I: pbuilder: network access will be disabled during build I: Current time: Wed Jan 7 19:34:46 +14 2026 I: pbuilder-time-stamp: 1767764086 I: Building the build Environment I: extracting base tarball [/var/cache/pbuilder/trixie-reproducible-base.tgz] I: copying local configuration W: --override-config is not set; not updating apt.conf Read the manpage for details. I: mounting /proc filesystem I: mounting /sys filesystem I: creating /{dev,run}/shm I: mounting /dev/pts filesystem I: redirecting /dev/ptmx to /dev/pts/ptmx I: policy-rc.d already exists I: using eatmydata during job I: Copying source file I: copying [bioperl-run_1.7.3-13.dsc] I: copying [./bioperl-run_1.7.3.orig.tar.gz] I: copying [./bioperl-run_1.7.3-13.debian.tar.xz] I: Extracting source gpgv: Signature made Sun Dec 1 10:21:27 2024 gpgv: using RSA key 8F91B227C7D6F2B1948C8236793CF67E8F0D11DA gpgv: issuer "emollier@debian.org" gpgv: Can't check signature: No public key dpkg-source: warning: cannot verify inline signature for ./bioperl-run_1.7.3-13.dsc: no acceptable signature found dpkg-source: info: extracting bioperl-run in bioperl-run-1.7.3 dpkg-source: info: unpacking bioperl-run_1.7.3.orig.tar.gz dpkg-source: info: unpacking bioperl-run_1.7.3-13.debian.tar.xz dpkg-source: info: using patch list from debian/patches/series dpkg-source: info: applying Extract_version_from_BEDTools_properly.patch dpkg-source: info: applying skip_tests_for_RemoteBlast_rpsblast.patch dpkg-source: info: applying skip_tests_for_RemoteBlast.patch dpkg-source: info: applying kalign-input-via-piping.patch dpkg-source: info: applying kalign-version-regex.patch dpkg-source: info: applying skip_tests_for_wise.patch dpkg-source: info: applying skip_tests_for_phylip.patch dpkg-source: info: applying skip_tests_for_phyml.patch dpkg-source: info: applying skip_tests_for_infernal.patch dpkg-source: info: applying skip_tests_for_ncbi-blast+.patch dpkg-source: info: applying hyphy.patch dpkg-source: info: applying remove_tests_for_ensembl.patch dpkg-source: info: applying skip_tests_for_soap.patch dpkg-source: info: applying get-overlap.patch dpkg-source: info: applying alternate-data.patch dpkg-source: info: applying skip-test-for-kalign.patch dpkg-source: info: applying fix-whatis-entries.patch dpkg-source: info: applying unscramble-erpin.patch dpkg-source: info: applying fix-pod-conversion.patch dpkg-source: info: applying adjust-muscle-test.patch dpkg-source: info: applying update-blastdbcmd-error-output.patch I: Not using root during the build. I: Installing the build-deps I: user script /srv/workspace/pbuilder/12030/tmp/hooks/D01_modify_environment starting debug: Running on infom08-i386. I: Changing host+domainname to test build reproducibility I: Adding a custom variable just for the fun of it... I: Changing /bin/sh to bash '/bin/sh' -> '/bin/bash' lrwxrwxrwx 1 root root 9 Jan 7 05:35 /bin/sh -> /bin/bash I: Setting pbuilder2's login shell to /bin/bash I: Setting pbuilder2's GECOS to second user,second room,second work-phone,second home-phone,second other I: user script /srv/workspace/pbuilder/12030/tmp/hooks/D01_modify_environment finished I: user script /srv/workspace/pbuilder/12030/tmp/hooks/D02_print_environment starting I: set BASH=/bin/sh BASHOPTS=checkwinsize:cmdhist:complete_fullquote:extquote:force_fignore:globasciiranges:globskipdots:hostcomplete:interactive_comments:patsub_replacement:progcomp:promptvars:sourcepath BASH_ALIASES=() BASH_ARGC=() BASH_ARGV=() BASH_CMDS=() BASH_LINENO=([0]="12" [1]="0") BASH_LOADABLES_PATH=/usr/local/lib/bash:/usr/lib/bash:/opt/local/lib/bash:/usr/pkg/lib/bash:/opt/pkg/lib/bash:. BASH_SOURCE=([0]="/tmp/hooks/D02_print_environment" [1]="/tmp/hooks/D02_print_environment") BASH_VERSINFO=([0]="5" [1]="2" [2]="32" [3]="1" [4]="release" [5]="i686-pc-linux-gnu") BASH_VERSION='5.2.32(1)-release' BUILDDIR=/build/reproducible-path