding debian:QuoVadis_Root_CA_3_G3.pem
Adding debian:SSL.com_EV_Root_Certification_Authority_ECC.pem
Adding debian:SSL.com_EV_Root_Certification_Authority_RSA_R2.pem
Adding debian:SSL.com_Root_Certification_Authority_ECC.pem
Adding debian:SSL.com_Root_Certification_Authority_RSA.pem
Adding debian:SSL.com_TLS_ECC_Root_CA_2022.pem
Adding debian:SSL.com_TLS_RSA_Root_CA_2022.pem
Adding debian:SZAFIR_ROOT_CA2.pem
Adding debian:Sectigo_Public_Server_Authentication_Root_E46.pem
Adding debian:Sectigo_Public_Server_Authentication_Root_R46.pem
Adding debian:SecureSign_RootCA11.pem
Adding debian:SecureTrust_CA.pem
Adding debian:Secure_Global_CA.pem
Adding debian:Security_Communication_ECC_RootCA1.pem
Adding debian:Security_Communication_RootCA2.pem
Adding debian:Security_Communication_RootCA3.pem
Adding debian:Security_Communication_Root_CA.pem
Adding debian:Starfield_Class_2_CA.pem
Adding debian:Starfield_Root_Certificate_Authority_-_G2.pem
Adding debian:Starfield_Services_Root_Certificate_Authority_-_G2.pem
Adding debian:SwissSign_Gold_CA_-_G2.pem
Adding debian:SwissSign_Silver_CA_-_G2.pem
Adding debian:T-TeleSec_GlobalRoot_Class_2.pem
Adding debian:T-TeleSec_GlobalRoot_Class_3.pem
Adding debian:TUBITAK_Kamu_SM_SSL_Kok_Sertifikasi_-_Surum_1.pem
Adding debian:TWCA_Global_Root_CA.pem
Adding debian:TWCA_Root_Certification_Authority.pem
Adding debian:TeliaSonera_Root_CA_v1.pem
Adding debian:Telia_Root_CA_v2.pem
Adding debian:TrustAsia_Global_Root_CA_G3.pem
Adding debian:TrustAsia_Global_Root_CA_G4.pem
Adding debian:Trustwave_Global_Certification_Authority.pem
Adding debian:Trustwave_Global_ECC_P256_Certification_Authority.pem
Adding debian:Trustwave_Global_ECC_P384_Certification_Authority.pem
Adding debian:TunTrust_Root_CA.pem
Adding debian:UCA_Extended_Validation_Root.pem
Adding debian:UCA_Global_G2_Root.pem
Adding debian:USERTrust_ECC_Certification_Authority.pem
Adding debian:USERTrust_RSA_Certification_Authority.pem
Adding debian:XRamp_Global_CA_Root.pem
Adding debian:certSIGN_ROOT_CA.pem
Adding debian:certSIGN_Root_CA_G2.pem
Adding debian:e-Szigno_Root_CA_2017.pem
Adding debian:ePKI_Root_Certification_Authority.pem
Adding debian:emSign_ECC_Root_CA_-_C3.pem
Adding debian:emSign_ECC_Root_CA_-_G3.pem
Adding debian:emSign_Root_CA_-_C1.pem
Adding debian:emSign_Root_CA_-_G1.pem
Adding debian:vTrus_ECC_Root_CA.pem
Adding debian:vTrus_Root_CA.pem
done.
Setting up maven-repo-helper (1.11) ...
Setting up antlr (2.7.7+dfsg-13) ...
Setting up openjdk-17-jdk-headless:armhf (17.0.11+9-1) ...
update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/jar to provide /usr/bin/jar (jar) in auto mode
update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/jarsigner to provide /usr/bin/jarsigner (jarsigner) in auto mode
update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/javac to provide /usr/bin/javac (javac) in auto mode
update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/javadoc to provide /usr/bin/javadoc (javadoc) in auto mode
update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/javap to provide /usr/bin/javap (javap) in auto mode
update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/jcmd to provide /usr/bin/jcmd (jcmd) in auto mode
update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/jdb to provide /usr/bin/jdb (jdb) in auto mode
update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/jdeprscan to provide /usr/bin/jdeprscan (jdeprscan) in auto mode
update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/jdeps to provide /usr/bin/jdeps (jdeps) in auto mode
update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/jfr to provide /usr/bin/jfr (jfr) in auto mode
update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/jimage to provide /usr/bin/jimage (jimage) in auto mode
update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/jinfo to provide /usr/bin/jinfo (jinfo) in auto mode
update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/jlink to provide /usr/bin/jlink (jlink) in auto mode
update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/jmap to provide /usr/bin/jmap (jmap) in auto mode
update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/jmod to provide /usr/bin/jmod (jmod) in auto mode
update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/jps to provide /usr/bin/jps (jps) in auto mode
update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/jrunscript to provide /usr/bin/jrunscript (jrunscript) in auto mode
update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/jshell to provide /usr/bin/jshell (jshell) in auto mode
update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/jstack to provide /usr/bin/jstack (jstack) in auto mode
update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/jstat to provide /usr/bin/jstat (jstat) in auto mode
update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/jstatd to provide /usr/bin/jstatd (jstatd) in auto mode
update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/serialver to provide /usr/bin/serialver (serialver) in auto mode
update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/jhsdb to provide /usr/bin/jhsdb (jhsdb) in auto mode
Setting up ivy (2.5.2-1) ...
Setting up ant (1.10.14-1) ...
Setting up junit4 (4.13.2-4) ...
Setting up groovy (2.4.21-10) ...
update-alternatives: using /usr/share/groovy/bin/groovy to provide /usr/bin/groovy (groovy) in auto mode
update-alternatives: using /usr/share/groovy/bin/groovyc to provide /usr/bin/groovyc (groovyc) in auto mode
update-alternatives: using /usr/share/groovy/bin/grape to provide /usr/bin/grape (grape) in auto mode
update-alternatives: using /usr/share/groovy/bin/startGroovy to provide /usr/bin/startGroovy (startGroovy) in auto mode
update-alternatives: using /usr/share/groovy/bin/groovysh to provide /usr/bin/groovysh (groovysh) in auto mode
update-alternatives: using /usr/share/groovy/bin/java2groovy to provide /usr/bin/java2groovy (java2groovy) in auto mode
update-alternatives: using /usr/share/groovy/bin/groovyConsole to provide /usr/bin/groovyConsole (groovyConsole) in auto mode
update-alternatives: using /usr/share/groovy/bin/groovydoc to provide /usr/bin/groovydoc (groovydoc) in auto mode
Setting up default-jre-headless (2:1.17-75) ...
Setting up openjdk-17-jre:armhf (17.0.11+9-1) ...
Setting up default-jre (2:1.17-75) ...
Setting up openjdk-17-jdk:armhf (17.0.11+9-1) ...
update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/jconsole to provide /usr/bin/jconsole (jconsole) in auto mode
Setting up ant-optional (1.10.14-1) ...
Setting up bnd (5.0.1-5) ...
Setting up default-jdk-headless (2:1.17-75) ...
Setting up libgradle-core-java (4.4.1-20) ...
Setting up libgradle-plugins-java (4.4.1-20) ...
Setting up gradle (4.4.1-20) ...
Setting up default-jdk (2:1.17-75) ...
Setting up gradle-debian-helper (2.4) ...
Processing triggers for ca-certificates (20240203) ...
Updating certificates in /etc/ssl/certs...
0 added, 0 removed; done.
Running hooks in /etc/ca-certificates/update.d...
done.
Processing triggers for ca-certificates-java (20240118) ...
done.
Reading package lists...
Building dependency tree...
Reading state information...
Reading extended state information...
Initializing package states...
Writing extended state information...
Building tag database...
 -> Finished parsing the build-deps
I: Building the package
I: Running cd /build/reproducible-path/milib-2.2.0+dfsg/ && env PATH="/usr/sbin:/usr/bin:/sbin:/bin:/usr/games" HOME="/nonexistent/first-build" dpkg-buildpackage -us -uc -b && env PATH="/usr/sbin:/usr/bin:/sbin:/bin:/usr/games" HOME="/nonexistent/first-build" dpkg-genchanges -S  > ../milib_2.2.0+dfsg-1_source.changes
dpkg-buildpackage: info: source package milib
dpkg-buildpackage: info: source version 2.2.0+dfsg-1
dpkg-buildpackage: info: source distribution unstable
dpkg-buildpackage: info: source changed by Pierre Gruet <pgt@debian.org>
 dpkg-source --before-build .
dpkg-buildpackage: info: host architecture armhf
 debian/rules clean
dh clean --with javahelper --with maven_repo_helper
   debian/rules override_dh_auto_clean
make[1]: Entering directory '/build/reproducible-path/milib-2.2.0+dfsg'
dh_auto_clean
# Clearing the build.gradle file we provide
rm build.gradle
rm: cannot remove 'build.gradle': No such file or directory
make[1]: [debian/rules:11: override_dh_auto_clean] Error 1 (ignored)
make[1]: Leaving directory '/build/reproducible-path/milib-2.2.0+dfsg'
   jh_clean
   dh_clean
 debian/rules binary
dh binary --with javahelper --with maven_repo_helper
   dh_update_autotools_config
   dh_autoreconf
   debian/rules override_dh_auto_configure
make[1]: Entering directory '/build/reproducible-path/milib-2.2.0+dfsg'
# Adding the upstream version number (without +dfsg) to the build.gradle file
# we got by patching build.gradle.kts
sed "s/\(^group.*\)/\1\nversion = '2.2.0+dfsg'/ ; s/\+dfsg[[:digit:]]*//" build.gradle.kts > build.gradle
dh_auto_configure
make[1]: Leaving directory '/build/reproducible-path/milib-2.2.0+dfsg'
   jh_linkjars
   dh_auto_build
	mkdir -p .gradle/init.d
	cp /usr/share/gradle-debian-helper/init.gradle .gradle/init.d/
	gradle --info --console plain --offline --stacktrace --no-daemon --refresh-dependencies --gradle-user-home .gradle -Duser.home=. -Duser.name=debian -Ddebian.package=milib -Dfile.encoding=UTF-8 --parallel --max-workers=5 jar
openjdk version "17.0.11" 2024-04-16
OpenJDK Runtime Environment (build 17.0.11+9-Debian-1)
OpenJDK Server VM (build 17.0.11+9-Debian-1, mixed mode, sharing)
Initialized native services in: /build/reproducible-path/milib-2.2.0+dfsg/.gradle/native
To honour the JVM settings for this build a new JVM will be forked. Please consider using the daemon: https://docs.gradle.org/4.4.1/userguide/gradle_daemon.html.
Starting process 'Gradle build daemon'. Working directory: /build/reproducible-path/milib-2.2.0+dfsg/.gradle/daemon/4.4.1 Command: /usr/lib/jvm/java-17-openjdk-armhf/bin/java --add-opens java.base/java.lang=ALL-UNNAMED -Xbootclasspath/a:/usr/share/java/gradle-helper-hook.jar:/usr/share/java/maven-repo-helper.jar -Dfile.encoding=UTF-8 -Duser.country=US -Duser.language=en -Duser.variant -cp /usr/share/gradle/lib/gradle-launcher-4.4.1.jar org.gradle.launcher.daemon.bootstrap.GradleDaemon 4.4.1
Successfully started process 'Gradle build daemon'
An attempt to start the daemon took 9.143 secs.
The client will now receive all logging from the daemon (pid: 15719). The daemon log file: /build/reproducible-path/milib-2.2.0+dfsg/.gradle/daemon/4.4.1/daemon-15719.out.log
Daemon will be stopped at the end of the build stopping after processing
Closing daemon's stdin at end of input.
The daemon will no longer process any standard input.
Using 5 worker leases.
Creating new cache for fileHashes, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/caches/4.4.1/fileHashes/fileHashes.bin, access org.gradle.cache.internal.DefaultCacheAccess@10fa1cb
Creating new cache for resourceHashesCache, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/caches/4.4.1/fileHashes/resourceHashesCache.bin, access org.gradle.cache.internal.DefaultCacheAccess@10fa1cb
Creating new cache for fileHashes, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/4.4.1/fileHashes/fileHashes.bin, access org.gradle.cache.internal.DefaultCacheAccess@4f5b18
Starting Build
Compiling initialization script '/build/reproducible-path/milib-2.2.0+dfsg/.gradle/init.d/init.gradle' using SubsetScriptTransformer.
Creating new cache for metadata-1.1/results, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/caches/transforms-1/metadata-1.1/results.bin, access org.gradle.cache.internal.DefaultCacheAccess@c42d94
Compiling initialization script '/build/reproducible-path/milib-2.2.0+dfsg/.gradle/init.d/init.gradle' using BuildScriptTransformer.
Settings evaluated using settings file '/build/reproducible-path/milib-2.2.0+dfsg/settings.gradle'.
	Settings file not found (/build/reproducible-path/milib-2.2.0+dfsg/settings.gradle)
	Root project name not defined in settings.gradle, defaulting to 'milib' instead of the name of the root directory 'milib-2.2.0+dfsg'
Projects loaded. Root project using build file '/build/reproducible-path/milib-2.2.0+dfsg/build.gradle'.
Included projects: [root project 'milib']
	Keep-alive timer started
	Adding Debian repository to project 'milib'
Parallel execution is an incubating feature.
Evaluating root project 'milib' using build file '/build/reproducible-path/milib-2.2.0+dfsg/build.gradle'.
Compiling build file '/build/reproducible-path/milib-2.2.0+dfsg/build.gradle' using SubsetScriptTransformer.
Compiling build file '/build/reproducible-path/milib-2.2.0+dfsg/build.gradle' using BuildScriptTransformer.
	Adding Maven pom generation to project 'milib'
	Linking the generated javadoc to the system JDK API documentation
All projects evaluated.
Selected primary task 'jar' from project :
Creating new cache for annotation-processors, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/4.4.1/fileContent/annotation-processors.bin, access org.gradle.cache.internal.DefaultCacheAccess@690555
Tasks to be executed: [task ':compileJava', task ':processResources', task ':classes', task ':debianMavenPom', task ':jar']
Creating new cache for resourceHashesCache, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/4.4.1/fileHashes/resourceHashesCache.bin, access org.gradle.cache.internal.DefaultCacheAccess@4f5b18
Creating new cache for taskHistory, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/4.4.1/taskHistory/taskHistory.bin, access org.gradle.cache.internal.DefaultCacheAccess@6f6a4f
Creating new cache for outputFiles, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/buildOutputCleanup/outputFiles.bin, access org.gradle.cache.internal.DefaultCacheAccess@451c61
:compileJava (Thread[Task worker for ':',5,main]) started.
:compileJava
Putting task artifact state for task ':compileJava' into context took 0.043 secs.
Creating new cache for metadata-2.36/module-metadata, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/caches/modules-2/metadata-2.36/module-metadata.bin, access org.gradle.cache.internal.DefaultCacheAccess@f95ca7
	Loading the Maven rules...
	Replacing org.apache.commons:commons-math3:jar:3.6.1  ->  org.apache.commons:commons-math3:jar:debian
	Replacing cc.redberry:pipe:jar:1.3.0  ->  cc.redberry:pipe:jar:1.0.0-alpha0
	Replacing com.fasterxml.jackson:jackson-bom:jar:2.14.0  ->  com.fasterxml.jackson:jackson-bom:jar:debian
	Passing through com.fasterxml.jackson:jackson-parent:jar:debian
	Passing through com.fasterxml:oss-parent:jar:debian
	Passing through com.fasterxml.jackson.core:jackson-databind:jar:2.x
	Passing through com.fasterxml.jackson:jackson-base:jar:debian
	Passing through com.fasterxml.jackson:jackson-bom:jar:debian
	Replacing org.apache.commons:commons-compress:jar:1.21  ->  org.apache.commons:commons-compress:jar:debian
	Passing through org.apache.commons:commons-parent:jar:debian
	Passing through org.apache:apache:jar:debian
	Replacing commons-io:commons-io:jar:2.11.0  ->  commons-io:commons-io:jar:debian
	Replacing org.lz4:lz4-java:jar:1.8.0  ->  org.lz4:lz4-java:jar:debian
	Replacing com.beust:jcommander:jar:1.72  ->  com.beust:jcommander:jar:debian
	Replacing net.sf.trove4j:trove4j:jar:3.0.3  ->  net.sf.trove4j:trove4j:jar:debian
	Replacing com.google.guava:guava:jar:31.1-jre  ->  com.google.guava:guava:jar:debian
	Passing through com.google.guava:guava-parent:jar:debian
	Passing through com.fasterxml.jackson.core:jackson-annotations:jar:2.x
	Passing through com.fasterxml.jackson.core:jackson-core:jar:2.x
	Passing through org.jsr-305:jsr305:jar:0.x
	Passing through com.google.errorprone:error_prone_annotations:jar:debian
	Passing through com.google.errorprone:error_prone_parent:jar:debian
Malformed jar [jackson-databind-2.x.jar] found on classpath. Gradle 5.0 will no longer allow malformed jars on a classpath.
	at org.gradle.api.internal.changedetection.state.AbstractClasspathSnapshotBuilder$JarHasher.hashMalformedZip(AbstractClasspathSnapshotBuilder.java:120)
	at org.gradle.api.internal.changedetection.state.AbstractClasspathSnapshotBuilder$JarHasher.hashJarContents(AbstractClasspathSnapshotBuilder.java:115)
	at org.gradle.api.internal.changedetection.state.AbstractClasspathSnapshotBuilder$JarHasher.hash(AbstractClasspathSnapshotBuilder.java:93)
	at org.gradle.api.internal.changedetection.state.ResourceSnapshotterCacheService.hashFile(ResourceSnapshotterCacheService.java:44)
	at org.gradle.api.internal.changedetection.state.AbstractClasspathSnapshotBuilder.visitJar(AbstractClasspathSnapshotBuilder.java:83)
	at org.gradle.api.internal.changedetection.state.AbstractClasspathSnapshotBuilder.visitFileSnapshot(AbstractClasspathSnapshotBuilder.java:76)
	at org.gradle.api.internal.changedetection.state.AbstractFileCollectionSnapshotter$FileCollectionVisitorImpl.visitCollection(AbstractFileCollectionSnapshotter.java:77)
	at org.gradle.api.internal.file.AbstractFileCollection.visitRootElements(AbstractFileCollection.java:234)
	at org.gradle.api.internal.file.CompositeFileCollection.visitRootElements(CompositeFileCollection.java:185)
	at org.gradle.api.internal.changedetection.state.AbstractFileCollectionSnapshotter.snapshot(AbstractFileCollectionSnapshotter.java:53)
	at org.gradle.api.internal.changedetection.state.DefaultCompileClasspathSnapshotter.snapshot(DefaultCompileClasspathSnapshotter.java:38)
	at org.gradle.api.internal.changedetection.state.CacheBackedTaskHistoryRepository.snapshotTaskFiles(CacheBackedTaskHistoryRepository.java:331)
	at org.gradle.api.internal.changedetection.state.CacheBackedTaskHistoryRepository.createExecution(CacheBackedTaskHistoryRepository.java:154)
	at org.gradle.api.internal.changedetection.state.CacheBackedTaskHistoryRepository.access$100(CacheBackedTaskHistoryRepository.java:61)
	at org.gradle.api.internal.changedetection.state.CacheBackedTaskHistoryRepository$1.getCurrentExecution(CacheBackedTaskHistoryRepository.java:114)
	at org.gradle.api.internal.changedetection.changes.DefaultTaskArtifactStateRepository$TaskArtifactStateImpl.getStates(DefaultTaskArtifactStateRepository.java:201)
	at org.gradle.api.internal.changedetection.changes.DefaultTaskArtifactStateRepository$TaskArtifactStateImpl.isUpToDate(DefaultTaskArtifactStateRepository.java:86)
	at org.gradle.api.internal.tasks.execution.SkipUpToDateTaskExecuter.execute(SkipUpToDateTaskExecuter.java:53)
	at org.gradle.api.internal.tasks.execution.ResolveTaskOutputCachingStateExecuter.execute(ResolveTaskOutputCachingStateExecuter.java:54)
	at org.gradle.api.internal.tasks.execution.ValidatingTaskExecuter.execute(ValidatingTaskExecuter.java:60)
	at org.gradle.api.internal.tasks.execution.SkipEmptySourceFilesTaskExecuter.execute(SkipEmptySourceFilesTaskExecuter.java:97)
	at org.gradle.api.internal.tasks.execution.CleanupStaleOutputsExecuter.execute(CleanupStaleOutputsExecuter.java:87)
	at org.gradle.api.internal.tasks.execution.ResolveTaskArtifactStateTaskExecuter.execute(ResolveTaskArtifactStateTaskExecuter.java:52)
	at org.gradle.api.internal.tasks.execution.SkipTaskWithNoActionsExecuter.execute(SkipTaskWithNoActionsExecuter.java:52)
	at org.gradle.api.internal.tasks.execution.SkipOnlyIfTaskExecuter.execute(SkipOnlyIfTaskExecuter.java:54)
	at org.gradle.api.internal.tasks.execution.ExecuteAtMostOnceTaskExecuter.execute(ExecuteAtMostOnceTaskExecuter.java:43)
	at org.gradle.api.internal.tasks.execution.CatchExceptionTaskExecuter.execute(CatchExceptionTaskExecuter.java:34)
	at org.gradle.execution.taskgraph.DefaultTaskGraphExecuter$EventFiringTaskWorker$1.run(DefaultTaskGraphExecuter.java:248)
	at org.gradle.internal.progress.DefaultBuildOperationExecutor$RunnableBuildOperationWorker.execute(DefaultBuildOperationExecutor.java:336)
	at org.gradle.internal.progress.DefaultBuildOperationExecutor$RunnableBuildOperationWorker.execute(DefaultBuildOperationExecutor.java:328)
	at org.gradle.internal.progress.DefaultBuildOperationExecutor.execute(DefaultBuildOperationExecutor.java:199)
	at org.gradle.internal.progress.DefaultBuildOperationExecutor.run(DefaultBuildOperationExecutor.java:110)
	at org.gradle.execution.taskgraph.DefaultTaskGraphExecuter$EventFiringTaskWorker.execute(DefaultTaskGraphExecuter.java:241)
	at org.gradle.execution.taskgraph.DefaultTaskGraphExecuter$EventFiringTaskWorker.execute(DefaultTaskGraphExecuter.java:230)
	at org.gradle.execution.taskgraph.DefaultTaskPlanExecutor$TaskExecutorWorker.processTask(DefaultTaskPlanExecutor.java:123)
	at org.gradle.execution.taskgraph.DefaultTaskPlanExecutor$TaskExecutorWorker.access$200(DefaultTaskPlanExecutor.java:79)
	at org.gradle.execution.taskgraph.DefaultTaskPlanExecutor$TaskExecutorWorker$1.execute(DefaultTaskPlanExecutor.java:104)
	at org.gradle.execution.taskgraph.DefaultTaskPlanExecutor$TaskExecutorWorker$1.execute(DefaultTaskPlanExecutor.java:98)
	at org.gradle.execution.taskgraph.DefaultTaskExecutionPlan.execute(DefaultTaskExecutionPlan.java:626)
	at org.gradle.execution.taskgraph.DefaultTaskExecutionPlan.executeWithTask(DefaultTaskExecutionPlan.java:581)
	at org.gradle.execution.taskgraph.DefaultTaskPlanExecutor$TaskExecutorWorker.run(DefaultTaskPlanExecutor.java:98)
	at org.gradle.internal.concurrent.ExecutorPolicy$CatchAndRecordFailures.onExecute(ExecutorPolicy.java:63)
	at org.gradle.internal.concurrent.ManagedExecutorImpl$1.run(ManagedExecutorImpl.java:46)
	at java.base/java.util.concurrent.ThreadPoolExecutor.runWorker(ThreadPoolExecutor.java:1136)
	at java.base/java.util.concurrent.ThreadPoolExecutor$Worker.run(ThreadPoolExecutor.java:635)
	at org.gradle.internal.concurrent.ThreadFactoryImpl$ManagedThreadRunnable.run(ThreadFactoryImpl.java:55)
	at java.base/java.lang.Thread.run(Thread.java:840)
Up-to-date check for task ':compileJava' took 39.355 secs. It is not up-to-date because:
  No history is available.
All input files are considered out-of-date for incremental task ':compileJava'.
Compiling with JDK Java compiler API.
Note: Some input files use or override a deprecated API.
Note: Recompile with -Xlint:deprecation for details.
Note: Some input files use unchecked or unsafe operations.
Note: Recompile with -Xlint:unchecked for details.
:compileJava (Thread[Task worker for ':',5,main]) completed. Took 2 mins 37.299 secs.
:processResources (Thread[Task worker for ':',5,main]) started.
:processResources
Putting task artifact state for task ':processResources' into context took 0.0 secs.
Up-to-date check for task ':processResources' took 0.127 secs. It is not up-to-date because:
  No history is available.
:processResources (Thread[Task worker for ':',5,main]) completed. Took 0.38 secs.
:classes (Thread[Task worker for ':',5,main]) started.
:classes
Skipping task ':classes' as it has no actions.
:classes (Thread[Task worker for ':',5,main]) completed. Took 0.007 secs.
:debianMavenPom (Thread[Task worker for ':',5,main]) started.
:debianMavenPom
Putting task artifact state for task ':debianMavenPom' into context took 0.0 secs.
Up-to-date check for task ':debianMavenPom' took 0.01 secs. It is not up-to-date because:
  No history is available.
	Generating pom file /build/reproducible-path/milib-2.2.0+dfsg/build/debian/milib.pom
:debianMavenPom (Thread[Task worker for ':',5,main]) completed. Took 0.638 secs.
:jar (Thread[Task worker for ':',5,main]) started.
:jar
Putting task artifact state for task ':jar' into context took 0.0 secs.
Up-to-date check for task ':jar' took 0.223 secs. It is not up-to-date because:
  No history is available.
:jar (Thread[Task worker for ':',5,main]) completed. Took 2.364 secs.

BUILD SUCCESSFUL in 3m 56s
4 actionable tasks: 4 executed
   dh_auto_test
	mkdir -p .gradle/init.d
	cp /usr/share/gradle-debian-helper/init.gradle .gradle/init.d/
	gradle --info --console plain --offline --stacktrace --no-daemon --refresh-dependencies --gradle-user-home .gradle -Duser.home=. -Duser.name=debian -Ddebian.package=milib -Dfile.encoding=UTF-8 --parallel --max-workers=5 test
openjdk version "17.0.11" 2024-04-16
OpenJDK Runtime Environment (build 17.0.11+9-Debian-1)
OpenJDK Server VM (build 17.0.11+9-Debian-1, mixed mode, sharing)
Initialized native services in: /build/reproducible-path/milib-2.2.0+dfsg/.gradle/native
To honour the JVM settings for this build a new JVM will be forked. Please consider using the daemon: https://docs.gradle.org/4.4.1/userguide/gradle_daemon.html.
Starting process 'Gradle build daemon'. Working directory: /build/reproducible-path/milib-2.2.0+dfsg/.gradle/daemon/4.4.1 Command: /usr/lib/jvm/java-17-openjdk-armhf/bin/java --add-opens java.base/java.lang=ALL-UNNAMED -Xbootclasspath/a:/usr/share/java/gradle-helper-hook.jar:/usr/share/java/maven-repo-helper.jar -Dfile.encoding=UTF-8 -Duser.country=US -Duser.language=en -Duser.variant -cp /usr/share/gradle/lib/gradle-launcher-4.4.1.jar org.gradle.launcher.daemon.bootstrap.GradleDaemon 4.4.1
Successfully started process 'Gradle build daemon'
An attempt to start the daemon took 8.333 secs.
The client will now receive all logging from the daemon (pid: 22174). The daemon log file: /build/reproducible-path/milib-2.2.0+dfsg/.gradle/daemon/4.4.1/daemon-22174.out.log
Daemon will be stopped at the end of the build stopping after processing
Closing daemon's stdin at end of input.
The daemon will no longer process any standard input.
Using 5 worker leases.
Creating new cache for fileHashes, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/caches/4.4.1/fileHashes/fileHashes.bin, access org.gradle.cache.internal.DefaultCacheAccess@15e5a47
Creating new cache for resourceHashesCache, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/caches/4.4.1/fileHashes/resourceHashesCache.bin, access org.gradle.cache.internal.DefaultCacheAccess@15e5a47
Creating new cache for fileHashes, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/4.4.1/fileHashes/fileHashes.bin, access org.gradle.cache.internal.DefaultCacheAccess@38a3d1
Starting Build
Creating new cache for metadata-1.1/results, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/caches/transforms-1/metadata-1.1/results.bin, access org.gradle.cache.internal.DefaultCacheAccess@cbc92e
Settings evaluated using settings file '/build/reproducible-path/milib-2.2.0+dfsg/settings.gradle'.
	Settings file not found (/build/reproducible-path/milib-2.2.0+dfsg/settings.gradle)
	Root project name not defined in settings.gradle, defaulting to 'milib' instead of the name of the root directory 'milib-2.2.0+dfsg'
Projects loaded. Root project using build file '/build/reproducible-path/milib-2.2.0+dfsg/build.gradle'.
Included projects: [root project 'milib']
	Keep-alive timer started
	Adding Debian repository to project 'milib'
Parallel execution is an incubating feature.
Evaluating root project 'milib' using build file '/build/reproducible-path/milib-2.2.0+dfsg/build.gradle'.
	Adding Maven pom generation to project 'milib'
	Linking the generated javadoc to the system JDK API documentation
All projects evaluated.
Selected primary task 'test' from project :
Creating new cache for annotation-processors, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/4.4.1/fileContent/annotation-processors.bin, access org.gradle.cache.internal.DefaultCacheAccess@1596257
Tasks to be executed: [task ':compileJava', task ':processResources', task ':classes', task ':compileTestJava', task ':processTestResources', task ':testClasses', task ':test']
Creating new cache for resourceHashesCache, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/4.4.1/fileHashes/resourceHashesCache.bin, access org.gradle.cache.internal.DefaultCacheAccess@38a3d1
Creating new cache for taskHistory, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/4.4.1/taskHistory/taskHistory.bin, access org.gradle.cache.internal.DefaultCacheAccess@750b4e
Creating new cache for outputFiles, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/buildOutputCleanup/outputFiles.bin, access org.gradle.cache.internal.DefaultCacheAccess@12ba3df
:compileJava (Thread[Task worker for ':',5,main]) started.
:compileJava
Putting task artifact state for task ':compileJava' into context took 0.043 secs.
Creating new cache for metadata-2.36/module-metadata, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/caches/modules-2/metadata-2.36/module-metadata.bin, access org.gradle.cache.internal.DefaultCacheAccess@17d0a6a
	Loading the Maven rules...
	Replacing org.apache.commons:commons-math3:jar:3.6.1  ->  org.apache.commons:commons-math3:jar:debian
	Replacing cc.redberry:pipe:jar:1.3.0  ->  cc.redberry:pipe:jar:1.0.0-alpha0
	Replacing com.fasterxml.jackson:jackson-bom:jar:2.14.0  ->  com.fasterxml.jackson:jackson-bom:jar:debian
	Passing through com.fasterxml.jackson:jackson-parent:jar:debian
	Passing through com.fasterxml:oss-parent:jar:debian
	Passing through com.fasterxml.jackson.core:jackson-databind:jar:2.x
	Passing through com.fasterxml.jackson:jackson-base:jar:debian
	Passing through com.fasterxml.jackson:jackson-bom:jar:debian
	Replacing org.apache.commons:commons-compress:jar:1.21  ->  org.apache.commons:commons-compress:jar:debian
	Passing through org.apache.commons:commons-parent:jar:debian
	Passing through org.apache:apache:jar:debian
	Replacing commons-io:commons-io:jar:2.11.0  ->  commons-io:commons-io:jar:debian
	Replacing org.lz4:lz4-java:jar:1.8.0  ->  org.lz4:lz4-java:jar:debian
	Replacing com.beust:jcommander:jar:1.72  ->  com.beust:jcommander:jar:debian
	Replacing net.sf.trove4j:trove4j:jar:3.0.3  ->  net.sf.trove4j:trove4j:jar:debian
	Replacing com.google.guava:guava:jar:31.1-jre  ->  com.google.guava:guava:jar:debian
	Passing through com.google.guava:guava-parent:jar:debian
	Passing through com.fasterxml.jackson.core:jackson-annotations:jar:2.x
	Passing through com.fasterxml.jackson.core:jackson-core:jar:2.x
	Passing through org.jsr-305:jsr305:jar:0.x
	Passing through com.google.errorprone:error_prone_annotations:jar:debian
	Passing through com.google.errorprone:error_prone_parent:jar:debian
Skipping task ':compileJava' as it is up-to-date (took 9.249 secs).
:compileJava UP-TO-DATE
:compileJava (Thread[Task worker for ':',5,main]) completed. Took 9.544 secs.
:processResources (Thread[Task worker for ':',5,main]) started.
:processResources
Putting task artifact state for task ':processResources' into context took 0.0 secs.
Skipping task ':processResources' as it is up-to-date (took 0.115 secs).
:processResources UP-TO-DATE
:processResources (Thread[Task worker for ':',5,main]) completed. Took 0.148 secs.
:classes (Thread[Task worker for ':',5,main]) started.
:classes
Skipping task ':classes' as it has no actions.
:classes UP-TO-DATE
:classes (Thread[Task worker for ':',5,main]) completed. Took 0.009 secs.
:compileTestJava (Thread[Task worker for ':',5,main]) started.
:compileTestJava
Putting task artifact state for task ':compileTestJava' into context took 0.0 secs.
	Replacing junit:junit:jar:4.13.2  ->  junit:junit:jar:4.x
	Replacing org.mockito:mockito-all:jar:1.10.19  ->  org.mockito:mockito-all:jar:debian
org.mockito:mockito-all:debian is relocated to org.mockito:mockito-core:debian. Please update your dependencies.
	Passing through org.hamcrest:hamcrest:jar:debian
	Passing through org.mockito:mockito-core:jar:debian
	Passing through net.bytebuddy:byte-buddy:jar:debian
	Passing through net.bytebuddy:byte-buddy-parent:jar:debian
	Passing through net.bytebuddy:byte-buddy-agent:jar:debian
	Passing through org.objenesis:objenesis:jar:debian
	Passing through org.objenesis:objenesis-parent:jar:debian
	Passing through net.bytebuddy:byte-buddy-dep:jar:debian
	Passing through org.ow2.asm:asm:jar:debian
	Passing through org.ow2.asm:asm-commons:jar:debian
Up-to-date check for task ':compileTestJava' took 32.504 secs. It is not up-to-date because:
  No history is available.
All input files are considered out-of-date for incremental task ':compileTestJava'.
Compiling with JDK Java compiler API.
Note: Some input files use or override a deprecated API.
Note: Recompile with -Xlint:deprecation for details.
Note: Some input files use unchecked or unsafe operations.
Note: Recompile with -Xlint:unchecked for details.
:compileTestJava (Thread[Task worker for ':',5,main]) completed. Took 1 mins 19.656 secs.
:processTestResources (Thread[Task worker for ':',5,main]) started.
:processTestResources
Putting task artifact state for task ':processTestResources' into context took 0.0 secs.
Up-to-date check for task ':processTestResources' took 0.172 secs. It is not up-to-date because:
  No history is available.
:processTestResources (Thread[Task worker for ':',5,main]) completed. Took 0.432 secs.
:testClasses (Thread[Task worker for ':',5,main]) started.
:testClasses
Skipping task ':testClasses' as it has no actions.
:testClasses (Thread[Task worker for ':',5,main]) completed. Took 0.006 secs.
:test (Thread[Task worker for ':',5,main]) started.
:test
Putting task artifact state for task ':test' into context took 0.0 secs.
Up-to-date check for task ':test' took 7.541 secs. It is not up-to-date because:
  No history is available.
Starting process 'Gradle Test Executor 1'. Working directory: /build/reproducible-path/milib-2.2.0+dfsg Command: /usr/lib/jvm/java-17-openjdk-armhf/bin/java -Dorg.gradle.native=false @/tmp/gradle-worker-classpath14842924770810497216txt -Xms1024m -Xmx2048m -Dfile.encoding=UTF-8 -Duser.country=US -Duser.language=en -Duser.variant -ea worker.org.gradle.process.internal.worker.GradleWorkerMain 'Gradle Test Executor 1'
Successfully started process 'Gradle Test Executor 1'
Gradle Test Executor 1 started executing tests.

com.milaboratory.primitivio.blocks.PrimitivOBlocksTest > benchmark1 SKIPPED

com.milaboratory.primitivio.blocks.PrimitivOBlocksTest > test1 STANDARD_OUT
    Pending / IO / Serde: 1 / 0 / 3
    Pending / IO / Serde: 1 / 0 / 3

    ==================
    High compression: false
    Concurrency: 4
    File size: 6799510
    Write time: 3.96s

    O. Stats:
    Wall clock time: 3.98s
    Total CPU time: 8.72s
    User wait time: 3.28s
    Serialization time: 7.17s (82.24%)
    Checksum calculation time: 954.87ms (10.95%)
    Compression time: 487.76ms (5.59%)
    Total IO delay: 411.21ms
    Concurrency overhead: 282.18ms
    Uncompressed size: 18.44MiB (~2.08KiB per object)
    Output size: 6.48MiB (~748B per object; compression = 35.17%)
    IO speed: 15.78MiB/s
    Concurrency adjusted uncompressed speed: 7.19MiB/s
    Actual uncompressed speed: 4.64MiB/s
    Actual speed: 1.63MiB/s
    Objects: 9079
    Average object size uncompressed: 2.08KiB
    Average object size compressed: 748B
    Blocks: 62 (~107.1KiB each)
    Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0
    Pending / IO / Serde: 0 / 0 / 0
    Pending / IO / Serde: 0 / 0 / 0

    I. Stats 1:
    Wall clock time: 2.33s
    Total CPU time: 3.7s
    Serialization time: 2.85s (77.03%)
    Checksum calculation time: 260.27ms (7.03%)
    Compression time: 577.28ms (15.58%)
    Total IO delay: 224.41ms
    Input size: 6.48MiB
    Decompressed size: 18.44MiB (compression = 35.17%)
    IO speed: 28.95MiB/s
    Concurrency adjusted uncompressed speed: 18.77MiB/s
    Actual uncompressed speed: 7.9MiB/s
    Actual speed: 2.78MiB/s
    Objects: 9079
    Average object size uncompressed: 2.08KiB
    Average object size compressed: 748B
    Blocks: 62 (~107.1KiB each)
    Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0
    Pending / IO / Serde: 0 / 0 / 0

    I. Stats 2:
    Wall clock time: 3.91s
    Total CPU time: 5.14s
    Serialization time: 3.48s (67.61%)
    Checksum calculation time: 543.12ms (10.56%)
    Compression time: 1.1s (21.3%)
    Total IO delay: 465.73ms
    Input size: 12.97MiB
    Decompressed size: 36.87MiB (compression = 35.17%)
    IO speed: 27.89MiB/s
    Concurrency adjusted uncompressed speed: 26.32MiB/s
    Actual uncompressed speed: 9.44MiB/s
    Actual speed: 3.32MiB/s
    Objects: 18158
    Average object size uncompressed: 2.08KiB
    Average object size compressed: 748B
    Blocks: 124 (~107.1KiB each)
    Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0
    Pending / IO / Serde: 0 / 0 / 0

    ==================
    High compression: false
    Concurrency: 4
    File size: 6791878
    Write time: 1.38s

    O. Stats:
    Wall clock time: 1.38s
    Total CPU time: 1.89s
    User wait time: 1.09s
    Serialization time: 1.13s (60.03%)
    Checksum calculation time: 231.53ms (12.27%)
    Compression time: 492.17ms (26.09%)
    Total IO delay: 158.52ms
    Concurrency overhead: 93.91ms
    Uncompressed size: 18.44MiB (~2.08KiB per object)
    Output size: 6.48MiB (~748B per object; compression = 35.13%)
    IO speed: 41MiB/s
    Concurrency adjusted uncompressed speed: 30.47MiB/s
    Actual uncompressed speed: 13.32MiB/s
    Actual speed: 4.68MiB/s
    Objects: 9079
    Average object size uncompressed: 2.08KiB
    Average object size compressed: 748B
    Blocks: 20 (~331.63KiB each)
    Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0

    I. Stats 1:
    Wall clock time: 1.32s
    Total CPU time: 1.7s
    Serialization time: 787.64ms (46.31%)
    Checksum calculation time: 312.25ms (18.36%)
    Compression time: 597.92ms (35.15%)
    Total IO delay: 98.65ms
    Input size: 6.48MiB
    Decompressed size: 18.44MiB (compression = 35.13%)
    IO speed: 66.09MiB/s
    Concurrency adjusted uncompressed speed: 41.06MiB/s
    Actual uncompressed speed: 13.97MiB/s
    Actual speed: 4.91MiB/s
    Objects: 9079
    Average object size uncompressed: 2.08KiB
    Average object size compressed: 748B
    Blocks: 20 (~331.63KiB each)
    Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0
    Pending / IO / Serde: 0 / 0 / 0

    I. Stats 2:
    Wall clock time: 3.08s
    Total CPU time: 3.54s
    Serialization time: 1.7s (47.94%)
    Checksum calculation time: 574.25ms (16.23%)
    Compression time: 1.25s (35.41%)
    Total IO delay: 214.11ms
    Input size: 12.95MiB
    Decompressed size: 36.87MiB (compression = 35.13%)
    IO speed: 60.53MiB/s
    Concurrency adjusted uncompressed speed: 39.31MiB/s
    Actual uncompressed speed: 11.99MiB/s
    Actual speed: 4.21MiB/s
    Objects: 18158
    Average object size uncompressed: 2.08KiB
    Average object size compressed: 748B
    Blocks: 40 (~331.63KiB each)
    Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0

    ==================
    High compression: false
    Concurrency: 1
    File size: 6799510
    Write time: 1.36s

    O. Stats:
    Wall clock time: 1.37s
    Total CPU time: 1.04s
    User wait time: 1.24s
    Serialization time: 459.6ms (44.2%)
    Checksum calculation time: 142.29ms (13.69%)
    Compression time: 371.82ms (35.76%)
    Total IO delay: 150.07ms
    Concurrency overhead: 41.47ms
    Uncompressed size: 18.44MiB (~2.08KiB per object)
    Output size: 6.48MiB (~748B per object; compression = 35.17%)
    IO speed: 43.23MiB/s
    Concurrency adjusted uncompressed speed: 14.98MiB/s
    Actual uncompressed speed: 13.48MiB/s
    Actual speed: 4.74MiB/s
    Objects: 9079
    Average object size uncompressed: 2.08KiB
    Average object size compressed: 748B
    Blocks: 62 (~107.1KiB each)
    Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0
    Checksum ok!
    Pending / IO / Serde: 2 / 1 / 0

    I. Stats 1:
    Wall clock time: 1.16s
    Total CPU time: 1.44s
    Serialization time: 603.35ms (41.94%)
    Checksum calculation time: 294.81ms (20.49%)
    Compression time: 515.78ms (35.85%)
    Total IO delay: 320.99ms
    Input size: 6.48MiB
    Decompressed size: 18.44MiB (compression = 35.17%)
    IO speed: 20.26MiB/s
    Concurrency adjusted uncompressed speed: 10.48MiB/s
    Actual uncompressed speed: 15.96MiB/s
    Actual speed: 5.61MiB/s
    Objects: 9079
    Average object size uncompressed: 2.08KiB
    Average object size compressed: 748B
    Blocks: 62 (~107.1KiB each)
    Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0
    Pending / IO / Serde: 0 / 0 / 0

    I. Stats 2:
    Wall clock time: 2.31s
    Total CPU time: 3.18s
    Serialization time: 1.37s (43.23%)
    Checksum calculation time: 589.27ms (18.55%)
    Compression time: 1.16s (36.48%)
    Total IO delay: 549.87ms
    Input size: 12.97MiB
    Decompressed size: 36.87MiB (compression = 35.17%)
    IO speed: 23.62MiB/s
    Concurrency adjusted uncompressed speed: 9.9MiB/s
    Actual uncompressed speed: 16MiB/s
    Actual speed: 5.63MiB/s
    Objects: 18158
    Average object size uncompressed: 2.08KiB
    Average object size compressed: 748B
    Blocks: 124 (~107.1KiB each)
    Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0

    ==================
    High compression: false
    Concurrency: 1
    File size: 6791878
    Write time: 1.24s

    O. Stats:
    Wall clock time: 1.25s
    Total CPU time: 962.36ms
    User wait time: 1.1s
    Serialization time: 439.25ms (45.64%)
    Checksum calculation time: 158.59ms (16.48%)
    Compression time: 318.18ms (33.06%)
    Total IO delay: 119.42ms
    Concurrency overhead: 7.75ms
    Uncompressed size: 18.44MiB (~2.08KiB per object)
    Output size: 6.48MiB (~748B per object; compression = 35.13%)
    IO speed: 54.43MiB/s
    Concurrency adjusted uncompressed speed: 16.93MiB/s
    Actual uncompressed speed: 14.79MiB/s
    Actual speed: 5.19MiB/s
    Objects: 9079
    Average object size uncompressed: 2.08KiB
    Average object size compressed: 748B
    Blocks: 20 (~331.63KiB each)
    Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0
    Checksum ok!
    Pending / IO / Serde: 0 / 0 / 0

    I. Stats 1:
    Wall clock time: 1.09s
    Total CPU time: 1.44s
    Serialization time: 543.58ms (37.71%)
    Checksum calculation time: 266.81ms (18.51%)
    Compression time: 628.08ms (43.58%)
    Total IO delay: 69.24ms
    Input size: 6.48MiB
    Decompressed size: 18.44MiB (compression = 35.13%)
    IO speed: 93.87MiB/s
    Concurrency adjusted uncompressed speed: 12.21MiB/s
    Actual uncompressed speed: 16.95MiB/s
    Actual speed: 5.95MiB/s
    Objects: 9079
    Average object size uncompressed: 2.08KiB
    Average object size compressed: 748B
    Blocks: 20 (~331.63KiB each)
    Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0
    Pending / IO / Serde: 0 / 0 / 0

    I. Stats 2:
    Wall clock time: 2.55s
    Total CPU time: 3s
    Serialization time: 1.08s (36.03%)
    Checksum calculation time: 556.96ms (18.54%)
    Compression time: 1.36s (45.22%)
    Total IO delay: 161ms
    Input size: 12.95MiB
    Decompressed size: 36.87MiB (compression = 35.13%)
    IO speed: 80.46MiB/s
    Concurrency adjusted uncompressed speed: 11.65MiB/s
    Actual uncompressed speed: 14.45MiB/s
    Actual speed: 5.08MiB/s
    Objects: 18158
    Average object size uncompressed: 2.08KiB
    Average object size compressed: 748B
    Blocks: 40 (~331.63KiB each)
    Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0
    Pending / IO / Serde: 1 / 0 / 3
    Pending / IO / Serde: 0 / 0 / 4
    Pending / IO / Serde: 1 / 0 / 3
    Pending / IO / Serde: 3 / 0 / 1
    Pending / IO / Serde: 1 / 0 / 3
    Pending / IO / Serde: 2 / 0 / 2
    Pending / IO / Serde: 0 / 0 / 4
    Pending / IO / Serde: 0 / 0 / 4
    Pending / IO / Serde: 1 / 0 / 2

    ==================
    High compression: true
    Concurrency: 4
    File size: 4156299
    Write time: 18.06s

    O. Stats:
    Wall clock time: 18.06s
    Total CPU time: 48.16s
    User wait time: 17.15s
    Serialization time: 645.89ms (1.34%)
    Checksum calculation time: 279.87ms (0.58%)
    Compression time: 47.17s (97.94%)
    Total IO delay: 229.44ms
    Concurrency overhead: 144.87ms
    Uncompressed size: 18.44MiB (~2.08KiB per object)
    Output size: 3.96MiB (~457B per object; compression = 21.5%)
    IO speed: 17.31MiB/s
    Concurrency adjusted uncompressed speed: 1.51MiB/s
    Actual uncompressed speed: 1.02MiB/s
    Actual speed: 224.73KiB/s
    Objects: 9079
    Average object size uncompressed: 2.08KiB
    Average object size compressed: 457B
    Blocks: 62 (~65.47KiB each)
    Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0

    I. Stats 1:
    Wall clock time: 703.91ms
    Total CPU time: 969.8ms
    Serialization time: 347.14ms (35.8%)
    Checksum calculation time: 249.37ms (25.71%)
    Compression time: 361.55ms (37.28%)
    Total IO delay: 220.86ms
    Input size: 3.96MiB
    Decompressed size: 18.44MiB (compression = 21.5%)
    IO speed: 18.02MiB/s
    Concurrency adjusted uncompressed speed: 62.08MiB/s
    Actual uncompressed speed: 26.23MiB/s
    Actual speed: 5.64MiB/s
    Objects: 9079
    Average object size uncompressed: 2.08KiB
    Average object size compressed: 457B
    Blocks: 62 (~65.47KiB each)
    Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0
    Pending / IO / Serde: 0 / 0 / 0

    I. Stats 2:
    Wall clock time: 1.73s
    Total CPU time: 2.11s
    Serialization time: 735.24ms (34.85%)
    Checksum calculation time: 532.6ms (25.24%)
    Compression time: 818.2ms (38.78%)
    Total IO delay: 449.48ms
    Input size: 7.93MiB
    Decompressed size: 36.87MiB (compression = 21.5%)
    IO speed: 17.66MiB/s
    Concurrency adjusted uncompressed speed: 57.71MiB/s
    Actual uncompressed speed: 21.3MiB/s
    Actual speed: 4.58MiB/s
    Objects: 18158
    Average object size uncompressed: 2.08KiB
    Average object size compressed: 457B
    Blocks: 124 (~65.47KiB each)
    Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0
    Pending / IO / Serde: 2 / 0 / 2
    Pending / IO / Serde: 2 / 0 / 2
    Pending / IO / Serde: 3 / 0 / 1
    Pending / IO / Serde: 2 / 0 / 2
    Pending / IO / Serde: 2 / 0 / 2
    Pending / IO / Serde: 2 / 0 / 2
    Pending / IO / Serde: 2 / 0 / 2
    Pending / IO / Serde: 3 / 0 / 1
    Pending / IO / Serde: 3 / 0 / 1
    Pending / IO / Serde: 3 / 0 / 1
    Pending / IO / Serde: 3 / 0 / 1

    ==================
    High compression: true
    Concurrency: 4
    File size: 4098671
    Write time: 23.46s

    O. Stats:
    Wall clock time: 23.47s
    Total CPU time: 39.1s
    User wait time: 22.05s
    Serialization time: 383.58ms (0.98%)
    Checksum calculation time: 206.99ms (0.53%)
    Compression time: 38.47s (98.39%)
    Total IO delay: 93.93ms
    Concurrency overhead: 14.4ms
    Uncompressed size: 18.44MiB (~2.08KiB per object)
    Output size: 3.91MiB (~451B per object; compression = 21.2%)
    IO speed: 42.03MiB/s
    Concurrency adjusted uncompressed speed: 1.88MiB/s
    Actual uncompressed speed: 804.41KiB/s
    Actual speed: 170.54KiB/s
    Objects: 9079
    Average object size uncompressed: 2.08KiB
    Average object size compressed: 451B
    Blocks: 20 (~200.13KiB each)
    Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0
    Pending / IO / Serde: 0 / 0 / 0

    I. Stats 1:
    Wall clock time: 608.82ms
    Total CPU time: 622.15ms
    Serialization time: 173.74ms (27.93%)
    Checksum calculation time: 153.3ms (24.64%)
    Compression time: 293.74ms (47.21%)
    Total IO delay: 42.16ms
    Input size: 3.91MiB
    Decompressed size: 18.44MiB (compression = 21.2%)
    IO speed: 93.07MiB/s
    Concurrency adjusted uncompressed speed: 111.07MiB/s
    Actual uncompressed speed: 30.32MiB/s
    Actual speed: 6.43MiB/s
    Objects: 9079
    Average object size uncompressed: 2.08KiB
    Average object size compressed: 451B
    Blocks: 20 (~200.13KiB each)
    Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0

    I. Stats 2:
    Wall clock time: 1.29s
    Total CPU time: 1.24s
    Serialization time: 341.17ms (27.52%)
    Checksum calculation time: 301.87ms (24.35%)
    Compression time: 593.66ms (47.89%)
    Total IO delay: 88.33ms
    Input size: 7.82MiB
    Decompressed size: 36.87MiB (compression = 21.2%)
    IO speed: 88.84MiB/s
    Concurrency adjusted uncompressed speed: 111.07MiB/s
    Actual uncompressed speed: 28.54MiB/s
    Actual speed: 6.05MiB/s
    Objects: 18158
    Average object size uncompressed: 2.08KiB
    Average object size compressed: 451B
    Blocks: 40 (~200.13KiB each)
    Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0
    Pending / IO / Serde: 0 / 0 / 1
    Pending / IO / Serde: 0 / 0 / 1
    Pending / IO / Serde: 0 / 0 / 1
    Pending / IO / Serde: 0 / 0 / 1
    Pending / IO / Serde: 0 / 0 / 1
    Pending / IO / Serde: 0 / 0 / 1
    Pending / IO / Serde: 0 / 0 / 1
    Pending / IO / Serde: 0 / 0 / 1
    Pending / IO / Serde: 0 / 0 / 1
    Pending / IO / Serde: 0 / 0 / 1
    Pending / IO / Serde: 0 / 0 / 1
    Pending / IO / Serde: 0 / 0 / 1

    ==================
    High compression: true
    Concurrency: 1
    File size: 4156299
    Write time: 23.97s

    O. Stats:
    Wall clock time: 23.97s
    Total CPU time: 23.77s
    User wait time: 23.89s
    Serialization time: 260.83ms (1.1%)
    Checksum calculation time: 144.97ms (0.61%)
    Compression time: 23.34s (98.22%)
    Total IO delay: 104.16ms
    Concurrency overhead: 14.41ms
    Uncompressed size: 18.44MiB (~2.08KiB per object)
    Output size: 3.96MiB (~457B per object; compression = 21.5%)
    IO speed: 38.11MiB/s
    Concurrency adjusted uncompressed speed: 790.46KiB/s
    Actual uncompressed speed: 787.63KiB/s
    Actual speed: 169.33KiB/s
    Objects: 9079
    Average object size uncompressed: 2.08KiB
    Average object size compressed: 457B
    Blocks: 62 (~65.47KiB each)
    Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0
    Checksum ok!

    I. Stats 1:
    Wall clock time: 530.61ms
    Total CPU time: 663.27ms
    Serialization time: 206.34ms (31.11%)
    Checksum calculation time: 157.86ms (23.8%)
    Compression time: 293.5ms (44.25%)
    Total IO delay: 65.77ms
    Input size: 3.96MiB
    Decompressed size: 18.44MiB (compression = 21.5%)
    IO speed: 60.98MiB/s
    Concurrency adjusted uncompressed speed: 25.29MiB/s
    Actual uncompressed speed: 34.79MiB/s
    Actual speed: 7.48MiB/s
    Objects: 9079
    Average object size uncompressed: 2.08KiB
    Average object size compressed: 457B
    Blocks: 62 (~65.47KiB each)
    Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0

    I. Stats 2:
    Wall clock time: 1.16s
    Total CPU time: 1.33s
    Serialization time: 417.85ms (31.45%)
    Checksum calculation time: 313.37ms (23.59%)
    Compression time: 581.45ms (43.77%)
    Total IO delay: 145.35ms
    Input size: 7.93MiB
    Decompressed size: 36.87MiB (compression = 21.5%)
    IO speed: 54.67MiB/s
    Concurrency adjusted uncompressed speed: 25.03MiB/s
    Actual uncompressed speed: 31.9MiB/s
    Actual speed: 6.86MiB/s
    Objects: 18158
    Average object size uncompressed: 2.08KiB
    Average object size compressed: 457B
    Blocks: 124 (~65.47KiB each)
    Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0
    Pending / IO / Serde: 0 / 0 / 1
    Pending / IO / Serde: 0 / 0 / 1
    Pending / IO / Serde: 0 / 0 / 1
    Pending / IO / Serde: 0 / 0 / 1
    Pending / IO / Serde: 0 / 0 / 1
    Pending / IO / Serde: 0 / 0 / 1
    Pending / IO / Serde: 0 / 0 / 1
    Pending / IO / Serde: 0 / 0 / 1
    Pending / IO / Serde: 0 / 0 / 1
    Pending / IO / Serde: 0 / 0 / 1
    Pending / IO / Serde: 0 / 0 / 1
    Pending / IO / Serde: 0 / 0 / 1

    ==================
    High compression: true
    Concurrency: 1
    File size: 4098671
    Write time: 24.11s

    O. Stats:
    Wall clock time: 24.12s
    Total CPU time: 23.97s
    User wait time: 24.04s
    Serialization time: 248.88ms (1.04%)
    Checksum calculation time: 125.78ms (0.52%)
    Compression time: 23.58s (98.36%)
    Total IO delay: 66.52ms
    Concurrency overhead: 4.22ms
    Uncompressed size: 18.44MiB (~2.08KiB per object)
    Output size: 3.91MiB (~451B per object; compression = 21.2%)
    IO speed: 59.22MiB/s
    Concurrency adjusted uncompressed speed: 785.23KiB/s
    Actual uncompressed speed: 782.79KiB/s
    Actual speed: 165.96KiB/s
    Objects: 9079
    Average object size uncompressed: 2.08KiB
    Average object size compressed: 451B
    Blocks: 20 (~200.13KiB each)
    Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0
    Checksum ok!

    I. Stats 1:
    Wall clock time: 536.75ms
    Total CPU time: 587.62ms
    Serialization time: 152.76ms (26%)
    Checksum calculation time: 147.2ms (25.05%)
    Compression time: 286ms (48.67%)
    Total IO delay: 36.05ms
    Input size: 3.91MiB
    Decompressed size: 18.44MiB (compression = 21.2%)
    IO speed: 108.58MiB/s
    Concurrency adjusted uncompressed speed: 29.59MiB/s
    Actual uncompressed speed: 34.4MiB/s
    Actual speed: 7.29MiB/s
    Objects: 9079
    Average object size uncompressed: 2.08KiB
    Average object size compressed: 451B
    Blocks: 20 (~200.13KiB each)
    Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0

    I. Stats 2:
    Wall clock time: 1.18s
    Total CPU time: 1.2s
    Serialization time: 313.26ms (26.01%)
    Checksum calculation time: 303.18ms (25.17%)
    Compression time: 584.55ms (48.54%)
    Total IO delay: 76.32ms
    Input size: 7.82MiB
    Decompressed size: 36.87MiB (compression = 21.2%)
    IO speed: 102.86MiB/s
    Concurrency adjusted uncompressed speed: 28.81MiB/s
    Actual uncompressed speed: 31.17MiB/s
    Actual speed: 6.61MiB/s
    Objects: 18158
    Average object size uncompressed: 2.08KiB
    Average object size compressed: 451B
    Blocks: 40 (~200.13KiB each)
    Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0

com.milaboratory.primitivio.blocks.PrimitivOBlocksTest > bigBlocks STANDARD_OUT
    Pending / IO / Serde / Objs: 0 / 0 / 1 / 0
    Pending / IO / Serde / Objs: 0 / 1 / 1 / 1000
    Pending / IO / Serde / Objs: 0 / 1 / 1 / 2000
    Pending / IO / Serde / Objs: 1 / 1 / 0 / 4000
    Pending / IO / Serde / Objs: 0 / 1 / 1 / 5000
    Pending / IO / Serde / Objs: 0 / 0 / 1 / 6000
    Pending / IO / Serde / Objs: 0 / 1 / 1 / 8000
    Pending / IO / Serde / Objs: 0 / 1 / 1 / 9000
    Pending / IO / Serde / Objs: 0 / 0 / 1 / 10000
    Pending / IO / Serde / Objs: 0 / 0 / 1 / 11000
    Pending / IO / Serde / Objs: 0 / 1 / 1 / 13000
    Pending / IO / Serde / Objs: 0 / 0 / 1 / 14000
    Pending / IO / Serde / Objs: 0 / 1 / 1 / 15000
    Pending / IO / Serde / Objs: 0 / 0 / 1 / 16000
    Pending / IO / Serde / Objs: 0 / 0 / 1 / 17000
    Pending / IO / Serde / Objs: 0 / 0 / 1 / 18000
    Pending / IO / Serde / Objs: 1 / 0 / 1 / 19000
    O. Stats:
    Wall clock time: 35.21s
    Total CPU time: 27.37s
    User wait time: 558.54us
    Serialization time: 4.75s (17.34%)
    Checksum calculation time: 14.55s (53.15%)
    Compression time: 3.5s (12.78%)
    Total IO delay: 21.61s
    Concurrency overhead: 19.56ms
    Uncompressed size: 1.86GiB (~97.66KiB per object)
    Output size: 1.86GiB (~97.66KiB per object; compression = 100%)
    IO speed: 88.27MiB/s
    Concurrency adjusted uncompressed speed: 310.56MiB/s
    Actual uncompressed speed: 54.18MiB/s
    Actual speed: 54.18MiB/s
    Objects: 20000
    Average object size uncompressed: 97.66KiB
    Average object size compressed: 97.66KiB
    Blocks: 20 (~95.37MiB each)
    Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0

com.milaboratory.util.IntCombinationsTest > test1 STANDARD_OUT
    [0, 1]
    [0, 2]
    [1, 2]

com.milaboratory.util.RemoveActionTest > test1 STANDARD_OUT
    /tmp/milib_57df84f9852ce8d7738016aec3d58fb04b3e20da3204330060324933045

com.milaboratory.util.RemoveActionTest > test2 STANDARD_OUT
    /tmp/milib_edd7a3dfb1745a2959c8b58d06aa28bee05262aa3696775241197821344.tmp

com.milaboratory.util.VersionInfoTest > test3 SKIPPED

com.milaboratory.util.ByteStringTest > testSpeed1 STANDARD_OUT
    Time per hash: 1.22us
    Addition to hash set (per operation): 3.28us
    Hash set removal (per operation): 1.79us
    b

com.milaboratory.util.sorting.HashSorterTest > testSingleton STANDARD_OUT
    /tmp/milib_37dc4afa1aaa7bdebe0c9dc469030455cf21f280191412631343915194
    timeInCollate: 43.59s
    timeInCollatorInit: 30.73s
    timeAwaitingO: 12ms
    timeAwaitingI: 5.23s
    timeInFinalSorting1: 0ns
    timeInFinalSorting2: 125.2ms
    timeInFinalSorting3: 493.32ms
    /2S (5|27|32):  objs=50000 size=3.19MiB

com.milaboratory.util.sorting.HashSorterTest > test1 STANDARD_OUT
    /tmp/milib_8bec0268d50e8ce28174ef31ccc3b192783bd44c18018545032853239805
    timeInCollate: 1.71m
    timeInCollatorInit: 5.17s
    timeAwaitingO: 5.72s
    timeAwaitingI: 23.8s
    timeInFinalSorting1: 17.19s
    timeInFinalSorting2: 13.96s
    timeInFinalSorting3: 5.42s
    /0N (5|27|32):  objs=158058 size=9.01MiB
    /1N (5|27|32):  objs=156232 size=8.71MiB
    /2N (5|27|32):  objs=155067 size=9.1MiB
    /3N (5|27|32):  objs=150140 size=8.02MiB
    /4N (5|27|32):  objs=153080 size=8.45MiB
    /5N (5|27|32):  objs=163008 size=9.36MiB
    /6N (5|27|32):  objs=153357 size=8.45MiB
    /7N (5|27|32):  objs=158403 size=8.95MiB
    /8N (5|27|32):  objs=156553 size=8.85MiB
    /9N (5|27|32):  objs=153207 size=8.68MiB
    /10N (5|27|32):  objs=153978 size=8.62MiB
    /11N (5|27|32):  objs=157249 size=8.89MiB
    /12N (5|27|32):  objs=159224 size=8.96MiB
    /13N (5|27|32):  objs=145947 size=8.17MiB
    /14N (5|27|32):  objs=156943 size=8.73MiB
    /15N (5|27|32):  objs=155990 size=8.86MiB
    /16N (5|27|32):  objs=158455 size=8.95MiB
    /17N (5|27|32):  objs=159771 size=8.96MiB
    /18N (5|27|32):  objs=166828 size=9.48MiB
    /19N (5|27|32):  objs=160002 size=8.79MiB
    /20N (5|27|32):  objs=161075 size=9.14MiB
    /21N (5|27|32):  objs=150001 size=8.29MiB
    /22N (5|27|32):  objs=159313 size=8.77MiB
    /23N (5|27|32):  objs=159191 size=8.91MiB
    /24N (5|27|32):  objs=149906 size=8.37MiB
    /25N (5|27|32):  objs=160684 size=9.11MiB
    /26N (5|27|32):  objs=161869 size=9.18MiB
    /27N (5|27|32):  objs=151661 size=8.52MiB
    /28N (5|27|32):  objs=150018 size=8.29MiB
    /29N (5|27|32):  objs=148303 size=8.16MiB
    /30N (5|27|32):  objs=155210 size=8.8MiB
    /31N (5|27|32):  objs=161277 size=9.32MiB
    /0/0N (2|25|36):  objs=39853 size=942.7KiB
    /0/1N (2|25|36):  objs=42100 size=1.02MiB
    /0/2N (2|25|36):  objs=27599 size=404.9KiB
    /0/3S (2|25|36):  objs=160 size=127B
    /0/4N (2|25|36):  objs=2612 size=10.76KiB
    /0/5S (2|25|36):  objs=141 size=231B
    /0/6N (2|25|36):  objs=1506 size=6.13KiB
    /0/7S (2|25|36):  objs=152 size=210B
    /0/9S (2|25|36):  objs=129 size=293B
    /0/10N (2|25|36):  objs=2328 size=10.16KiB
    /0/11N (2|25|36):  objs=8964 size=48.78KiB
    /0/12S (2|25|36):  objs=142 size=104B
    /0/13N (2|25|36):  objs=3831 size=16.73KiB
    /0/14S (2|25|36):  objs=158 size=155B
    /0/15N (2|25|36):  objs=2224 size=9.39KiB
    /0/16S (2|25|36):  objs=154 size=115B
    /0/18S (2|25|36):  objs=159 size=121B
    /0/19N (2|25|36):  objs=4287 size=19.7KiB
    /0/20S (2|25|36):  objs=136 size=184B
    /0/21N (2|25|36):  objs=1709 size=6.96KiB
    /0/22S (2|25|36):  objs=169 size=225B
    /0/23N (2|25|36):  objs=312 size=842B
    /0/24S (2|25|36):  objs=176 size=274B
    /0/25N (2|25|36):  objs=5939 size=26.04KiB
    /0/26S (2|25|36):  objs=138 size=106B
    /0/27N (2|25|36):  objs=3227 size=13.69KiB
    /0/28S (2|25|36):  objs=150 size=324B
    /0/29N (2|25|36):  objs=1878 size=7.61KiB
    /0/30S (2|25|36):  objs=169 size=130B
    /0/31N (2|25|36):  objs=5198 size=24.17KiB
    /0/32S (2|25|36):  objs=158 size=126B
    /0/33N (2|25|36):  objs=1085 size=4.12KiB
    /0/34S (2|25|36):  objs=166 size=94B
    /0/35N (2|25|36):  objs=949 size=3.61KiB
    /1/0N (2|25|36):  objs=39501 size=842.6KiB
    /1/1N (2|25|36):  objs=37629 size=752.03KiB
    /1/2N (2|25|36):  objs=40807 size=1.01MiB
    /1/3N (2|25|36):  objs=11701 size=65.76KiB
    /1/4S (2|25|36):  objs=169 size=105B
    /1/5N (2|25|36):  objs=1631 size=6.51KiB
    /1/6S (2|25|36):  objs=144 size=326B
    /1/7N (2|25|36):  objs=1851 size=7.51KiB
    /1/8S (2|25|36):  objs=150 size=302B
    /1/9N (2|25|36):  objs=1051 size=4.06KiB
    /1/10S (2|25|36):  objs=151 size=269B
    /1/11N (2|25|36):  objs=1878 size=7.71KiB
    /1/12S (2|25|36):  objs=157 size=300B
    /1/13N (2|25|36):  objs=1968 size=8.27KiB
    /1/14S (2|25|36):  objs=168 size=164B
    /1/15N (2|25|36):  objs=558 size=2.04KiB
    /1/16S (2|25|36):  objs=129 size=146B
    /1/17N (2|25|36):  objs=626 size=2.28KiB
    /1/18S (2|25|36):  objs=147 size=300B
    /1/20S (2|25|36):  objs=128 size=316B
    /1/21N (2|25|36):  objs=6203 size=27.76KiB
    /1/22S (2|25|36):  objs=148 size=267B
    /1/23N (2|25|36):  objs=942 size=3.64KiB
    /1/24S (2|25|36):  objs=151 size=91B
    /1/25S (2|25|36):  objs=131 size=235B
    /1/26S (2|25|36):  objs=133 size=300B
    /1/27S (2|25|36):  objs=154 size=260B
    /1/28S (2|25|36):  objs=152 size=278B
    /1/29N (2|25|36):  objs=918 size=3.69KiB
    /1/30S (2|25|36):  objs=153 size=123B
    /1/31N (2|25|36):  objs=3163 size=13.58KiB
    /1/32S (2|25|36):  objs=166 size=311B
    /1/33N (2|25|36):  objs=2207 size=9.12KiB
    /1/34S (2|25|36):  objs=136 size=314B
    /1/35N (2|25|36):  objs=931 size=3.54KiB
    /2/0N (2|25|36):  objs=36095 size=762.63KiB
    /2/1N (2|25|36):  objs=43379 size=1.07MiB
    /2/2N (2|25|36):  objs=35857 size=728.27KiB
    /2/3N (2|25|36):  objs=12704 size=99.09KiB
    /2/4S (2|25|36):  objs=159 size=141B
    /2/5N (2|25|36):  objs=5481 size=30.27KiB
    /2/6S (2|25|36):  objs=162 size=263B
    /2/7N (2|25|36):  objs=339 size=1.03KiB
    /2/8S (2|25|36):  objs=157 size=88B
    /2/9N (2|25|36):  objs=1170 size=4.87KiB
    /2/10S (2|25|36):  objs=136 size=213B
    /2/12S (2|25|36):  objs=122 size=273B
    /2/13S (2|25|36):  objs=153 size=136B
    /2/14S (2|25|36):  objs=140 size=128B
    /2/15N (2|25|36):  objs=1828 size=7.76KiB
    /2/16S (2|25|36):  objs=130 size=237B
    /2/17N (2|25|36):  objs=2680 size=11.2KiB
    /2/18S (2|25|36):  objs=137 size=320B
    /2/19N (2|25|36):  objs=473 size=1.57KiB
    /2/20S (2|25|36):  objs=142 size=141B
    /2/21N (2|25|36):  objs=2408 size=10.43KiB
    /2/22S (2|25|36):  objs=176 size=236B
    /2/23N (2|25|36):  objs=460 size=1.54KiB
    /2/24S (2|25|36):  objs=150 size=177B
    /2/25S (2|25|36):  objs=141 size=95B
    /2/26S (2|25|36):  objs=149 size=95B
    /2/27N (2|25|36):  objs=2158 size=8.99KiB
    /2/28S (2|25|36):  objs=138 size=108B
    /2/29N (2|25|36):  objs=3151 size=15.76KiB
    /2/30S (2|25|36):  objs=142 size=182B
    /2/31N (2|25|36):  objs=818 size=3.09KiB
    /2/32S (2|25|36):  objs=167 size=114B
    /2/33N (2|25|36):  objs=1070 size=4.19KiB
    /2/34S (2|25|36):  objs=143 size=259B
    /2/35N (2|25|36):  objs=2352 size=10.01KiB
    /3/0N (2|25|36):  objs=39606 size=877.59KiB
    /3/1N (2|25|36):  objs=36279 size=567.26KiB
    /3/2N (2|25|36):  objs=37394 size=664.31KiB
    /3/3S (2|25|36):  objs=164 size=146B
    /3/4S (2|25|36):  objs=163 size=141B
    /3/5N (2|25|36):  objs=1978 size=8.09KiB
    /3/6S (2|25|36):  objs=130 size=140B
    /3/7N (2|25|36):  objs=783 size=3.09KiB
    /3/8S (2|25|36):  objs=166 size=186B
    /3/9N (2|25|36):  objs=2289 size=9.68KiB
    /3/10S (2|25|36):  objs=142 size=118B
    /3/11N (2|25|36):  objs=8707 size=41.96KiB
    /3/12S (2|25|36):  objs=156 size=232B
    /3/13N (2|25|36):  objs=675 size=2.46KiB
    /3/14S (2|25|36):  objs=157 size=106B
    /3/15N (2|25|36):  objs=1042 size=3.99KiB
    /3/16S (2|25|36):  objs=145 size=303B
    /3/17N (2|25|36):  objs=635 size=2.31KiB
    /3/18S (2|25|36):  objs=148 size=208B
    /3/19N (2|25|36):  objs=2367 size=10.48KiB
    /3/20S (2|25|36):  objs=149 size=234B
    /3/21N (2|25|36):  objs=757 size=2.9KiB
    /3/22S (2|25|36):  objs=156 size=304B
    /3/23N (2|25|36):  objs=305 size=956B
    /3/24S (2|25|36):  objs=146 size=298B
    /3/25N (2|25|36):  objs=1446 size=5.98KiB
    /3/26S (2|25|36):  objs=155 size=87B
    /3/27N (2|25|36):  objs=1400 size=5.6KiB
    /3/28S (2|25|36):  objs=153 size=309B
    /3/29N (2|25|36):  objs=3885 size=17.53KiB
    /3/30S (2|25|36):  objs=162 size=148B
    /3/31N (2|25|36):  objs=1818 size=7.78KiB
    /3/32S (2|25|36):  objs=135 size=92B
    /3/33N (2|25|36):  objs=601 size=2.17KiB
    /3/34S (2|25|36):  objs=147 size=317B
    /3/35N (2|25|36):  objs=5599 size=27.12KiB
    /4/0N (2|25|36):  objs=38566 size=737.91KiB
    /4/1N (2|25|36):  objs=33987 size=559.09KiB
    /4/2N (2|25|36):  objs=37297 size=812.78KiB
    /4/3S (2|25|36):  objs=159 size=330B
    /4/4N (2|25|36):  objs=1186 size=4.85KiB
    /4/5N (2|25|36):  objs=4950 size=21.69KiB
    /4/6S (2|25|36):  objs=163 size=151B
    /4/7N (2|25|36):  objs=3843 size=18.22KiB
    /4/8S (2|25|36):  objs=133 size=164B
    /4/9S (2|25|36):  objs=165 size=181B
    /4/10S (2|25|36):  objs=177 size=256B
    /4/11N (2|25|36):  objs=763 size=2.88KiB
    /4/12S (2|25|36):  objs=158 size=169B
    /4/13N (2|25|36):  objs=3076 size=14.37KiB
    /4/14S (2|25|36):  objs=177 size=223B
    /4/15N (2|25|36):  objs=3486 size=15.33KiB
    /4/16S (2|25|36):  objs=158 size=306B
    /4/17N (2|25|36):  objs=4763 size=22.6KiB
    /4/18S (2|25|36):  objs=155 size=280B
    /4/19N (2|25|36):  objs=2019 size=8.23KiB
    /4/20S (2|25|36):  objs=142 size=143B
    /4/22S (2|25|36):  objs=145 size=216B
    /4/23N (2|25|36):  objs=5426 size=24.87KiB
    /4/24S (2|25|36):  objs=151 size=214B
    /4/25N (2|25|36):  objs=2757 size=11.57KiB
    /4/26S (2|25|36):  objs=151 size=277B
    /4/27S (2|25|36):  objs=157 size=170B
    /4/28S (2|25|36):  objs=149 size=103B
    /4/29N (2|25|36):  objs=3506 size=15.14KiB
    /4/30S (2|25|36):  objs=154 size=148B
    /4/31N (2|25|36):  objs=1535 size=6.3KiB
    /4/32S (2|25|36):  objs=121 size=289B
    /4/33S (2|25|36):  objs=148 size=236B
    /4/34S (2|25|36):  objs=158 size=141B
    /4/35N (2|25|36):  objs=2999 size=13.14KiB
    /5/0N (2|25|36):  objs=38295 size=796.15KiB
    /5/1N (2|25|36):  objs=41094 size=981.9KiB
    /5/2N (2|25|36):  objs=38682 size=741.19KiB
    /5/3S (2|25|36):  objs=154 size=92B
    /5/4N (2|25|36):  objs=2718 size=12.34KiB
    /5/5S (2|25|36):  objs=166 size=330B
    /5/6N (2|25|36):  objs=300 size=842B
    /5/7N (2|25|36):  objs=1529 size=6.12KiB
    /5/8S (2|25|36):  objs=137 size=308B
    /5/9N (2|25|36):  objs=3542 size=16.15KiB
    /5/10S (2|25|36):  objs=144 size=263B
    /5/12S (2|25|36):  objs=149 size=337B
    /5/13N (2|25|36):  objs=5400 size=25.63KiB
    /5/14S (2|25|36):  objs=158 size=203B
    /5/15S (2|25|36):  objs=144 size=277B
    /5/16S (2|25|36):  objs=142 size=188B
    /5/17N (2|25|36):  objs=2852 size=12.36KiB
    /5/18S (2|25|36):  objs=136 size=138B
    /5/19N (2|25|36):  objs=477 size=1.58KiB
    /5/20S (2|25|36):  objs=159 size=298B
    /5/21N (2|25|36):  objs=747 size=2.93KiB
    /5/22S (2|25|36):  objs=136 size=160B
    /5/23N (2|25|36):  objs=4165 size=18.89KiB
    /5/24S (2|25|36):  objs=159 size=292B
    /5/25N (2|25|36):  objs=8133 size=40.64KiB
    /5/26S (2|25|36):  objs=160 size=272B
    /5/27N (2|25|36):  objs=6757 size=33.41KiB
    /5/28S (2|25|36):  objs=148 size=301B
    /5/29N (2|25|36):  objs=769 size=3.04KiB
    /5/30S (2|25|36):  objs=157 size=269B
    /5/31N (2|25|36):  objs=2006 size=8.23KiB
    /5/32S (2|25|36):  objs=155 size=317B
    /5/33N (2|25|36):  objs=654 size=2.42KiB
    /5/34S (2|25|36):  objs=152 size=231B
    /5/35N (2|25|36):  objs=2332 size=10.61KiB
    /6/0N (2|25|36):  objs=41012 size=850.03KiB
    /6/1N (2|25|36):  objs=36067 size=806.1KiB
    /6/2N (2|25|36):  objs=40409 size=944.96KiB
    /6/3N (2|25|36):  objs=15130 size=85.3KiB
    /6/4S (2|25|36):  objs=137 size=201B
    /6/5N (2|25|36):  objs=1193 size=4.61KiB
    /6/6S (2|25|36):  objs=149 size=184B
    /6/7N (2|25|36):  objs=1589 size=6.59KiB
    /6/8S (2|25|36):  objs=164 size=161B
    /6/9N (2|25|36):  objs=2138 size=8.81KiB
    /6/10S (2|25|36):  objs=161 size=187B
    /6/11N (2|25|36):  objs=1867 size=7.77KiB
    /6/12S (2|25|36):  objs=164 size=220B
    /6/13N (2|25|36):  objs=1317 size=5.35KiB
    /6/14S (2|25|36):  objs=149 size=220B
    /6/15N (2|25|36):  objs=1999 size=8.77KiB
    /6/16S (2|25|36):  objs=162 size=162B
    /6/17N (2|25|36):  objs=870 size=3.31KiB
    /6/18S (2|25|36):  objs=155 size=220B
    /6/19N (2|25|36):  objs=1107 size=4.41KiB
    /6/20S (2|25|36):  objs=161 size=306B
    /6/22S (2|25|36):  objs=161 size=216B
    /6/24S (2|25|36):  objs=153 size=306B
    /6/25N (2|25|36):  objs=2648 size=11.33KiB
    /6/26S (2|25|36):  objs=166 size=199B
    /6/28S (2|25|36):  objs=132 size=249B
    /6/29N (2|25|36):  objs=1045 size=4.17KiB
    /6/30S (2|25|36):  objs=153 size=136B
    /6/31N (2|25|36):  objs=775 size=2.95KiB
    /6/32S (2|25|36):  objs=150 size=231B
    /6/33N (2|25|36):  objs=460 size=1.76KiB
    /6/34S (2|25|36):  objs=154 size=316B
    /6/35N (2|25|36):  objs=1260 size=4.88KiB
    /7/0N (2|25|36):  objs=37015 size=790.76KiB
    /7/1N (2|25|36):  objs=38491 size=817.43KiB
    /7/2N (2|25|36):  objs=38559 size=867.18KiB
    /7/3N (2|25|36):  objs=10638 size=60.64KiB
    /7/4S (2|25|36):  objs=152 size=94B
    /7/5N (2|25|36):  objs=1055 size=4.27KiB
    /7/6S (2|25|36):  objs=144 size=123B
    /7/7N (2|25|36):  objs=3003 size=13.38KiB
    /7/8S (2|25|36):  objs=143 size=93B
    /7/9N (2|25|36):  objs=3097 size=14.21KiB
    /7/10S (2|25|36):  objs=150 size=311B
    /7/11N (2|25|36):  objs=1758 size=7.42KiB
    /7/12S (2|25|36):  objs=147 size=109B
    /7/13N (2|25|36):  objs=1511 size=6.48KiB
    /7/14S (2|25|36):  objs=150 size=303B
    /7/16S (2|25|36):  objs=138 size=309B
    /7/17N (2|25|36):  objs=1049 size=4.24KiB
    /7/18S (2|25|36):  objs=142 size=332B
    /7/19S (2|25|36):  objs=139 size=105B
    /7/20S (2|25|36):  objs=152 size=336B
    /7/21N (2|25|36):  objs=2582 size=11.2KiB
    /7/22S (2|25|36):  objs=149 size=324B
    /7/23N (2|25|36):  objs=2174 size=9.14KiB
    /7/24S (2|25|36):  objs=152 size=235B
    /7/25N (2|25|36):  objs=2567 size=11.07KiB
    /7/26S (2|25|36):  objs=135 size=281B
    /7/27N (2|25|36):  objs=1185 size=4.87KiB
    /7/28S (2|25|36):  objs=154 size=280B
    /7/29N (2|25|36):  objs=737 size=2.8KiB
    /7/30S (2|25|36):  objs=152 size=133B
    /7/31N (2|25|36):  objs=1358 size=5.38KiB
    /7/32S (2|25|36):  objs=156 size=117B
    /7/33N (2|25|36):  objs=4821 size=22.1KiB
    /7/34S (2|25|36):  objs=146 size=155B
    /7/35N (2|25|36):  objs=4302 size=18.52KiB
    /8/0N (2|25|36):  objs=41165 size=981.22KiB
    /8/1N (2|25|36):  objs=39510 size=949.12KiB
    /8/2N (2|25|36):  objs=37698 size=723.78KiB
    /8/3S (2|25|36):  objs=141 size=112B
    /8/5N (2|25|36):  objs=3159 size=14.7KiB
    /8/6S (2|25|36):  objs=153 size=319B
    /8/7N (2|25|36):  objs=3674 size=15.88KiB
    /8/8S (2|25|36):  objs=132 size=119B
    /8/9N (2|25|36):  objs=2127 size=8.97KiB
    /8/10S (2|25|36):  objs=152 size=180B
    /8/11N (2|25|36):  objs=572 size=2.16KiB
    /8/12S (2|25|36):  objs=180 size=344B
    /8/13N (2|25|36):  objs=2079 size=8.85KiB
    /8/14S (2|25|36):  objs=183 size=224B
    /8/15N (2|25|36):  objs=926 size=3.75KiB
    /8/16S (2|25|36):  objs=177 size=337B
    /8/17N (2|25|36):  objs=1096 size=4.39KiB
    /8/18S (2|25|36):  objs=168 size=142B
    /8/19N (2|25|36):  objs=2286 size=9.31KiB
    /8/20S (2|25|36):  objs=138 size=102B
    /8/21S (2|25|36):  objs=138 size=136B
    /8/22S (2|25|36):  objs=147 size=172B
    /8/23N (2|25|36):  objs=2506 size=10.88KiB
    /8/24S (2|25|36):  objs=153 size=195B
    /8/25N (2|25|36):  objs=773 size=3KiB
    /8/26S (2|25|36):  objs=151 size=211B
    /8/27N (2|25|36):  objs=6748 size=33.72KiB
    /8/28S (2|25|36):  objs=168 size=227B
    /8/29S (2|25|36):  objs=161 size=325B
    /8/30S (2|25|36):  objs=145 size=250B
    /8/31N (2|25|36):  objs=1248 size=5.02KiB
    /8/32S (2|25|36):  objs=169 size=182B
    /8/34S (2|25|36):  objs=182 size=328B
    /8/35N (2|25|36):  objs=8148 size=45.05KiB
    /9/0N (2|25|36):  objs=41714 size=999.42KiB
    /9/1N (2|25|36):  objs=38294 size=812.99KiB
    /9/2N (2|25|36):  objs=39204 size=904.57KiB
    /9/3N (2|25|36):  objs=8703 size=42.62KiB
    /9/4S (2|25|36):  objs=121 size=242B
    /9/5S (2|25|36):  objs=173 size=146B
    /9/6S (2|25|36):  objs=155 size=184B
    /9/7N (2|25|36):  objs=3874 size=17.54KiB
    /9/8S (2|25|36):  objs=153 size=102B
    /9/9N (2|25|36):  objs=305 size=804B
    /9/10S (2|25|36):  objs=158 size=304B
    /9/11N (2|25|36):  objs=918 size=3.44KiB
    /9/12S (2|25|36):  objs=160 size=206B
    /9/13N (2|25|36):  objs=1739 size=7.3KiB
    /9/14S (2|25|36):  objs=177 size=268B
    /9/15N (2|25|36):  objs=2863 size=12.91KiB
    /9/16S (2|25|36):  objs=147 size=136B
    /9/17N (2|25|36):  objs=2122 size=8.92KiB
    /9/18S (2|25|36):  objs=150 size=259B
    /9/19N (2|25|36):  objs=727 size=2.76KiB
    /9/20S (2|25|36):  objs=159 size=348B
    /9/21N (2|25|36):  objs=732 size=2.75KiB
    /9/22S (2|25|36):  objs=153 size=229B
    /9/24S (2|25|36):  objs=182 size=143B
    /9/25N (2|25|36):  objs=2195 size=9.04KiB
    /9/26S (2|25|36):  objs=162 size=347B
    /9/27N (2|25|36):  objs=1988 size=8.25KiB
    /9/28S (2|25|36):  objs=136 size=192B
    /9/29N (2|25|36):  objs=1282 size=5.03KiB
    /9/30S (2|25|36):  objs=135 size=146B
    /9/31N (2|25|36):  objs=3589 size=18.21KiB
    /9/32S (2|25|36):  objs=173 size=313B
    /9/34S (2|25|36):  objs=167 size=233B
    /9/35N (2|25|36):  objs=297 size=874B
    /10/0N (2|25|36):  objs=37239 size=765.37KiB
    /10/1N (2|25|36):  objs=41194 size=850.12KiB
    /10/2N (2|25|36):  objs=34801 size=728.72KiB
    /10/3S (2|25|36):  objs=144 size=96B
    /10/4N (2|25|36):  objs=496 size=1.55KiB
    /10/5N (2|25|36):  objs=464 size=1.69KiB
    /10/6S (2|25|36):  objs=152 size=274B
    /10/7N (2|25|36):  objs=6832 size=30.81KiB
    /10/8S (2|25|36):  objs=163 size=253B
    /10/9N (2|25|36):  objs=3019 size=12.52KiB
    /10/10S (2|25|36):  objs=135 size=162B
    /10/11N (2|25|36):  objs=1644 size=6.65KiB
    /10/12S (2|25|36):  objs=140 size=257B
    /10/13N (2|25|36):  objs=758 size=2.97KiB
    /10/14S (2|25|36):  objs=140 size=284B
    /10/15N (2|25|36):  objs=1952 size=8.36KiB
    /10/16S (2|25|36):  objs=151 size=163B
    /10/17N (2|25|36):  objs=4016 size=18.72KiB
    /10/18S (2|25|36):  objs=157 size=303B
    /10/19N (2|25|36):  objs=634 size=2.39KiB
    /10/20S (2|25|36):  objs=173 size=130B
    /10/21N (2|25|36):  objs=5073 size=22.99KiB
    /10/22S (2|25|36):  objs=153 size=115B
    /10/23N (2|25|36):  objs=3611 size=16.69KiB
    /10/24S (2|25|36):  objs=164 size=241B
    /10/25N (2|25|36):  objs=4466 size=21.48KiB
    /10/26S (2|25|36):  objs=150 size=147B
    /10/27N (2|25|36):  objs=1040 size=4.11KiB
    /10/28S (2|25|36):  objs=156 size=300B
    /10/29N (2|25|36):  objs=872 size=3.32KiB
    /10/30S (2|25|36):  objs=128 size=310B
    /10/31N (2|25|36):  objs=290 size=779B
    /10/32S (2|25|36):  objs=150 size=96B
    /10/33N (2|25|36):  objs=1945 size=8.54KiB
    /10/34S (2|25|36):  objs=152 size=250B
    /10/35N (2|25|36):  objs=1224 size=4.92KiB
    /11/0N (2|25|36):  objs=40444 size=947.27KiB
    /11/1N (2|25|36):  objs=35242 size=665.89KiB
    /11/2N (2|25|36):  objs=41837 size=962.84KiB
    /11/3N (2|25|36):  objs=3598 size=15.84KiB
    /11/4S (2|25|36):  objs=177 size=330B
    /11/5N (2|25|36):  objs=1174 size=4.77KiB
    /11/6S (2|25|36):  objs=153 size=252B
    /11/7N (2|25|36):  objs=1209 size=4.99KiB
    /11/8S (2|25|36):  objs=155 size=330B
    /11/9N (2|25|36):  objs=1087 size=4.41KiB
    /11/10S (2|25|36):  objs=163 size=215B
    /11/11N (2|25|36):  objs=2266 size=10.2KiB
    /11/12S (2|25|36):  objs=138 size=227B
    /11/13N (2|25|36):  objs=333 size=909B
    /11/14S (2|25|36):  objs=146 size=222B
    /11/15S (2|25|36):  objs=163 size=122B
    /11/16S (2|25|36):  objs=139 size=108B
    /11/17N (2|25|36):  objs=1927 size=7.98KiB
    /11/18S (2|25|36):  objs=155 size=233B
    /11/19N (2|25|36):  objs=6457 size=30.7KiB
    /11/20S (2|25|36):  objs=167 size=100B
    /11/21N (2|25|36):  objs=7544 size=39.65KiB
    /11/22S (2|25|36):  objs=150 size=275B
    /11/23N (2|25|36):  objs=4371 size=20.23KiB
    /11/24S (2|25|36):  objs=152 size=124B
    /11/25N (2|25|36):  objs=893 size=3.39KiB
    /11/26S (2|25|36):  objs=139 size=304B
    /11/27N (2|25|36):  objs=1198 size=4.91KiB
    /11/28S (2|25|36):  objs=154 size=307B
    /11/29N (2|25|36):  objs=892 size=3.35KiB
    /11/30S (2|25|36):  objs=146 size=162B
    /11/31N (2|25|36):  objs=1908 size=8.01KiB
    /11/32S (2|25|36):  objs=172 size=324B
    /11/33N (2|25|36):  objs=2257 size=9.48KiB
    /11/34S (2|25|36):  objs=143 size=94B
    /12/0N (2|25|36):  objs=37685 size=779.29KiB
    /12/1N (2|25|36):  objs=36668 size=634.32KiB
    /12/2N (2|25|36):  objs=25313 size=318.19KiB
    /12/3S (2|25|36):  objs=165 size=152B
    /12/4N (2|25|36):  objs=10382 size=60.02KiB
    /12/5S (2|25|36):  objs=154 size=331B
    /12/7S (2|25|36):  objs=158 size=298B
    /12/8N (2|25|36):  objs=1661 size=6.79KiB
    /12/9S (2|25|36):  objs=142 size=192B
    /12/10N (2|25|36):  objs=594 size=2.11KiB
    /12/11N (2|25|36):  objs=6428 size=33.47KiB
    /12/12S (2|25|36):  objs=163 size=195B
    /12/13N (2|25|36):  objs=2494 size=10.79KiB
    /12/14S (2|25|36):  objs=159 size=251B
    /12/15N (2|25|36):  objs=2409 size=11.03KiB
    /12/16S (2|25|36):  objs=171 size=346B
    /12/17N (2|25|36):  objs=2150 size=9.33KiB
    /12/18S (2|25|36):  objs=157 size=326B
    /12/19N (2|25|36):  objs=10213 size=56.86KiB
    /12/20S (2|25|36):  objs=152 size=120B
    /12/21S (2|25|36):  objs=140 size=219B
    /12/22S (2|25|36):  objs=144 size=308B
    /12/23N (2|25|36):  objs=1635 size=7.12KiB
    /12/24S (2|25|36):  objs=149 size=251B
    /12/25N (2|25|36):  objs=4554 size=19.85KiB
    /12/26S (2|25|36):  objs=141 size=83B
    /12/27N (2|25|36):  objs=1078 size=4.25KiB
    /12/28S (2|25|36):  objs=159 size=264B
    /12/29N (2|25|36):  objs=1359 size=5.52KiB
    /12/30S (2|25|36):  objs=141 size=253B
    /12/31N (2|25|36):  objs=4173 size=18.46KiB
    /12/32S (2|25|36):  objs=148 size=340B
    /12/33N (2|25|36):  objs=2582 size=10.81KiB
    /12/34S (2|25|36):  objs=163 size=339B
    /12/35N (2|25|36):  objs=5240 size=25.99KiB
    /13/0N (2|25|36):  objs=32927 size=663.77KiB
    /13/1N (2|25|36):  objs=36813 size=669.31KiB
    /13/2N (2|25|36):  objs=39506 size=900.82KiB
    /13/3S (2|25|36):  objs=174 size=142B
    /13/4N (2|25|36):  objs=1683 size=7.22KiB
    /13/5N (2|25|36):  objs=6668 size=31.12KiB
    /13/6S (2|25|36):  objs=147 size=241B
    /13/7N (2|25|36):  objs=1084 size=4.46KiB
    /13/8S (2|25|36):  objs=143 size=275B
    /13/10S (2|25|36):  objs=165 size=130B
    /13/12S (2|25|36):  objs=147 size=238B
    /13/13N (2|25|36):  objs=8123 size=39.42KiB
    /13/14S (2|25|36):  objs=160 size=298B
    /13/16S (2|25|36):  objs=151 size=315B
    /13/17N (2|25|36):  objs=4003 size=19.78KiB
    /13/18S (2|25|36):  objs=185 size=152B
    /13/19N (2|25|36):  objs=940 size=3.59KiB
    /13/20S (2|25|36):  objs=141 size=187B
    /13/21N (2|25|36):  objs=1574 size=6.19KiB
    /13/22S (2|25|36):  objs=177 size=179B
    /13/23N (2|25|36):  objs=3680 size=16.41KiB
    /13/24S (2|25|36):  objs=176 size=246B
    /13/25N (2|25|36):  objs=610 size=2.14KiB
    /13/26S (2|25|36):  objs=141 size=308B
    /13/27S (2|25|36):  objs=148 size=278B
    /13/28S (2|25|36):  objs=137 size=257B
    /13/29N (2|25|36):  objs=807 size=3.05KiB
    /13/30S (2|25|36):  objs=163 size=96B
    /13/31N (2|25|36):  objs=1240 size=5.22KiB
    /13/32S (2|25|36):  objs=156 size=181B
    /13/33S (2|25|36):  objs=185 size=295B
    /13/34S (2|25|36):  objs=153 size=336B
    /13/35N (2|25|36):  objs=3440 size=14.69KiB
    /14/0N (2|25|36):  objs=41248 size=1021.82KiB
    /14/1N (2|25|36):  objs=39639 size=795.44KiB
    /14/2N (2|25|36):  objs=38630 size=866.2KiB
    /14/3N (2|25|36):  objs=6164 size=32.45KiB
    /14/4S (2|25|36):  objs=171 size=260B
    /14/5N (2|25|36):  objs=310 size=768B
    /14/6S (2|25|36):  objs=162 size=139B
    /14/7N (2|25|36):  objs=1047 size=4.2KiB
    /14/8S (2|25|36):  objs=152 size=233B
    /14/9N (2|25|36):  objs=1247 size=5.09KiB
    /14/10S (2|25|36):  objs=151 size=219B
    /14/11S (2|25|36):  objs=169 size=124B
    /14/12S (2|25|36):  objs=135 size=204B
    /14/13N (2|25|36):  objs=1413 size=5.73KiB
    /14/14S (2|25|36):  objs=154 size=287B
    /14/15N (2|25|36):  objs=4560 size=20.12KiB
    /14/16S (2|25|36):  objs=147 size=223B
    /14/18S (2|25|36):  objs=171 size=178B
    /14/19N (2|25|36):  objs=3593 size=17.07KiB
    /14/20S (2|25|36):  objs=149 size=161B
    /14/21N (2|25|36):  objs=4484 size=22.06KiB
    /14/22S (2|25|36):  objs=168 size=164B
    /14/23N (2|25|36):  objs=5633 size=27.32KiB
    /14/24S (2|25|36):  objs=141 size=97B
    /14/25N (2|25|36):  objs=1678 size=6.85KiB
    /14/26S (2|25|36):  objs=139 size=156B
    /14/27N (2|25|36):  objs=2084 size=8.7KiB
    /14/28S (2|25|36):  objs=152 size=176B
    /14/29N (2|25|36):  objs=1241 size=4.83KiB
    /14/30S (2|25|36):  objs=124 size=198B
    /14/31N (2|25|36):  objs=1055 size=4.4KiB
    /14/32S (2|25|36):  objs=169 size=111B
    /14/33N (2|25|36):  objs=283 size=912B
    /14/34S (2|25|36):  objs=180 size=218B
    /15/0N (2|25|36):  objs=36535 size=698.68KiB
    /15/1N (2|25|36):  objs=39815 size=863.58KiB
    /15/2N (2|25|36):  objs=28084 size=395.49KiB
    /15/3S (2|25|36):  objs=172 size=260B
    /15/4N (2|25|36):  objs=14992 size=104.67KiB
    /15/5N (2|25|36):  objs=1395 size=5.67KiB
    /15/6S (2|25|36):  objs=157 size=327B
    /15/7N (2|25|36):  objs=617 size=2.19KiB
    /15/8S (2|25|36):  objs=142 size=218B
    /15/9N (2|25|36):  objs=3655 size=16.63KiB
    /15/10S (2|25|36):  objs=158 size=241B
    /15/11N (2|25|36):  objs=1243 size=4.87KiB
    /15/12S (2|25|36):  objs=177 size=156B
    /15/13N (2|25|36):  objs=2135 size=9.1KiB
    /15/14S (2|25|36):  objs=142 size=295B
    /15/15S (2|25|36):  objs=173 size=147B
    /15/16S (2|25|36):  objs=147 size=290B
    /15/18S (2|25|36):  objs=128 size=271B
    /15/19S (2|25|36):  objs=148 size=266B
    /15/20S (2|25|36):  objs=125 size=258B
    /15/21N (2|25|36):  objs=593 size=2.14KiB
    /15/22S (2|25|36):  objs=169 size=149B
    /15/23N (2|25|36):  objs=16222 size=112.03KiB
    /15/24S (2|25|36):  objs=151 size=156B
    /15/25N (2|25|36):  objs=508 size=1.76KiB
    /15/26S (2|25|36):  objs=138 size=149B
    /15/27N (2|25|36):  objs=1405 size=5.63KiB
    /15/28S (2|25|36):  objs=147 size=318B
    /15/29N (2|25|36):  objs=894 size=3.4KiB
    /15/30S (2|25|36):  objs=147 size=87B
    /15/31N (2|25|36):  objs=4278 size=19.2KiB
    /15/32S (2|25|36):  objs=149 size=91B
    /15/33S (2|25|36):  objs=149 size=332B
    /15/34S (2|25|36):  objs=135 size=323B
    /15/35N (2|25|36):  objs=765 size=2.97KiB
    /16/0N (2|25|36):  objs=39744 size=888.52KiB
    /16/1N (2|25|36):  objs=38880 size=911.54KiB
    /16/2N (2|25|36):  objs=36637 size=708.43KiB
    /16/3S (2|25|36):  objs=131 size=271B
    /16/4N (2|25|36):  objs=1374 size=5.52KiB
    /16/5N (2|25|36):  objs=15789 size=102.5KiB
    /16/6S (2|25|36):  objs=166 size=274B
    /16/7N (2|25|36):  objs=312 size=1.04KiB
    /16/8S (2|25|36):  objs=164 size=202B
    /16/9N (2|25|36):  objs=2708 size=11.36KiB
    /16/10S (2|25|36):  objs=159 size=342B
    /16/11S (2|25|36):  objs=151 size=292B
    /16/12S (2|25|36):  objs=130 size=150B
    /16/13N (2|25|36):  objs=744 size=2.76KiB
    /16/14S (2|25|36):  objs=171 size=114B
    /16/15N (2|25|36):  objs=319 size=963B
    /16/16S (2|25|36):  objs=167 size=91B
    /16/17N (2|25|36):  objs=6387 size=31.18KiB
    /16/18S (2|25|36):  objs=143 size=196B
    /16/19S (2|25|36):  objs=172 size=348B
    /16/20S (2|25|36):  objs=130 size=99B
    /16/21N (2|25|36):  objs=465 size=1.67KiB
    /16/22S (2|25|36):  objs=147 size=154B
    /16/23N (2|25|36):  objs=1243 size=4.78KiB
    /16/24S (2|25|36):  objs=169 size=251B
    /16/25N (2|25|36):  objs=1672 size=6.92KiB
    /16/26S (2|25|36):  objs=157 size=274B
    /16/27N (2|25|36):  objs=938 size=3.55KiB
    /16/28S (2|25|36):  objs=138 size=261B
    /16/30S (2|25|36):  objs=141 size=168B
    /16/31N (2|25|36):  objs=1529 size=6.38KiB
    /16/32S (2|25|36):  objs=138 size=304B
    /16/33N (2|25|36):  objs=2086 size=8.93KiB
    /16/34S (2|25|36):  objs=141 size=181B
    /16/35N (2|25|36):  objs=4913 size=22.14KiB
    /17/0N (2|25|36):  objs=40517 size=877.07KiB
    /17/1N (2|25|36):  objs=40230 size=928.89KiB
    /17/2N (2|25|36):  objs=39002 size=857.29KiB
    /17/4S (2|25|36):  objs=148 size=194B
    /17/5N (2|25|36):  objs=2988 size=12.7KiB
    /17/6S (2|25|36):  objs=159 size=103B
    /17/7N (2|25|36):  objs=1217 size=4.87KiB
    /17/8S (2|25|36):  objs=153 size=213B
    /17/9N (2|25|36):  objs=3403 size=14.49KiB
    /17/10S (2|25|36):  objs=170 size=87B
    /17/11N (2|25|36):  objs=8266 size=41.58KiB
    /17/12S (2|25|36):  objs=155 size=246B
    /17/14S (2|25|36):  objs=165 size=231B
    /17/15N (2|25|36):  objs=1407 size=5.61KiB
    /17/16S (2|25|36):  objs=139 size=199B
    /17/17S (2|25|36):  objs=164 size=206B
    /17/18S (2|25|36):  objs=159 size=309B
    /17/19N (2|25|36):  objs=1399 size=5.64KiB
    /17/20S (2|25|36):  objs=142 size=191B
    /17/21N (2|25|36):  objs=3664 size=16.05KiB
    /17/22S (2|25|36):  objs=137 size=239B
    /17/23N (2|25|36):  objs=1212 size=4.9KiB
    /17/24S (2|25|36):  objs=158 size=255B
    /17/25N (2|25|36):  objs=3739 size=15.81KiB
    /17/26S (2|25|36):  objs=168 size=171B
    /17/27N (2|25|36):  objs=3427 size=14.92KiB
    /17/28S (2|25|36):  objs=140 size=250B
    /17/29N (2|25|36):  objs=924 size=3.72KiB
    /17/30S (2|25|36):  objs=157 size=232B
    /17/31N (2|25|36):  objs=5120 size=23.36KiB
    /17/32S (2|25|36):  objs=157 size=183B
    /17/33N (2|25|36):  objs=469 size=1.62KiB
    /17/34S (2|25|36):  objs=159 size=192B
    /17/35S (2|25|36):  objs=157 size=347B
    /18/0N (2|25|36):  objs=38886 size=972.83KiB
    /18/1N (2|25|36):  objs=44522 size=1021.76KiB
    /18/2N (2|25|36):  objs=36326 size=662.89KiB
    /18/3S (2|25|36):  objs=131 size=85B
    /18/4N (2|25|36):  objs=3345 size=15.2KiB
    /18/5S (2|25|36):  objs=151 size=188B
    /18/6N (2|25|36):  objs=2484 size=10.63KiB
    /18/7S (2|25|36):  objs=163 size=247B
    /18/8N (2|25|36):  objs=468 size=1.73KiB
    /18/9N (2|25|36):  objs=1513 size=6.28KiB
    /18/10S (2|25|36):  objs=142 size=224B
    /18/11N (2|25|36):  objs=870 size=3.31KiB
    /18/12S (2|25|36):  objs=177 size=145B
    /18/13N (2|25|36):  objs=5072 size=24.82KiB
    /18/14S (2|25|36):  objs=155 size=295B
    /18/15N (2|25|36):  objs=3319 size=15.8KiB
    /18/16S (2|25|36):  objs=161 size=100B
    /18/17N (2|25|36):  objs=296 size=838B
    /18/18S (2|25|36):  objs=160 size=176B
    /18/19N (2|25|36):  objs=577 size=1.93KiB
    /18/20S (2|25|36):  objs=146 size=270B
    /18/22S (2|25|36):  objs=141 size=180B
    /18/23N (2|25|36):  objs=2721 size=11.96KiB
    /18/24S (2|25|36):  objs=132 size=197B
    /18/25N (2|25|36):  objs=3404 size=15.85KiB
    /18/26S (2|25|36):  objs=151 size=338B
    /18/27N (2|25|36):  objs=1210 size=4.61KiB
    /18/28S (2|25|36):  objs=133 size=201B
    /18/29S (2|25|36):  objs=169 size=300B
    /18/30S (2|25|36):  objs=167 size=315B
    /18/31N (2|25|36):  objs=3885 size=16.67KiB
    /18/32S (2|25|36):  objs=148 size=131B
    /18/33N (2|25|36):  objs=11343 size=63.33KiB
    /18/34S (2|25|36):  objs=156 size=233B
    /18/35N (2|25|36):  objs=4004 size=18.04KiB
    /19/0N (2|25|36):  objs=41671 size=960.96KiB
    /19/1N (2|25|36):  objs=42636 size=989.81KiB
    /19/2N (2|25|36):  objs=29913 size=398.74KiB
    /19/3S (2|25|36):  objs=140 size=89B
    /19/4N (2|25|36):  objs=4101 size=18.21KiB
    /19/5S (2|25|36):  objs=145 size=327B
    /19/6N (2|25|36):  objs=314 size=976B
    /19/7S (2|25|36):  objs=158 size=90B
    /19/8N (2|25|36):  objs=3179 size=15.39KiB
    /19/10S (2|25|36):  objs=155 size=281B
    /19/11N (2|25|36):  objs=445 size=1.47KiB
    /19/12S (2|25|36):  objs=149 size=128B
    /19/13S (2|25|36):  objs=151 size=143B
    /19/14S (2|25|36):  objs=153 size=313B
    /19/15N (2|25|36):  objs=5280 size=26.28KiB
    /19/16S (2|25|36):  objs=148 size=151B
    /19/17N (2|25|36):  objs=5771 size=28.29KiB
    /19/18S (2|25|36):  objs=150 size=150B
    /19/19N (2|25|36):  objs=1662 size=6.96KiB
    /19/20S (2|25|36):  objs=163 size=335B
    /19/21N (2|25|36):  objs=2923 size=12.15KiB
    /19/22S (2|25|36):  objs=167 size=351B
    /19/23N (2|25|36):  objs=3352 size=14.57KiB
    /19/24S (2|25|36):  objs=154 size=163B
    /19/25N (2|25|36):  objs=2644 size=11.07KiB
    /19/26S (2|25|36):  objs=155 size=289B
    /19/27N (2|25|36):  objs=3854 size=17.67KiB
    /19/28S (2|25|36):  objs=161 size=280B
    /19/29N (2|25|36):  objs=3988 size=18.49KiB
    /19/30S (2|25|36):  objs=165 size=167B
    /19/31N (2|25|36):  objs=1580 size=6.33KiB
    /19/32S (2|25|36):  objs=149 size=324B
    /19/33N (2|25|36):  objs=1827 size=7.71KiB
    /19/34S (2|25|36):  objs=162 size=200B
    /19/35N (2|25|36):  objs=2237 size=9.35KiB
    /20/0N (2|25|36):  objs=42356 size=988.63KiB
    /20/1N (2|25|36):  objs=38863 size=880.74KiB
    /20/2N (2|25|36):  objs=40498 size=875.91KiB
    /20/3S (2|25|36):  objs=154 size=302B
    /20/4N (2|25|36):  objs=1407 size=5.71KiB
    /20/5N (2|25|36):  objs=1371 size=5.62KiB
    /20/6S (2|25|36):  objs=139 size=119B
    /20/7N (2|25|36):  objs=1784 size=7.6KiB
    /20/8S (2|25|36):  objs=160 size=132B
    /20/9N (2|25|36):  objs=273 size=733B
    /20/10S (2|25|36):  objs=152 size=305B
    /20/11N (2|25|36):  objs=1218 size=5KiB
    /20/12S (2|25|36):  objs=134 size=171B
    /20/13N (2|25|36):  objs=1739 size=7.21KiB
    /20/14S (2|25|36):  objs=142 size=164B
    /20/15N (2|25|36):  objs=7174 size=35.83KiB
    /20/16S (2|25|36):  objs=157 size=143B
    /20/17N (2|25|36):  objs=803 size=2.82KiB
    /20/18S (2|25|36):  objs=139 size=198B
    /20/19N (2|25|36):  objs=2686 size=11.55KiB
    /20/20S (2|25|36):  objs=148 size=133B
    /20/21N (2|25|36):  objs=1554 size=6.27KiB
    /20/22S (2|25|36):  objs=152 size=194B
    /20/23N (2|25|36):  objs=4312 size=18.57KiB
    /20/24S (2|25|36):  objs=180 size=246B
    /20/26S (2|25|36):  objs=141 size=235B
    /20/27N (2|25|36):  objs=3555 size=16.18KiB
    /20/28S (2|25|36):  objs=149 size=109B
    /20/29N (2|25|36):  objs=1551 size=6.5KiB
    /20/30S (2|25|36):  objs=169 size=162B
    /20/31N (2|25|36):  objs=1788 size=7.12KiB
    /20/32S (2|25|36):  objs=161 size=157B
    /20/33N (2|25|36):  objs=888 size=3.39KiB
    /20/34S (2|25|36):  objs=142 size=137B
    /20/35N (2|25|36):  objs=4836 size=22.1KiB
    /21/0N (2|25|36):  objs=37192 size=748.69KiB
    /21/1N (2|25|36):  objs=26861 size=428.65KiB
    /21/2S (2|25|36):  objs=133 size=142B
    /21/3N (2|25|36):  objs=10987 size=65.2KiB
    /21/4N (2|25|36):  objs=35465 size=730.1KiB
    /21/5N (2|25|36):  objs=6389 size=31.77KiB
    /21/6S (2|25|36):  objs=147 size=287B
    /21/7S (2|25|36):  objs=146 size=273B
    /21/8S (2|25|36):  objs=157 size=291B
    /21/9N (2|25|36):  objs=1232 size=4.89KiB
    /21/10S (2|25|36):  objs=149 size=199B
    /21/11N (2|25|36):  objs=428 size=1.46KiB
    /21/12S (2|25|36):  objs=158 size=333B
    /21/13N (2|25|36):  objs=1045 size=4.29KiB
    /21/14S (2|25|36):  objs=152 size=118B
    /21/15N (2|25|36):  objs=296 size=1.03KiB
    /21/16S (2|25|36):  objs=144 size=197B
    /21/17N (2|25|36):  objs=1079 size=4.13KiB
    /21/18S (2|25|36):  objs=139 size=245B
    /21/19N (2|25|36):  objs=7010 size=35.07KiB
    /21/20S (2|25|36):  objs=143 size=285B
    /21/21N (2|25|36):  objs=1370 size=5.23KiB
    /21/22S (2|25|36):  objs=171 size=219B
    /21/23N (2|25|36):  objs=2401 size=9.76KiB
    /21/24S (2|25|36):  objs=149 size=264B
    /21/26S (2|25|36):  objs=157 size=343B
    /21/27N (2|25|36):  objs=598 size=2.24KiB
    /21/28S (2|25|36):  objs=135 size=116B
    /21/29N (2|25|36):  objs=296 size=682B
    /21/30S (2|25|36):  objs=142 size=282B
    /21/31N (2|25|36):  objs=7734 size=39KiB
    /21/32S (2|25|36):  objs=192 size=207B
    /21/33N (2|25|36):  objs=4604 size=20.39KiB
    /21/34S (2|25|36):  objs=153 size=89B
    /21/35N (2|25|36):  objs=2447 size=9.95KiB
    /22/0N (2|25|36):  objs=38493 size=802.38KiB
    /22/1N (2|25|36):  objs=40892 size=838.36KiB
    /22/2N (2|25|36):  objs=39952 size=815.13KiB
    /22/3N (2|25|36):  objs=20269 size=189.32KiB
    /22/4S (2|25|36):  objs=163 size=276B
    /22/5N (2|25|36):  objs=4462 size=20.08KiB
    /22/6S (2|25|36):  objs=139 size=96B
    /22/7N (2|25|36):  objs=2419 size=10.63KiB
    /22/8S (2|25|36):  objs=174 size=285B
    /22/9S (2|25|36):  objs=181 size=137B
    /22/10S (2|25|36):  objs=137 size=120B
    /22/11N (2|25|36):  objs=1480 size=5.89KiB
    /22/12S (2|25|36):  objs=146 size=227B
    /22/13N (2|25|36):  objs=1882 size=8.01KiB
    /22/14S (2|25|36):  objs=166 size=218B
    /22/15N (2|25|36):  objs=721 size=2.85KiB
    /22/16S (2|25|36):  objs=152 size=166B
    /22/17N (2|25|36):  objs=324 size=973B
    /22/18S (2|25|36):  objs=153 size=181B
    /22/19S (2|25|36):  objs=125 size=92B
    /22/20S (2|25|36):  objs=176 size=250B
    /22/21N (2|25|36):  objs=636 size=2.23KiB
    /22/22S (2|25|36):  objs=144 size=228B
    /22/24S (2|25|36):  objs=151 size=307B
    /22/25S (2|25|36):  objs=163 size=291B
    /22/26S (2|25|36):  objs=173 size=89B
    /22/27N (2|25|36):  objs=498 size=1.67KiB
    /22/28S (2|25|36):  objs=171 size=197B
    /22/29N (2|25|36):  objs=961 size=3.75KiB
    /22/30S (2|25|36):  objs=166 size=331B
    /22/31N (2|25|36):  objs=1988 size=8.6KiB
    /22/32S (2|25|36):  objs=165 size=119B
    /22/33N (2|25|36):  objs=888 size=3.63KiB
    /22/34S (2|25|36):  objs=158 size=183B
    /22/35N (2|25|36):  objs=445 size=1.5KiB
    /23/0N (2|25|36):  objs=37945 size=702.71KiB
    /23/1N (2|25|36):  objs=18139 size=130.25KiB
    /23/2S (2|25|36):  objs=155 size=107B
    /23/3N (2|25|36):  objs=21703 size=181.54KiB
    /23/4N (2|25|36):  objs=28489 size=477.68KiB
    /23/5S (2|25|36):  objs=155 size=340B
    /23/6N (2|25|36):  objs=12670 size=75.58KiB
    /23/7N (2|25|36):  objs=8739 size=49.74KiB
    /23/8S (2|25|36):  objs=151 size=221B
    /23/9N (2|25|36):  objs=588 size=2.22KiB
    /23/10S (2|25|36):  objs=160 size=328B
    /23/11N (2|25|36):  objs=440 size=1.66KiB
    /23/12S (2|25|36):  objs=151 size=203B
    /23/13N (2|25|36):  objs=1799 size=8.32KiB
    /23/14S (2|25|36):  objs=138 size=318B
    /23/15N (2|25|36):  objs=2173 size=8.92KiB
    /23/16S (2|25|36):  objs=174 size=243B
    /23/17N (2|25|36):  objs=3264 size=14.78KiB
    /23/18S (2|25|36):  objs=153 size=258B
    /23/19N (2|25|36):  objs=1610 size=6.67KiB
    /23/20S (2|25|36):  objs=155 size=199B
    /23/21N (2|25|36):  objs=3780 size=18.21KiB
    /23/22S (2|25|36):  objs=144 size=108B
    /23/23N (2|25|36):  objs=1270 size=5.34KiB
    /23/24S (2|25|36):  objs=149 size=273B
    /23/25N (2|25|36):  objs=456 size=1.66KiB
    /23/26S (2|25|36):  objs=151 size=207B
    /23/27N (2|25|36):  objs=2150 size=8.87KiB
    /23/28S (2|25|36):  objs=171 size=337B
    /23/29N (2|25|36):  objs=441 size=1.42KiB
    /23/30S (2|25|36):  objs=158 size=333B
    /23/31N (2|25|36):  objs=4344 size=18.89KiB
    /23/32S (2|25|36):  objs=145 size=92B
    /23/33N (2|25|36):  objs=2736 size=11.47KiB
    /23/34S (2|25|36):  objs=159 size=299B
    /23/35N (2|25|36):  objs=3986 size=18.32KiB
    /24/0N (2|25|36):  objs=37637 size=760.08KiB
    /24/1N (2|25|36):  objs=37515 size=785.15KiB
    /24/2N (2|25|36):  objs=29501 size=498.25KiB
    /24/3S (2|25|36):  objs=171 size=191B
    /24/4N (2|25|36):  objs=6011 size=28.25KiB
    /24/6S (2|25|36):  objs=158 size=222B
    /24/7N (2|25|36):  objs=1868 size=7.46KiB
    /24/8S (2|25|36):  objs=156 size=337B
    /24/9N (2|25|36):  objs=2644 size=11.42KiB
    /24/10S (2|25|36):  objs=160 size=342B
    /24/11N (2|25|36):  objs=3383 size=14.7KiB
    /24/12S (2|25|36):  objs=165 size=186B
    /24/13N (2|25|36):  objs=286 size=840B
    /24/14S (2|25|36):  objs=152 size=258B
    /24/15N (2|25|36):  objs=1241 size=4.94KiB
    /24/16S (2|25|36):  objs=158 size=229B
    /24/17N (2|25|36):  objs=5178 size=24.72KiB
    /24/18S (2|25|36):  objs=161 size=195B
    /24/19N (2|25|36):  objs=3525 size=15.31KiB
    /24/20S (2|25|36):  objs=138 size=103B
    /24/21N (2|25|36):  objs=1685 size=7.19KiB
    /24/22S (2|25|36):  objs=136 size=116B
    /24/23N (2|25|36):  objs=2538 size=10.7KiB
    /24/24S (2|25|36):  objs=151 size=197B
    /24/25N (2|25|36):  objs=2693 size=11.56KiB
    /24/26S (2|25|36):  objs=147 size=92B
    /24/27N (2|25|36):  objs=3257 size=14.04KiB
    /24/28S (2|25|36):  objs=169 size=263B
    /24/30S (2|25|36):  objs=156 size=316B
    /24/31N (2|25|36):  objs=3358 size=13.86KiB
    /24/32S (2|25|36):  objs=149 size=275B
    /24/33N (2|25|36):  objs=1802 size=7.72KiB
    /24/34S (2|25|36):  objs=148 size=199B
    /24/35N (2|25|36):  objs=3309 size=13.97KiB
    /25/0N (2|25|36):  objs=41726 size=989.23KiB
    /25/1N (2|25|36):  objs=40222 size=955.96KiB
    /25/2N (2|25|36):  objs=37693 size=725.3KiB
    /25/3N (2|25|36):  objs=22624 size=232.49KiB
    /25/4S (2|25|36):  objs=166 size=116B
    /25/5N (2|25|36):  objs=1293 size=5.52KiB
    /25/6S (2|25|36):  objs=175 size=325B
    /25/7N (2|25|36):  objs=909 size=3.59KiB
    /25/8S (2|25|36):  objs=143 size=203B
    /25/9S (2|25|36):  objs=152 size=206B
    /25/10S (2|25|36):  objs=155 size=253B
    /25/11N (2|25|36):  objs=4059 size=19.15KiB
    /25/12S (2|25|36):  objs=157 size=117B
    /25/13N (2|25|36):  objs=789 size=3.14KiB
    /25/14S (2|25|36):  objs=163 size=219B
    /25/15N (2|25|36):  objs=766 size=2.84KiB
    /25/16S (2|25|36):  objs=141 size=261B
    /25/17N (2|25|36):  objs=429 size=1.48KiB
    /25/18S (2|25|36):  objs=134 size=105B
    /25/19S (2|25|36):  objs=144 size=137B
    /25/20S (2|25|36):  objs=158 size=334B
    /25/21S (2|25|36):  objs=147 size=169B
    /25/22S (2|25|36):  objs=159 size=326B
    /25/23N (2|25|36):  objs=963 size=3.5KiB
    /25/24S (2|25|36):  objs=149 size=217B
    /25/25N (2|25|36):  objs=569 size=2.25KiB
    /25/26S (2|25|36):  objs=127 size=229B
    /25/27N (2|25|36):  objs=711 size=2.59KiB
    /25/28S (2|25|36):  objs=148 size=265B
    /25/29N (2|25|36):  objs=2736 size=11.47KiB
    /25/30S (2|25|36):  objs=176 size=133B
    /25/31N (2|25|36):  objs=611 size=2.31KiB
    /25/32S (2|25|36):  objs=156 size=100B
    /25/33N (2|25|36):  objs=480 size=1.62KiB
    /25/34S (2|25|36):  objs=121 size=83B
    /25/35N (2|25|36):  objs=1233 size=4.8KiB
    /26/0N (2|25|36):  objs=35674 size=680.53KiB
    /26/1N (2|25|36):  objs=2398 size=10.29KiB
    /26/2S (2|25|36):  objs=152 size=130B
    /26/3N (2|25|36):  objs=45133 size=1.03MiB
    /26/4N (2|25|36):  objs=33355 size=570.61KiB
    /26/5S (2|25|36):  objs=147 size=169B
    /26/6N (2|25|36):  objs=3032 size=13.01KiB
    /26/7S (2|25|36):  objs=166 size=249B
    /26/9S (2|25|36):  objs=159 size=228B
    /26/10S (2|25|36):  objs=155 size=293B
    /26/11N (2|25|36):  objs=2598 size=11.03KiB
    /26/12S (2|25|36):  objs=137 size=151B
    /26/13N (2|25|36):  objs=568 size=2.32KiB
    /26/14S (2|25|36):  objs=175 size=108B
    /26/15N (2|25|36):  objs=810 size=3.09KiB
    /26/16S (2|25|36):  objs=165 size=188B
    /26/17N (2|25|36):  objs=9038 size=49.65KiB
    /26/18S (2|25|36):  objs=171 size=307B
    /26/19N (2|25|36):  objs=5693 size=32.5KiB
    /26/20S (2|25|36):  objs=169 size=180B
    /26/21N (2|25|36):  objs=1853 size=7.73KiB
    /26/22S (2|25|36):  objs=152 size=257B
    /26/23S (2|25|36):  objs=162 size=127B
    /26/24S (2|25|36):  objs=159 size=171B
    /26/25N (2|25|36):  objs=4872 size=21.29KiB
    /26/26S (2|25|36):  objs=155 size=228B
    /26/27N (2|25|36):  objs=4844 size=21.99KiB
    /26/28S (2|25|36):  objs=159 size=191B
    /26/29S (2|25|36):  objs=149 size=293B
    /26/30S (2|25|36):  objs=148 size=87B
    /26/31N (2|25|36):  objs=1028 size=4.14KiB
    /26/32S (2|25|36):  objs=144 size=121B
    /26/33N (2|25|36):  objs=2047 size=8.53KiB
    /26/34S (2|25|36):  objs=127 size=133B
    /26/35N (2|25|36):  objs=5975 size=33.06KiB
    /27/0N (2|25|36):  objs=35807 size=710.08KiB
    /27/1N (2|25|36):  objs=38971 size=822.08KiB
    /27/2N (2|25|36):  objs=39936 size=851.85KiB
    /27/3N (2|25|36):  objs=8665 size=47.71KiB
    /27/4S (2|25|36):  objs=174 size=156B
    /27/5N (2|25|36):  objs=2912 size=12.65KiB
    /27/6S (2|25|36):  objs=146 size=257B
    /27/7N (2|25|36):  objs=2267 size=9.39KiB
    /27/8S (2|25|36):  objs=158 size=331B
    /27/9N (2|25|36):  objs=1581 size=6.24KiB
    /27/10S (2|25|36):  objs=173 size=335B
    /27/11N (2|25|36):  objs=1418 size=5.82KiB
    /27/12S (2|25|36):  objs=150 size=314B
    /27/13N (2|25|36):  objs=879 size=3.35KiB
    /27/14S (2|25|36):  objs=152 size=226B
    /27/15N (2|25|36):  objs=642 size=2.25KiB
    /27/16S (2|25|36):  objs=151 size=274B
    /27/18S (2|25|36):  objs=146 size=287B
    /27/19N (2|25|36):  objs=1687 size=7.04KiB
    /27/20S (2|25|36):  objs=186 size=127B
    /27/21N (2|25|36):  objs=1836 size=7.75KiB
    /27/22S (2|25|36):  objs=137 size=247B
    /27/23N (2|25|36):  objs=1706 size=6.98KiB
    /27/24S (2|25|36):  objs=167 size=219B
    /27/25N (2|25|36):  objs=5367 size=27.42KiB
    /27/26S (2|25|36):  objs=165 size=227B
    /27/27N (2|25|36):  objs=1218 size=4.79KiB
    /27/28S (2|25|36):  objs=183 size=213B
    /27/29N (2|25|36):  objs=1836 size=7.57KiB
    /27/30S (2|25|36):  objs=165 size=299B
    /27/31N (2|25|36):  objs=1895 size=8.15KiB
    /27/32S (2|25|36):  objs=184 size=101B
    /27/33N (2|25|36):  objs=459 size=1.44KiB
    /27/34S (2|25|36):  objs=142 size=169B
    /28/0N (2|25|36):  objs=38498 size=776.56KiB
    /28/1N (2|25|36):  objs=37219 size=711.29KiB
    /28/2N (2|25|36):  objs=34308 size=630.56KiB
    /28/3S (2|25|36):  objs=158 size=314B
    /28/4N (2|25|36):  objs=469 size=1.51KiB
    /28/5S (2|25|36):  objs=148 size=109B
    /28/6S (2|25|36):  objs=153 size=159B
    /28/7N (2|25|36):  objs=598 size=2.42KiB
    /28/8S (2|25|36):  objs=147 size=108B
    /28/9N (2|25|36):  objs=784 size=2.93KiB
    /28/10S (2|25|36):  objs=140 size=99B
    /28/11N (2|25|36):  objs=3274 size=14.88KiB
    /28/12S (2|25|36):  objs=179 size=300B
    /28/13N (2|25|36):  objs=2255 size=9.47KiB
    /28/14S (2|25|36):  objs=138 size=254B
    /28/15N (2|25|36):  objs=3105 size=13.11KiB
    /28/16S (2|25|36):  objs=163 size=264B
    /28/17N (2|25|36):  objs=14811 size=90.37KiB
    /28/18S (2|25|36):  objs=149 size=155B
    /28/19N (2|25|36):  objs=1084 size=4.33KiB
    /28/20S (2|25|36):  objs=176 size=308B
    /28/22S (2|25|36):  objs=136 size=247B
    /28/23N (2|25|36):  objs=1059 size=4.11KiB
    /28/24S (2|25|36):  objs=155 size=295B
    /28/25N (2|25|36):  objs=4675 size=20.06KiB
    /28/26S (2|25|36):  objs=165 size=210B
    /28/27N (2|25|36):  objs=609 size=2.09KiB
    /28/28S (2|25|36):  objs=145 size=326B
    /28/29N (2|25|36):  objs=4229 size=18.65KiB
    /28/30S (2|25|36):  objs=154 size=125B
    /28/31N (2|25|36):  objs=287 size=849B
    /28/32S (2|25|36):  objs=132 size=224B
    /28/33S (2|25|36):  objs=168 size=184B
    /28/34S (2|25|36):  objs=148 size=88B
    /29/0N (2|25|36):  objs=38926 size=823.78KiB
    /29/1N (2|25|36):  objs=31532 size=449.87KiB
    /29/2N (2|25|36):  objs=40332 size=904.51KiB
    /29/3N (2|25|36):  objs=7309 size=33.98KiB
    /29/4S (2|25|36):  objs=153 size=212B
    /29/5N (2|25|36):  objs=2346 size=10.02KiB
    /29/6S (2|25|36):  objs=154 size=299B
    /29/7S (2|25|36):  objs=148 size=324B
    /29/8S (2|25|36):  objs=173 size=186B
    /29/9N (2|25|36):  objs=945 size=3.71KiB
    /29/10S (2|25|36):  objs=148 size=185B
    /29/11N (2|25|36):  objs=1627 size=6.69KiB
    /29/12S (2|25|36):  objs=167 size=244B
    /29/13N (2|25|36):  objs=736 size=2.71KiB
    /29/14S (2|25|36):  objs=151 size=259B
    /29/15N (2|25|36):  objs=299 size=1021B
    /29/16S (2|25|36):  objs=134 size=126B
    /29/17N (2|25|36):  objs=2875 size=12.45KiB
    /29/18S (2|25|36):  objs=152 size=89B
    /29/19N (2|25|36):  objs=7398 size=35.59KiB
    /29/20S (2|25|36):  objs=166 size=277B
    /29/21N (2|25|36):  objs=2506 size=10.8KiB
    /29/22S (2|25|36):  objs=135 size=93B
    /29/23N (2|25|36):  objs=330 size=998B
    /29/24S (2|25|36):  objs=177 size=260B
    /29/25N (2|25|36):  objs=2600 size=11.17KiB
    /29/26S (2|25|36):  objs=174 size=240B
    /29/27N (2|25|36):  objs=3012 size=13.37KiB
    /29/28S (2|25|36):  objs=143 size=314B
    /29/30S (2|25|36):  objs=155 size=316B
    /29/32S (2|25|36):  objs=143 size=260B
    /29/33N (2|25|36):  objs=1079 size=4.21KiB
    /29/34S (2|25|36):  objs=164 size=186B
    /29/35N (2|25|36):  objs=1814 size=8.05KiB
    /30/0N (2|25|36):  objs=39811 size=873.29KiB
    /30/1N (2|25|36):  objs=37689 size=703.09KiB
    /30/2N (2|25|36):  objs=38487 size=903.8KiB
    /30/3N (2|25|36):  objs=14542 size=137.76KiB
    /30/4S (2|25|36):  objs=134 size=102B
    /30/5N (2|25|36):  objs=295 size=816B
    /30/6S (2|25|36):  objs=142 size=109B
    /30/7N (2|25|36):  objs=2299 size=9.61KiB
    /30/8S (2|25|36):  objs=178 size=322B
    /30/9S (2|25|36):  objs=146 size=281B
    /30/10S (2|25|36):  objs=167 size=289B
    /30/11N (2|25|36):  objs=322 size=888B
    /30/12S (2|25|36):  objs=144 size=192B
    /30/14S (2|25|36):  objs=150 size=217B
    /30/15N (2|25|36):  objs=1936 size=7.96KiB
    /30/16S (2|25|36):  objs=150 size=220B
    /30/17N (2|25|36):  objs=1700 size=7.2KiB
    /30/18S (2|25|36):  objs=145 size=247B
    /30/20S (2|25|36):  objs=151 size=221B
    /30/21N (2|25|36):  objs=4522 size=22.51KiB
    /30/22S (2|25|36):  objs=143 size=332B
    /30/23N (2|25|36):  objs=4341 size=19.94KiB
    /30/24S (2|25|36):  objs=166 size=150B
    /30/25N (2|25|36):  objs=3241 size=13.76KiB
    /30/26S (2|25|36):  objs=158 size=155B
    /30/28S (2|25|36):  objs=154 size=342B
    /30/29N (2|25|36):  objs=280 size=763B
    /30/30S (2|25|36):  objs=164 size=275B
    /30/32S (2|25|36):  objs=178 size=113B
    /30/33N (2|25|36):  objs=2529 size=10.62KiB
    /30/34S (2|25|36):  objs=143 size=325B
    /30/35N (2|25|36):  objs=603 size=2.21KiB
    /31/0N (2|25|36):  objs=21602 size=231.61KiB
    /31/1S (2|25|36):  objs=145 size=169B
    /31/2N (2|25|36):  objs=18241 size=150.79KiB
    /31/3N (2|25|36):  objs=40382 size=911.56KiB
    /31/4N (2|25|36):  objs=40154 size=787.18KiB
    /31/5N (2|25|36):  objs=6526 size=30.59KiB
    /31/6S (2|25|36):  objs=153 size=119B
    /31/8S (2|25|36):  objs=163 size=267B
    /31/10S (2|25|36):  objs=147 size=200B
    /31/11N (2|25|36):  objs=2262 size=9.41KiB
    /31/12S (2|25|36):  objs=150 size=262B
    /31/13N (2|25|36):  objs=5819 size=28.49KiB
    /31/14S (2|25|36):  objs=168 size=232B
    /31/15N (2|25|36):  objs=4258 size=21.23KiB
    /31/16S (2|25|36):  objs=151 size=186B
    /31/17N (2|25|36):  objs=328 size=1.05KiB
    /31/18S (2|25|36):  objs=159 size=314B
    /31/19N (2|25|36):  objs=771 size=2.85KiB
    /31/20S (2|25|36):  objs=142 size=286B
    /31/21N (2|25|36):  objs=1682 size=7.21KiB
    /31/22S (2|25|36):  objs=146 size=164B
    /31/23N (2|25|36):  objs=4310 size=19.46KiB
    /31/24S (2|25|36):  objs=147 size=183B
    /31/26S (2|25|36):  objs=147 size=292B
    /31/27N (2|25|36):  objs=3618 size=16.66KiB
    /31/28S (2|25|36):  objs=178 size=166B
    /31/29N (2|25|36):  objs=1173 size=4.65KiB
    /31/30S (2|25|36):  objs=160 size=317B
    /31/31N (2|25|36):  objs=4847 size=23.25KiB
    /31/32S (2|25|36):  objs=177 size=121B
    /31/33N (2|25|36):  objs=2684 size=11.84KiB
    /31/34S (2|25|36):  objs=153 size=310B
    /31/35S (2|25|36):  objs=134 size=309B

com.milaboratory.util.sorting.HashSorterTest > test2 SKIPPED
	Gradle is still running, please be patient...

com.milaboratory.util.sorting.SortingUtilTest > test1 STANDARD_OUT
    Collation: 1.05s
    Sorting: 1.06s
    1
    217
    41528
    99464
    99997

com.milaboratory.util.AtomicEnumHistogramTest > test1 STANDARD_OUT
    {"labels":["A","B","C","null"],"hist":[1,2,0,1]}

com.milaboratory.util.CacheTest > test1 STANDARD_OUT
    Cache misses:400
    Cache hits:800

com.milaboratory.util.NSequenceWithQualityPrintHelperTest > test1 SKIPPED

com.milaboratory.util.JsonOverriderTest > test1 STANDARD_OUT
    WARNING: unnecessary override -Ob= with the same value.

com.milaboratory.test.TestUtil > testLT STANDARD_OUT
    Short tests.
    No system env properties.

com.milaboratory.core.motif.BitapPatternTest > ttt STANDARD_OUT
     0 ATTWCCGACA 9
       |||   ||||
    20 ATTT--GACA 27
    [S3:W->T,D4:C,D5:C]
    24
    -26

com.milaboratory.core.mutations.MutationTest > exportRegexps STANDARD_OUT
    S([\QAGCTNRYSWKMBDHV\E])(\d+)([\QAGCTNRYSWKMBDHV\E])|D([\QAGCTNRYSWKMBDHV\E])(\d+)|I(\d+)([\QAGCTNRYSWKMBDHV\E])
    S([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E])(\d+)([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E])|D([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E])(\d+)|I(\d+)([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E])

com.milaboratory.core.mutations.MutationsTest > testCanonical1 STANDARD_OUT
    GCTCGCCTAGAGAGGGAGATTGTATTGAGTTCATCTGACTGGCCATCTTTGGAGACTCTCAGCCTCCTTATAAGAAGTAAGCGGCTCGAAGAAGCGAATCGGGGTTAAGGCTTACCGTGTGCTTTCTAATAGTTAGGGGGCTATTGCGACAGACTTATCTCGTTGCGGCAGTGGGTAATCCCAAAAATCTAGACGTCCATGTCGGGTACCCCTCTATTCGACGTAGGGAACAAGACACCCTAGAATAGCGAATCTCCGCTACATTCTTAATCGACGTGCCTCGTAGACGTACTCATTAATGCCCTTGCCGTCCGAGGACCGTTCTCAAAGTACTGCGCTCGGATGATGTTATTAAACGGAGTACAGGTGCTAGCGTATTAGAGACATGCGGCAAATTCTCACGTTTGAACCAAAAACTTGGGTATTGCTCGCTTGTACAGGATCTAACATGTTTTGTAGTACGACGTGAAAGCTCCTTCCAGGGTAGGCCTAACGACAGCGCTCGGATCTTAGGATCGTAGGCTGGGTTCTTGGATCCACAGAAATAAAGCAGAGCGGTCACAATGATCTTCTGGTTTGTGGTGCCTCATGTATATATACTAGCATAGATTAATTCCGCCCTCAAAGACCGAAGGACCCCATCAGTCTCAAACTTGGTCTGGTGGGGTGTTAGAGGTGTGGGTTTAGCAGAATCTTTGCTGCGAGAGTGTTGTCCCAAAGCTCTCTGGGCTCTTAAGCGCTCAGTTACTCGTGAGCGTGGAATGACCATGTTCGTGGGCTGACATTGTCCA
    GCTCGCCTAGAGAGGAGATTGATTGAGTTCATCTGACTGGCCATCTTTGGAACTGCTCAGCCTCTTATAGATGTAGCGGTCGAACGAAGCGAATGCGGTGTTGAGGCTTACTGTGTGCTTTCTGATAGTTAGGGGGCTACTTGCGACAGACTTATCTCATTGCGGCAGTGAGTAATCCCAAAAATCTAACGTCCATGTCGGGTACCCCTCTATTCGACGTAGGAACAAGACACCCTAGAATAAGCGATCTCTACTACATCCTTAATCGTCGTGCCTCGTAGACGTACTCATTAATCCCTTGCCGTCCGAGACCGTTCTCAAAGTACCTGCGCTCGGAGGTGTTATTAAACGAGTACAGGTGCTACGCGTATTAGAGACATGCGGCAAATTCACGTGAACCAAAAACTTGGGTATTCTCGCTTGTACAGGATCTAACATGTTTATGAGTACGACGTGAACAGCTCTTCCAGTGTAGGCCTAACGACAGCGCTCGGACTTAGGATCGTAGGCTGGGTGTCTTGGATCCACAGGAATAAAGCGAGGGTCCAATGATCTTCTGGTTTTGGTGCCTCAGATATATACTACATGATTAACTCCGCCCTCAATAGTCCGAAAGACCCCATCGTCTCAAACTGTGTCTGGTGGGGTGTAGAGGTGTGGGTTTAGCAGAATCTTTGCTGCGAGAGTGTTCCCAAAGCTCTCTGGGCTCTTAAGCGCTCAGTTACTCGTGGCGTGGAATGACCTGTTCGTGGGCTGACATTTGTC
    GCTCGCCTAGAGAGGAATTGATTGAGTTCATCTGATCTGGCCATCTTTGGAACTGCTCAGCCTCTTATTGATGTAGCCGTTCGAACGAATCGAATGCGGTGTTGAGGCTTACTGTGTGCTTTTCTATAGTTAGGGGTTACTTCGACAGACTTATCTCATGGGCAGTGAGTATATCCAAGAATCAACGTCCATGTCGGGTACCCTCTATTCACGTGGAATTAGACACCCTAGACATAAGCGATCTCTACATCTTAATCGTCGTGCCTCGTTACGTACTCTTAATCCCTTGCCGTCCGAGAACCGTTCTCGAAGTACCTGCGCTCGGAGGTTCTTATTAAACGAGTACTGTTACGCGTATTGGAGGCATGCGGGAAATTCACTGAACCAAAAACTTGGGTATTCTCGCTGTACAGGATCTAACAGTGTTTATGAGTACGACGTATCAGCTCCTTCTAGTGAGGCCTAACGACAGGCTCGGACTAGGGTCGTAGGCTGGGTGTCTTGGATCCACAGGGATAAAGCGAGGGTCCAATGATCTTCTGGTTTTGGTGTCCTCAGGATATACTACTATATTAACTCCGCCCTCAATAGTCCGAAAGACCCCACGTCTCAAATGTGTCTGGTGGGGTGAAGGTGTGATTTAGCAGTTCCTTGCGCGAAGGGTTCCCAAAGCTCCTGGGTCTTAAGCGCTCATACTCGTGGGCGTGGAATGACCTGTTCCTTGGCCGGCATTCGGTC
    0 GCTCGCCTAGAGA-GGA-ATTG-ATTGAGTTCATCTGATCTGGCCATCTTTGGA-ACTGCTCAGCCT-CTTAT-TGATGT-AGCCGTTCGAACGAATCGAATGCGGTGTTGAGGCTTACTGTGTGCTTTTCT-ATAGTTA-GGGGTTACTT-CGACAGACTTATCTC-ATG-GGCAGTGAGTATAT-CCAAGAATC-A-ACGTCCATGTCGGGTA-CCCTCTATTC-ACGT--GGAATTAGACACCCTAGACATAAGCG-ATCT---CTACA-TCTTAATCGTCGTGCCTCGT-TACGTACTC-TTAAT-CCCTTGCCGTCCGAGAACCGTTCTCGAAGTACCTGCGCTCGGAGGTTCTTATTAAAC-GAGTAC---TGTTACGCGTATTGGAGGCATGCGGGAAA-T-TCAC---TGAACCAAAAACTTGGGTATT-CTCGC-TGTACAGGATCTAACAGTGTTTATG-AGTACGACGT-ATCAGCTCCTTCTAGTG-AGGCCTAACGACAG-GCTCGGA-C-TAGGGTCGTAGGCTGGGTGTCTTGGATCCACAGGGATAAAGC-GAG-GGTC-CAATGATCTTCTGGTTT-TGGTGTCCTCA-G--GATATACTA-C-TATATTAACTCCGCCCTCAATAGTCCGAAAGACCCCA-C-GTCTCAAA--TGTGTCTGGTGGGGTG--A-AGGTGT-GATTTAGCAG-TTCCTTGC-GCGA-AG-GGT-TCCCAAAGCTC-CTGGG-TCTTAAGCGCTCA--TACTCGTGGGCGTGGAATGACC-TGTTCCTTGGCCGGCATTCGGT-C- 737
      ||||||||||||| ||| |||| ||||||||||||||| ||||||||||||||| ||| |||||||| |||||  || || ||| | ||||| ||| ||||| ||| ||| |||||||| |||||| ||||| ||||||| |||| || || |||||||||||||||  || ||||||| ||| || |||| |||| | |||||||||||||||| |||||||||| ||||  ||||  |||||||||||| || |||| ||||   ||||| ||||||||| ||||||||||  |||||||| ||||| ||||||||||||||| ||||||||| ||||| ||||||||||| | | ||||||||| ||||||   || || ||||||| ||| ||||||| ||| | ||||   ||||||||||||||||||||| ||||| |||||||||||||||| ||||| || |||||||||| |  ||||||||| || | |||||||||||||| ||||||| | |||| ||||||||||||| ||||||||||||||  ||||||| ||| |||| ||||||||||||||||| ||||| ||||| |   |||||||| | || ||||| ||||||||||| || ||||| ||||||| | ||||||||  || |||||||||||||  | |||||| | ||||||||  || |||| |||| || | | ||||||||||| ||||| |||||||||||||  |||||||| ||||||||||||| ||||| | ||| | ||||  || | 
    0 GCTCGCCTAGAGAGGGAGATTGTATTGAGTTCATCTGA-CTGGCCATCTTTGGAGACT-CTCAGCCTCCTTATAAGAAGTAAGCGGCTCGAA-GAAGCGAAT-CGGGGTTAAGGCTTACCGTGTGC-TTTCTAATAGTTAGGGGGCTA-TTGCGACAGACTTATCTCGTTGCGGCAGTGGGTA-ATCCCAAAAATCTAGACGTCCATGTCGGGTACCCCTCTATTCGACGTAGGGAACAAGACACCCTAGA-AT-AGCGAATCTCCGCTACATTCTTAATCGACGTGCCTCGTAGACGTACTCATTAATGCCCTTGCCGTCCGAGGACCGTTCTCAAAGTA-CTGCGCTCGGATGATGTTATTAAACGGAGTACAGGTGCTA-GCGTATTAGAGACATGCGGCAAATTCTCACGTTTGAACCAAAAACTTGGGTATTGCTCGCTTGTACAGGATCTAACA-TGTTT-TGTAGTACGACGTGA-AAGCTCCTTCCAGGGTAGGCCTAACGACAGCGCTCGGATCTTAGGATCGTAGGCTGGGT-TCTTGGATCCACAGAAATAAAGCAGAGCGGTCACAATGATCTTCTGGTTTGTGGTG-CCTCATGTATATATACTAGCATAGATTAATTCCGCCCTCAA-AGACCGAAGGACCCCATCAGTCTCAAACTTG-GTCTGGTGGGGTGTTAGAGGTGTGGGTTTAGCAGAATCTTTGCTGCGAGAGTGTTGTCCCAAAGCTCTCTGGGCTCTTAAGCGCTCAGTTACTCGTGAGCGTGGAATGACCATGTTCGTGGGCTGACATT--GTCCA 790
    [I13:G,D15:G,I65:C,D66:C,I78:A,D79:A,I81:C,S81:C->G,S83:G->C,D84:C,D122:T,I125:T,I161:G,S161:G->T,D163:T,I224:A,S224:A->G,D225:G,I250:A,D251:A,D252:T,D253:C,S256:C->T,I257:C,I257:C,I263:T,S264:T->C,D265:C,D343:T,S344:G->T,S345:A->G,S346:T->A,S347:G->T,I348:G,I357:G,D358:G,I364:A,I364:G,I364:G,S364:A->T,D366:G,S367:T->C,D368:G,S369:C->T,D370:T,I389:G,S390:G->C,D391:C,I395:T,I396:C,D397:C,D398:T,I402:G,I402:T,S402:G->T,D403:T,D404:T,I432:T,D433:T,D474:C,I476:C,I591:T,S591:T->A,S592:A->T,D593:T,I604:A,I604:T,S605:T->G,D606:A,D607:G,I652:C,S652:C->T,S654:T->G,D655:G,I669:T,D670:T,I690:A,D691:A,I707:T,S707:T->G,S708:G->T,D709:T,I743:G,S743:G->T,D745:T,I772:C,S772:C->G,S773:G->T,S774:T->G,D776:G]
    0 GCTCGCCTAGAGA-GGGAGATTGTATTGAGTTCATCTGACTGGCCATCTTTGGAGACTCTCAGCCT-CCTTATAAGAAGT-AAG-CGGCTCGAAGAAGCGAATCGGGGTTAAGGCTTACCGTGTGCTTT-CTAATAGTTAGGGGGCTATTGCGACAGACTTATCTC-GTTGCGGCAGTGGGTAATCCCAAAAATCTAGACGTCCATGTCGGGTACCCCTCTATTCGACGT-AGGGAACAAGACACCCTAGAATAGCG-AATCTCC--GCTACA-TTCTTAATCGACGTGCCTCGTAGACGTACTCATTAATGCCCTTGCCGTCCGAGGACCGTTCTCAAAGTACTGCGCTCGGATGATG-TTATTAAAC-GGAGTAC---AGGTGCTAGCGTATTAGAGACATGC-GGCAAA-T-TCTCAC--GTTTGAACCAAAAACTTGGGTATTGCTCGC-TTGTACAGGATCTAACATGTTTTGTAGTACGACGTGAAAGCTCC-TTCCAGGGTAGGCCTAACGACAGCGCTCGGATCTTAGGATCGTAGGCTGGGTTCTTGGATCCACAGAAATAAAGCAGAGCGGTCACAATGATCTTCTGGTTTGTGGTGCCTCATG-TATATATACTAGC--ATAGATTAATTCCGCCCTCAAAGACCGAAGGACCCCATCAGTCTCAAA-CTTGGTCTGGTGGGGTG-TTAGAGGTGTGGGTTTAGCAG-AATCTTTGCTGCGAGAG-TGTTGTCCCAAAGCTCTCTGGGCTCTTAAGCGCTCA-GTTACTCGTGAGCGTGGAATGACCATGTT-CGTGGGCTGACATTGTCCA 790
      ||||||||||||| || ||||||||||||||||||||||||||||||||||||||||||||||||| | ||||||||||| | |  |  ||||||||||||||||||||||||||||||||||||| || ||||||||||||||||||||||||||||||||||||  | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||   |||||||||||||||||||||||| |   ||   |||||| |  |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||      ||||||||| | |||||    |     |||||||||||||||||| |  ||| | |  |||     ||||||||||||||||||||||||||| | |||||||||||||||||||||||||||||||||||||||| | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||    ||||||||||  |   ||||||||||||||||||||||||||||||||||||||||||||  |  ||||||||||||| | ||||||||||||||||||| | |||||||||||||||    |||||||||||||||||||||||||||||||||  | ||||||||||||||||||||||||||    | ||||||||||||||
    0 GCTCGCCTAGAGAGGG-AGATTGTATTGAGTTCATCTGACTGGCCATCTTTGGAGACTCTCAGCCTCC-TTATAAGAAGTAA-GCGGC-TCGAAGAAGCGAATCGGGGTTAAGGCTTACCGTGTGC-TTTCTAATAGTTAGGGGGCTATTGCGACAGACTTATCTCGTT-GCGGCAGTGGGTAATCCCAAAAATCTAGACGTCCATGTCGGGTACCCCTCTATTCGACGTAG-GGAACAAGACACCCTAGAATAGCGAA---TCTCCGCTACATTC-TTAATCGACGTGCCTCGTAGACGTACTCATTAATGCCCTTGCCGTCCGAGGACCGTTCTCAAAGTACTGCGCTCGGA-TGATGTTATTAAACGG-AGTACAGGTG-C-T-AGCGTATTAGAGACATGCGGC-AAATTCT--CACGTT--TGAACCAAAAACTTGGGTATTGCTCGCTT-GTACAGGATCTAACATGTTTTGTAGTACGACGTGAAAGCT-CCTTCCAGGGTAGGCCTAACGACAGCGCTCGGATCTTAGGATCGTAGGCTGGGTTCTTGGATCCACAGAAATAAAGCAGAGCGGTCACAATGATCTTCTGGTTTGTGGTGCCTCATGTAT-ATATACTAGCATAG--ATTAATTCCGCCCTCAAAGACCGAAGGACCCCATCAGTCTCAAACTTG-GTCTGGTGGGGTGTT-AGAGGTGTGGGTTTAGCAGAA-TCTTTGCTGCGAGAGTGT-TGTCCCAAAGCTCTCTGGGCTCTTAAGCGCTCAGTT-ACTCGTGAGCGTGGAATGACCATGTTCGTGG-GCTGACATTGTCCA 790

com.milaboratory.core.mutations.MutationsUtilTest > test1111 STANDARD_OUT
    S([\QAGCTNRYSWKMBDHV\E])(\d+)([\QAGCTNRYSWKMBDHV\E])|D([\QAGCTNRYSWKMBDHV\E])(\d+)|I(\d+)([\QAGCTNRYSWKMBDHV\E])
    S([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E])(\d+)([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E])|D([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E])(\d+)|I(\d+)([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E])

com.milaboratory.core.mutations.MutationsUtilTest > nt2AAWithMappingManual1 STANDARD_OUT
    [I2C::SM0I, I2G::I1A, I2C::I1A, SG2C:SM0I:I1A]

com.milaboratory.core.mutations.MutationsUtilTest > nt2AAWithMappingManual2 STANDARD_OUT
    [S0:T->N,D13:V,S14:S->Y,S15:P->R,S16:W->P,S17:Y->G,S18:D->T,S19:P->I,S20:G->P,S21:D->A,S22:K->T,S23:A->K,S24:F->R,S25:G->S,S26:P->D,I27:S]
    [-1, -1, 9, 15]

com.milaboratory.core.mutations.MutationsUtilTest > nt2AAWithMappingManual3 STANDARD_OUT
    0 CAGGTTCAGCTGGTGCAGTCTGGAGCTGAGGTGAAGAAGCCTGGGGCCTCAGTGAAGGTCTCCTGCAAGGCTTCTGGTTACACCTTTACCAGCTACGGTATCAGCTGGGTGCGACAGGCCCCTGGACAAGGGCTTGAGTGGATGGGATGGATCAGCGCTTACAATGGTAACACAAACTATGCACAGAAGCTCCAGGGCAGAGTCACCATGACCACAGACACATCCACGAGCACAGCCTACATGGAGCTGAGGAGCCTGAGATCTGACGACACGGCCGTGTATTACTGTGCGAGAGA 295
      ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||  ||||||| ||||| ||||||||||||||||||||||||||||| ||||||||| ||||||||| ||||||||||||||||||| || |||||     |||   || ||||||||||||||
    0 CAGGTTCAGCTGGTGCAGTCTGGAGCTGAGGTGAAGAAGCCTGGGGCCTCAGTGAAGGTCTCCTGCAAGGCTTCTGGTTACACCTTTACCAGCTACGGTATCAGCTGGGTGCGACAGGCCCCTGGACAAGGGCTTGAGTGGATGGGATGGATCAGCGCTTACAATGGTAACACATTCTATGCAGAGAAGTTCCAGGGCAGAGTCACCATGACCACAGACGCATCCACGACCACAGCCTATATGGAGCTGAGGAGCCTGACATTTGACG-----GCCACATACTACTGTGCGAGAGA 290
    [S58:N->F,S61:Q->E,S63:L->F,S73:T->A,S76:S->T,S86:R->T,S87:S->F,S89:D->G,D90:T,D91:A,S92:V->H,S93:Y->I,S94:Y->L,S95:C->L,S96:A->C,S97:R->E,S98:_->R]
    QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYGISWVRQAPGQGLEWMGWISAYNGNTFYAEKFQGRVTMTTDASTTTAYMELRSLTFDGHILLCER
    QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYGISWVRQAPGQGLEWMGWISAYNGNTFYAEKFQGRVTMTTDASTTTAYMELRSLTFDGHILLCER
    [S58:N->F,S61:Q->E,S63:L->F,S73:T->A,S76:S->T,S86:R->T,S87:S->F,S89:D->G,D90:T,D91:A,S92:V->H,S93:Y->I,S94:Y->L,S95:C->L,S96:A->C,S97:R->E,S98:_->R]
    [0, 0, 1, 2, 3, 4, -1, 5, 6, 7, 7, 8, 8, 8, 10, 10, 11, 12]

com.milaboratory.core.mutations.MutationsUtilTest > nt2AAWithMappingManual4 STANDARD_OUT
    [S3:S->M,D4:D,S5:_->I]

com.milaboratory.core.io.util.IOUtilTest > test111 STANDARD_OUT
    3
    3
    -2147483648
    -9223372036854775808

com.milaboratory.core.io.sequence.fasta.RandomAccessFastaReaderTest > test1nt STANDARD_ERROR
    Indexing milib_c599519b574b09d3e9e7065b3573b11d4f3360276966349625176437433.fasta: 0%
    Indexing milib_c599519b574b09d3e9e7065b3573b11d4f3360276966349625176437433.fasta: done

com.milaboratory.core.io.sequence.fasta.RandomAccessFastaReaderTest > test1 STANDARD_ERROR
    Indexing milib_c599519b574b09d3e9e7065b3573b11d4f3360276966349625176437433.fasta: 0%
    Indexing milib_c599519b574b09d3e9e7065b3573b11d4f3360276966349625176437433.fasta: done

com.milaboratory.core.io.sequence.fasta.RandomAccessFastaReaderTest > test2 STANDARD_ERROR
    Indexing milib_b2f762a1e7af6fe249632762e7d461d2a6411e4918343225654943373063.tmp: 0%
    Indexing milib_b2f762a1e7af6fe249632762e7d461d2a6411e4918343225654943373063.tmp: 46.4%
    Indexing milib_b2f762a1e7af6fe249632762e7d461d2a6411e4918343225654943373063.tmp: 97.8%
    Indexing milib_b2f762a1e7af6fe249632762e7d461d2a6411e4918343225654943373063.tmp: done

com.milaboratory.core.tree.SequenceTreeMapTest > testCase9 STANDARD_OUT
    Hit 1
    0 ac-gacTtgactg 11
    0 acTgac-tgactg 11

    Hit 2
    0 ac-gactTgactg 11
    0 acTgact-gactg 11


com.milaboratory.core.tree.SequenceTreeMapTest > optimalityAndScopeTest STANDARD_OUT
    --NW  alignments--
    CASSLAPGATN-KLFF
    CASS-APGATNEKLFF

    CASSLAPGATN-KLFF
    CASSLAPG-TNEKLFF

    CASSLAPGATN-KLfF
    CASSLAPG-TNEKLyF

    --STM alignments--
    CASSLAPGATN-KLFF
    CASS-APGATNEKLFF

    CASSLAPGATN-KLFF
    CASSLAPG-TNEKLFF

    CASSlAPGATN-KLFF
    CASSa-PGATNEKLFF

    CASSLAPGaTN-KLFF
    CASSLAPGt-NEKLFF

    CASSlAPGATN-KLFF
    CA-SsAPGATNEKLFF

    CASSlAPGATN-KLFF
    CAS-sAPGATNEKLFF

    CASSLAPGATNk-LFF
    CASS-APGATNeKLFF

    CASSLAPGaTN-KLFF
    CASSLAP-gTNEKLFF

    CASSLAPGATNk-LFF
    CASSLAPG-TNeKLFF

    CASSLAPGATN-KLfF
    CASSLAPG-TNEKLyF

    ------------------

com.milaboratory.core.tree.PrimerGenerator > generate SKIPPED

com.milaboratory.core.merger.MergerParametersTest > test2 STANDARD_OUT
    {
      "qualityMergingAlgorithm": "SumSubtraction",
      "partsLayout": "Collinear",
      "minimalOverlap": 15,
      "maxQuality": 50,
      "minimalIdentity": 0.8,
      "identityType": "Unweighted"
    }

com.milaboratory.core.sequence.AminoAcidSequenceTest > testName STANDARD_OUT
    3

com.milaboratory.core.sequence.AminoAcidSequenceTest > testConvertPositionSync1 STANDARD_OUT
    FromCenter
    2
    3
    4
    5
    6
    7
    8
    9
    10
    11
    12
    13
    14
    15
    16
    17
    18
    19
    FromLeftWithoutIncompleteCodon
    2
    3
    4
    5
    6
    7
    8
    9
    10
    11
    12
    13
    14
    15
    16
    17
    18
    19
    FromLeftWithIncompleteCodon
    2
    3
    4
    5
    6
    7
    8
    9
    10
    11
    12
    13
    14
    15
    16
    17
    18
    19
    FromRightWithoutIncompleteCodon
    2
    3
    4
    5
    6
    7
    8
    9
    10
    11
    12
    13
    14
    15
    16
    17
    18
    19
    FromRightWithIncompleteCodon
    2
    3
    4
    5
    6
    7
    8
    9
    10
    11
    12
    13
    14
    15
    16
    17
    18
    19

com.milaboratory.core.sequence.GeneticCodeTest > generateExtendedGeneticCode SKIPPED

com.milaboratory.core.sequence.ShortSequenceSetTest > test1 STANDARD_OUT
    99955 elements with 366.33KiB in raw nucleotide entropy serialized into 273.41KiB

com.milaboratory.core.sequence.AminoAcidAlphabetTest > testCalculateMatches SKIPPED

com.milaboratory.core.sequence.NucleotideAlphabetTest > testCalculateIntersections SKIPPED

com.milaboratory.core.sequence.quality.QualityTrimmerTest > testParametersSerialization0 STANDARD_OUT
    {
      "averageQualityThreshold": 7.0,
      "windowSize": 6
    }

com.milaboratory.core.sequence.quality.QualityAggregatorTest > test1 STANDARD_OUT
    45

com.milaboratory.core.sequence.quality.QualityAggregatorTest > test2 STANDARD_OUT
    650

com.milaboratory.core.sequence.quality.QualityAggregatorTest > test3 STANDARD_OUT
    2511

com.milaboratory.core.RangeTest > test23e14 STANDARD_OUT
    1000001
    1010100
    1000111
    1000011

    1000010

com.milaboratory.core.alignment.AlignmentTest > testInvert STANDARD_OUT
    8 AGACACAGATACA 20
      ||||||| |||||
    0 AGACACATATACA 12
    0 AGACACATATACA 12
      ||||||| |||||
    8 AGACACAGATACA 20

    0 GATACATTAGACACAGATACA--- 20
              ||||||| |||||   
    0 --------AGACACATATACACAG 15
    0 --------AGACACATATACACAG 15
              ||||||| |||||   
    0 GATACATTAGACACAGATACA--- 20

    0 GATACATTAGA---CACAGATACA 20
      |||||||||||   ||||||||||
    5 GATACATTAGAGACCACAGATACA 28
    5 GATACATTAGAGACCACAGATACA 28
      |||||||||||   ||||||||||
    0 GATACATTAGA---CACAGATACA 20

    0 GATAC-----ATTAGA---CACAGATACA 20
      |||||     ||||||   ||||||||||
    0 GATACGATACATTAGAGACCACAGATACA 28
    0 GATACGATACATTAGAGACCACAGATACA 28
      |||||     ||||||   ||||||||||
    0 GATAC-----ATTAGA---CACAGATACA 20


com.milaboratory.core.alignment.AlignmentTrimmerTest > testRandom1 STANDARD_OUT
    lTrimmed = 1761
    rTrimmed = 1674
    lTrimmed = 2941
    rTrimmed = 2771

com.milaboratory.core.alignment.AlignmentIteratorTest > test1 STANDARD_OUT
    0 -ATT-AGACA-- 7
       |||  || |  
    0 AATTGGGA-ATT 10
    I0AI3GSA3GDC6I8TI8T

com.milaboratory.core.alignment.AlignerTest > testCalculateScore1 STANDARD_OUT
    11.69us
    10.60us
    8.65us

com.milaboratory.core.alignment.AlignerCustomTest > testSemiLocal0 STANDARD_OUT
    29.0
    2 c----cccTTgaa---tgTtaGTa-----taacta--tct 27
    0 cAGTTccc--gaaACCtgCta--aGCTCTtaactaCTtct 35
    29.0
    2 c----cccTTgaa---tgTtaGTa-----taacta--tct 27
    0 cAGTTccc--gaaACCtgCta--aGCTCTtaactaCTtct 35

com.milaboratory.core.alignment.kaligner2.OffsetPacksAccumulatorTest > testScoreCorrection2 SKIPPED

com.milaboratory.core.alignment.kaligner2.KMapper2Test > test11112 STANDARD_OUT
      ID: 0
      Score: 1719
      Cluster 0:
      Q 27 -> T 15 - -12
      Q 30 -> T 18 - -12
      Q 39 -> T 28 - -11
      Q 42 -> T 31 - -11
      Q 45 -> T 34 - -11
      Q 48 -> T 37 - -11
      Q 51 -> T 40 - -11
      Cluster 1:
      Q 84 -> T 50 - -34
      Q 87 -> T 53 - -34
      Q 90 -> T 56 - -34
      Q 93 -> T 59 - -34
      Q 96 -> T 62 - -34
      Q 99 -> T 65 - -34
      Q 111 -> T 79 - -32
      Q 114 -> T 82 - -32
      Cluster 2:
      Q 153 -> T 95 - -58
      Q 156 -> T 98 - -58
      Q 159 -> T 101 - -58
      Cluster 3:
      Q 198 -> T 120 - -78
      Q 201 -> T 123 - -78
      Q 204 -> T 126 - -78
      Q 207 -> T 129 - -78
      Q 216 -> T 139 - -77
      Q 219 -> T 142 - -77
      Q 222 -> T 145 - -77
      Q 231 -> T 153 - -78
      Q 234 -> T 156 - -78
      Q 237 -> T 159 - -78
      Q 240 -> T 162 - -78
      Cluster 4:
      Q 246 -> T 178 - -68
      Q 249 -> T 181 - -68
      Q 252 -> T 184 - -68
      Q 255 -> T 187 - -68
      Q 258 -> T 190 - -68
      Q 261 -> T 193 - -68
      Q 262 -> T 194 - -68


com.milaboratory.core.alignment.kaligner2.KMapper2Test > test1111 STANDARD_OUT
      ID: 0
      Score: 1209
      Cluster 0:
      Q 9 -> T 15 - 6
      Q 12 -> T 18 - 6
      Q 15 -> T 21 - 6
      Q 18 -> T 24 - 6
      Q 21 -> T 27 - 6
      Q 24 -> T 30 - 6
      Q 27 -> T 33 - 6
      Q 30 -> T 36 - 6
      Q 33 -> T 39 - 6
      Cluster 1:
      Q 60 -> T 51 - -9
      Q 69 -> T 61 - -8
      Q 78 -> T 69 - -9
      Q 81 -> T 72 - -9
      Q 84 -> T 75 - -9
      Cluster 2:
      Q 123 -> T 89 - -34
      Q 126 -> T 92 - -34
      Q 129 -> T 95 - -34
      Q 132 -> T 98 - -34
      Q 135 -> T 101 - -34
      Q 150 -> T 116 - -34
      Q 171 -> T 135 - -36
      Q 174 -> T 138 - -36
      Q 177 -> T 141 - -36
      Q 180 -> T 144 - -36
      Q 183 -> T 147 - -36
      Q 185 -> T 149 - -36

	Gradle is still running, please be patient...

com.milaboratory.core.alignment.kaligner2.KMapper2Test > testRandom1 STANDARD_OUT
    noHits: 279
    noHits2: 0
    noHits3: 0
    wrongTopHit: 44
    wrongTopHitS: 33
    noCorrectHitInList: 24




    Timings:
    DescriptiveStatistics:
    n: 100000
    min: 36167.0
    max: 3.429470975E9
    mean: 616507.5305198506
    std dev: 1.3187345072383659E7
    median: 466960.0
    skewness: 195.94171272705825
    kurtosis: 47032.72944620415





    Clusters basicSize
    DescriptiveStatistics:
    n: 99677
    min: 1.0
    max: 7.0
    mean: 2.874775524945585
    std dev: 1.1083725853414113
    median: 3.0
    skewness: 0.277642954820058
    kurtosis: -0.7015571477916591





    Top Delta
    DescriptiveStatistics:
    n: 99697
    min: -24.0
    max: 0.0
    mean: -0.0011033431296830984
    std dev: 0.12833102365179114
    median: 0.0
    skewness: -130.14997250803614
    kurtosis: 18764.981167284237


com.milaboratory.core.alignment.kaligner2.KAligner2Test > testBoundaries STANDARD_OUT
    4956

com.milaboratory.core.alignment.kaligner2.KAligner2Test > caseJ1 STANDARD_OUT
    52
     0 TGATGCTTTTGATATCTGGGGCCAAGGGACAATGGTCACCGTCTCTTCAGGA 51
       ||||||||||||||||||||||||||||||||||||||||||||||||||| 
    55 TGATGCTTTTGATATCTGGGGCCAAGGGACAATGGTCACCGTCTCTTCAGGG 106
    [S51:A->G]
    (0->52)
    (55->107)

com.milaboratory.core.alignment.kaligner2.KAligner2Test > testCase0 SKIPPED

com.milaboratory.core.alignment.kaligner2.KAligner2Test > testSimpleRandomTest STANDARD_OUT
    Time per query: 12.02ms
    Processed queries: 5
    Bad percent: 0.0
    False positive percent: 0.36363636363636365
    Scoring error percent: 0.0

com.milaboratory.core.alignment.BandedAffineAlignerTest > test11 STANDARD_OUT
    0 --------------------- -1
    0 ATAAAAAAAAAAACGAGCTAG 20
    0 --------------------- -1
    0 ATAAAAAAAAAAACGAGCTAG 20

com.milaboratory.core.alignment.BandedAffineAlignerTest > test23 STANDARD_OUT
    0 atgcggggatgc 11
    0 atgcggggatgc 11

com.milaboratory.core.alignment.BandedAffineAlignerTest > test1 STANDARD_OUT
    0 at-----------cgagctagTTTTTTTTTTT 20
    0 atAAAAAAAAAAAcgagctag----------- 20
    0 at-----------cgagctagTTTTTTTTTTT 20
    0 atAAAAAAAAAAAcgagctag----------- 20

com.milaboratory.core.alignment.BandedAffineAlignerTest > test2 STANDARD_OUT
    0 atgcGGGGatgc 11
    0 atgcTA--atgc 9
    0 atgcGGGGatgc----------- 11
    0 atgcTA--atgcTTTTTTTTTTT 20

com.milaboratory.core.alignment.BandedAffineAlignerTest > test3 STANDARD_OUT
     0 cgtaGGGGcgta 11
    11 cgta--ATcgta 20
    0 -----------cgtaGGGGcgta 11
    0 TTTTTTTTTTTcgtaAT--cgta 20

com.milaboratory.core.alignment.BandedAffineAlignerTest > test4 STANDARD_OUT
    0 atgcggggat-gTTTTT 15
    0 atgcggggatAg----- 11
    0 atgcggggat-gTTTTTTT 17
    0 atgcggggatAg------- 11

com.milaboratory.core.alignment.BandedAffineAlignerTest > test5 STANDARD_OUT
    7 g-taggggcgta 17
    0 gAtaggggcgta 11

    0 TTTTTTTg-taggggcgta 17
    0 -------gAtaggggcgta 11

com.milaboratory.core.alignment.BandedAffineAlignerTest > test6 STANDARD_OUT
    0  0
    0  0

com.milaboratory.core.alignment.BandedAffineAlignerTest > semiGlobalLeft1 STANDARD_OUT
    0 gCccTtgtgatgacccagactccagcctccgtgGAGgCaGctgtgggaggcacagtcaccatcaagtgccaggccagtcagagcattagcaacctcttaGCCTGGTATCAGCAGAAACCAGGGCAGCCTCCCAAGCTCCTGATCTATTATGCATCCGATCTGGcatctggggtctcatcaaggttcaaaggcagtggatctgggacagagtAcactctcaccatcagTggcgtgcagtgtgccgatgctgccacttactac 260
    1 gAccCtgtgatgacccagactccagcctccgtgTCTgAaCctgtgggaggcacagtcaccatcaagtgccaggccagtcagagcattagcaacctctta-------------------------------------------------------------NNNcatctggggtctcatcaaggttcaaaggcagtggatctgggacagagtTcactctcaccatcagCggcgtgcagtgtgccgatgctgccacttactac 200

com.milaboratory.core.alignment.batch.SimpleBatchAlignerTest > test1 STANDARD_OUT
    4 hits.

com.milaboratory.core.alignment.blast.BlastAlignerTest > test1 SKIPPED

com.milaboratory.core.alignment.blast.BlastAlignerTest > simpleRandomTestT1 SKIPPED

com.milaboratory.core.alignment.blast.BlastAlignerTest > simpleRandomTestT2 SKIPPED

com.milaboratory.core.alignment.blast.BlastAlignerTest > simpleRandomTestT3 SKIPPED

com.milaboratory.core.alignment.blast.BlastDBBuilderTest > test1 SKIPPED

com.milaboratory.core.alignment.blast.BlastAlignerExtTest > test16SMicrobial1 SKIPPED

com.milaboratory.core.alignment.blast.BlastAlignerExtTest > test1 SKIPPED

com.milaboratory.core.alignment.AlignmentHelperTest > test1 STANDARD_OUT
        0 GAGGTGCAGCTGGTGGAGTCTGGGGGAGGC 29
          ||||||||||||||||||||||||||||||
        0 GAGGTGCAGCTGGTGGAGTCTGGGGGAGGC 29

       30 TTGGT-ACAGCCTGGGGGGTCCCTGAGACT 58
           |||| | |||||||||||||| |||||| 
       30 CTGGTCA-AGCCTGGGGGGTCCATGAGACA 58

       59 CTCCTGTGCAGCCTCTGGATTCACCTTCAG 88
          |||||||||||||||||||||| |||||||
       59 CTCCTGTGCAGCCTCTGGATTCCCCTTCAG 88

       89 TAGC-TATAGCATGAACTGGGTCCGCCAGG 117
          || | |||||||||||||||||||||||||
       89 TA-CTTATAGCATGAACTGGGTCCGCCAGG 117

      118 CTCCAGGGAAGGGGCTGGAGTGGGTTTCAT 147
          ||||||||||||||||||||||||| ||||
      118 CTCCAGGGAAGGGGCTGGAGTGGGTCTCAT 147

      148 ACATTAGTAGTAGTAGTAG-TACCATATAC 176
           |||||||||| ||||||| || |||||| 
      148 CCATTAGTAGTGGTAGTAGTTA-CATATAT 176

      177 TACGCAGACTCTGTGAAGGGCCGATTCACC 206
          ||||||||||| ||||||||||||||||||
      177 TACGCAGACTCCGTGAAGGGCCGATTCACC 206

      207 ATCTCCAGAGACAATGCCAAGAACTCACTG 236
          |||||||||||||| |||||||||||||||
      207 ATCTCCAGAGACAACGCCAAGAACTCACTG 236

      237 TATCTGCAAATGAACAGCCTGAGAGACGAG 266
          ||||||||||||||||||||||||| ||||
      237 TATCTGCAAATGAACAGCCTGAGAGCCGAG 266

      267 GACACGGCTGTGTATTACTGTGC 289
          |||||||||||||||||||||||
      267 GACACGGCTGTGTATTACTGTGC 289


com.milaboratory.core.alignment.MultiAlignmentHelperTest > test1 STANDARD_OUT
    8 AGACACAGATACA 20
      ||||||| |||||
    0 AGACACATATACA 12

    0 GATACATTAGACACAGATACA--- 20
              ||||||| |||||   
    0 --------AGACACATATACACAG 15

    0 GATACATTAGA---CACAGATACA 20
      |||||||||||   ||||||||||
    5 GATACATTAGAGACCACAGATACA 28

    0 GATAC-----ATTAGA---CACAGATACA 20
      |||||     ||||||   ||||||||||
    0 GATACGATACATTAGAGACCACAGATACA 28

    Quality   78778     878777   7778887878      
    Subject 0 GATAC-----ATTAGA---CACAGATACA--- 20 
     Query0 0              aga---cacaTataca    12
     Query1 0 -------------aga---cacaTatacaCAG 15
     Query2 5 gatac-----attagaGACcacagataca    28
     Query3 0 gatacGATACattagaGACcacagataca    28

    Quality   78778  
    Subject 0 GATAC 4 
     Query1 0 ----- 0
     Query2 5 gatac 9
     Query3 0 gatac 4

    Quality            
    Subject  5 ----- 5  
     Query1  0 ----- 0 
     Query2 10 ----- 10
     Query3  5 GATAC 9 

    Quality    87877   
    Subject  5 ATTAG 9  
     Query0  0    ag 1 
     Query1  0 ---ag 1 
     Query2 10 attag 14
     Query3 10 attag 14

    Quality    7   7   
    Subject 10 A---C 11 
     Query0  2 a---c 3 
     Query1  2 a---c 3 
     Query2 15 aGACc 19
     Query3 15 aGACc 19

    Quality    77888   
    Subject 12 ACAGA 16 
     Query0  4 acaTa 8 
     Query1  4 acaTa 8 
     Query2 20 acaga 24
     Query3 20 acaga 24

    Quality    7878    
    Subject 17 TACA- 20 
     Query0  9 taca  12
     Query1  9 tacaC 13
     Query2 25 taca  28
     Query3 25 taca  28

    Quality         
    Subject 21 -- 21 
     Query1 14 AG 15

     0 GATAC-----ATTAGA---CACAGATACA--- 20 
     0              ...---....T.....    12
     0 -------------...---....T.....CAG 15
     5 .....-----......GAC..........    28
     0 .....GATAC......GAC..........    28

       787788787777778887878   
     0 GATACATTAGACACAGATACA 20 

com.milaboratory.core.alignment.MultiAlignmentHelperTest > test2 STANDARD_OUT
    15 TATAGGGAGAACTCCGATCGACATCG 40
       |||||||||  |||||||||||||||
     0 TATAGGGAG--CTCCGATCGACATCG 23

    56 CGATCC--CGGTGACAAAGCGTTCGGACC 82
       ||||||  |||||||||||||||||||||
     0 CGATCCTTCGGTGACAAAGCGTTCGGACC 28

    36 CATCGGGTATCGCCCTGGTACG 57
       |||| |||||||||||||||||
     0 CATCAGGTATCGCCCTGGTACG 21

     0 AACGATGGGCGCAAATATAGGGAGAACTCCGATCGACATCGGGTATCGCCCTGGTACGATCC--CGGTGACAAAGCGTTCGGACCTGTCTGGACGCTAGAACGC 101 
     0                tatagggag--ctccgatcgacatcg                                                                23 
     0                                                         cgatccTTcggtgacaaagcgttcggacc                    28 
     0                                     catcAggtatcgccctggtacg                                               21 

com.milaboratory.core.alignment.BandedLinearAlignerTest > testCase1 STANDARD_OUT
    GCGTGAAGACTGCAGGCATTGAGTACGTTACTAGTCCAGTGGGGCCCAACCGTAACATTGCGTGTGACTGGTTGCTTAGCGGGTGACGGCGTTTCAGGTTACGCCCTCTGTGCATCACCGATAGCGTTGTTTGAGCTTTCTAACGTCTCAAACCTGCTTGCGCCCTACGGTTTCTCTATATATACACGAAAGGGGCTGGTCGCAACCTCGCAATTCTATCCCTCCAACCTCCCTCGAATTTTT
    AAAGCGTGAAGACTTGCAGGCATTGGTACGTTATTAGTCCAGTGGGGCCACAACCGTAACATTGCGTGTGACTGGTGCTTAGCGGGTGACGGCGTTCAGGTTACGCCCTCTGTGCATCACCGATTAGCGTTGTCTGAGCTTTCTAACGTCTCAAACCTGCTTGCGCCCTACGGTTTCTCTATAGTATCACGAAAGGGTCTGGTCGCAACCTCGCAATTCTATCCCTCCAACCTCCCTTGAATTTTTCTA

com.milaboratory.core.alignment.BandedLinearAlignerTest > testGlobal1 STANDARD_OUT
    1 AATTGACA 8
       |||||| 
    0 TATTGACT 7

com.milaboratory.core.alignment.BandedLinearAlignerTest > testGlobal2 STANDARD_OUT
    1 AATTGACAG 9
       |||||| |
    0 TATTGAC-G 7

com.milaboratory.core.alignment.BandedLinearAlignerTest > testGlobal3 STANDARD_OUT
    0 TATTGACT 7
       |||||| 
    1 AATTGACA 8

com.milaboratory.core.alignment.BandedLinearAlignerTest > testGlobal4 STANDARD_OUT
    0 TATTGAC-G 7
       |||||| |
    1 AATTGACAG 9

com.milaboratory.core.alignment.kaligner1.KMapperTest > testBestOffset2 STANDARD_OUT
    -205

com.milaboratory.core.alignment.kaligner1.KAlignerTest > testRandomCorrectness STANDARD_OUT
    C=1182;I=0;M=0;ScE=0;R=0.0 AlignmentTime = 821.38us
    C=1642;I=1;M=0;ScE=0;R=0.0 AlignmentTime = 807.44us
    C=2048;I=0;M=0;ScE=0;R=0.0 AlignmentTime = 530.32us
    C=2142;I=0;M=0;ScE=0;R=8.333333333333333E-7 AlignmentTime = 540.72us

com.milaboratory.core.alignment.kaligner1.KAlignerTest > testRandom1 STANDARD_OUT
    ##teamcity[buildStatisticValue key='kmFound' value='0.9449']
    ##teamcity[buildStatisticValue key='kmWrong' value='1.0E-4']
    ##teamcity[buildStatisticValue key='kmFalse' value='0.0058']

com.milaboratory.core.alignment.kaligner1.KAlignerTest > testRandomCorrectnessConcurrent STANDARD_OUT
    C=2999;I=0;M=0;ScE=1;R=0.0 AlignmentTime = 965.30us
    C=2999;I=0;M=0;ScE=0;R=0.0 AlignmentTime = 1.07ms
    C=3000;I=0;M=0;ScE=0;R=0.0 AlignmentTime = 946.47us
    C=2998;I=0;M=0;ScE=0;R=0.0 AlignmentTime = 1.11ms
Gradle Test Executor 1 finished executing tests.
WARNING: A terminally deprecated method in java.lang.System has been called
WARNING: System::setSecurityManager has been called by org.gradle.api.internal.tasks.testing.worker.TestWorker (file:/usr/share/gradle/lib/plugins/gradle-testing-base-4.4.1.jar)
WARNING: Please consider reporting this to the maintainers of org.gradle.api.internal.tasks.testing.worker.TestWorker
WARNING: System::setSecurityManager will be removed in a future release
Finished generating test XML results (0.585 secs) into: /build/reproducible-path/milib-2.2.0+dfsg/build/test-results/test
Generating HTML test report...
Finished generating test html results (0.979 secs) into: /build/reproducible-path/milib-2.2.0+dfsg/build/reports/tests/test
:test (Thread[Task worker for ':',5,main]) completed. Took 23 mins 2.449 secs.

BUILD SUCCESSFUL in 25m 14s
5 actionable tasks: 3 executed, 2 up-to-date
   create-stamp debian/debhelper-build-stamp
   dh_prep
   dh_auto_install --destdir=debian/libmilib-java/
   mh_install
   jh_installjavadoc
   dh_installdocs
   dh_installchangelogs
   dh_perl
   dh_link
   jh_installlibs
   jh_classpath
   jh_manifest
   jh_depends
   dh_strip_nondeterminism
   dh_compress
   dh_fixperms
   dh_missing
   dh_installdeb
   dh_gencontrol
   dh_md5sums
   dh_builddeb
dpkg-deb: building package 'libmilib-java' in '../libmilib-java_2.2.0+dfsg-1_all.deb'.
 dpkg-genbuildinfo --build=binary -O../milib_2.2.0+dfsg-1_armhf.buildinfo
 dpkg-genchanges --build=binary -O../milib_2.2.0+dfsg-1_armhf.changes
dpkg-genchanges: info: binary-only upload (no source code included)
 dpkg-source --after-build .
dpkg-buildpackage: info: binary-only upload (no source included)
dpkg-genchanges: info: including full source code in upload
I: copying local configuration
I: unmounting dev/ptmx filesystem
I: unmounting dev/pts filesystem
I: unmounting dev/shm filesystem
I: unmounting proc filesystem
I: unmounting sys filesystem
I: cleaning the build env 
I: removing directory /srv/workspace/pbuilder/31058 and its subdirectories
I: Current time: Fri May 17 08:31:39 -12 2024
I: pbuilder-time-stamp: 1715977899