BUILDUSERGECOS='second user,second room,second work-phone,second home-phone,second other' BUILDUSERNAME=pbuilder2 BUILD_ARCH=i386 DEBIAN_FRONTEND=noninteractive DEB_BUILD_OPTIONS='buildinfo=+all reproducible=+all parallel=5 ' DIRSTACK=() DISTRIBUTION=trixie EUID=0 FUNCNAME=([0]="Echo" [1]="main") GROUPS=() HOME=/root HOSTNAME=i-capture-the-hostname HOSTTYPE=i686 HOST_ARCH=i386 IFS=' ' INVOCATION_ID=8fab9c47e71e4d93abaaa85872d6ee63 LANG=C LANGUAGE=de_CH:de LC_ALL=C LD_LIBRARY_PATH=/usr/lib/libeatmydata LD_PRELOAD=libeatmydata.so MACHTYPE=i686-pc-linux-gnu MAIL=/var/mail/root OPTERR=1 OPTIND=1 OSTYPE=linux-gnu PATH=/usr/sbin:/usr/bin:/sbin:/bin:/usr/games:/i/capture/the/path PBCURRENTCOMMANDLINEOPERATION=build PBUILDER_OPERATION=build PBUILDER_PKGDATADIR=/usr/share/pbuilder PBUILDER_PKGLIBDIR=/usr/lib/pbuilder PBUILDER_SYSCONFDIR=/etc PIPESTATUS=([0]="0") POSIXLY_CORRECT=y PPID=12030 PS4='+ ' PWD=/ SHELL=/bin/bash SHELLOPTS=braceexpand:errexit:hashall:interactive-comments:posix SHLVL=3 SUDO_COMMAND='/usr/bin/timeout -k 24.1h 24h /usr/bin/ionice -c 3 /usr/bin/nice -n 11 /usr/bin/unshare --uts -- /usr/sbin/pbuilder --build --configfile /srv/reproducible-results/rbuild-debian/r-b-build.5VMkDCer/pbuilderrc_G4jV --distribution trixie --hookdir /etc/pbuilder/rebuild-hooks --debbuildopts -b --basetgz /var/cache/pbuilder/trixie-reproducible-base.tgz --buildresult /srv/reproducible-results/rbuild-debian/r-b-build.5VMkDCer/b2 --logfile b2/build.log bioperl-run_1.7.3-13.dsc' SUDO_GID=111 SUDO_UID=104 SUDO_USER=jenkins TERM=unknown TZ=/usr/share/zoneinfo/Etc/GMT-14 UID=0 USER=root _='I: set' I: uname -a Linux i-capture-the-hostname 6.11.5+bpo-amd64 #1 SMP PREEMPT_DYNAMIC Debian 6.11.5-1~bpo12+1 (2024-11-11) x86_64 GNU/Linux I: ls -l /bin lrwxrwxrwx 1 root root 7 Nov 22 2024 /bin -> usr/bin I: user script /srv/workspace/pbuilder/12030/tmp/hooks/D02_print_environment finished -> Attempting to satisfy build-dependencies -> Creating pbuilder-satisfydepends-dummy package Package: pbuilder-satisfydepends-dummy Version: 0.invalid.0 Architecture: i386 Maintainer: Debian Pbuilder Team Description: Dummy package to satisfy dependencies with aptitude - created by pbuilder This package was created automatically by pbuilder to satisfy the build-dependencies of the package being currently built. Depends: debhelper-compat (= 13), libmodule-build-perl, perl, bioperl (>= 1.7.4), libalgorithm-diff-perl, libipc-run-perl, libio-string-perl, libxml-twig-perl, libfile-sort-perl, libtest-most-perl, libarray-compare-perl, libtree-dagnode-perl, libbio-cluster-perl, libbio-featureio-perl, libconfig-any-perl, libbio-eutilities-perl, libbio-tools-run-remoteblast-perl, amap-align, bedtools-test, ncbi-blast+-legacy, libbio-perl-perl, exonerate, hmmer, hyphy-pt, infernal, kalign, mafft, muscle, ncoils, phyml, primer3, probcons, raxml, sim4, wise, fasttree, lagan, pal2nal, libwww-perl dpkg-deb: building package 'pbuilder-satisfydepends-dummy' in '/tmp/satisfydepends-aptitude/pbuilder-satisfydepends-dummy.deb'. Selecting previously unselected package pbuilder-satisfydepends-dummy. (Reading database ... 19956 files and directories currently installed.) Preparing to unpack .../pbuilder-satisfydepends-dummy.deb ... Unpacking pbuilder-satisfydepends-dummy (0.invalid.0) ... dpkg: pbuilder-satisfydepends-dummy: dependency problems, but configuring anyway as you requested: pbuilder-satisfydepends-dummy depends on debhelper-compat (= 13); however: Package debhelper-compat is not installed. pbuilder-satisfydepends-dummy depends on libmodule-build-perl; however: Package libmodule-build-perl is not installed. pbuilder-satisfydepends-dummy depends on bioperl (>= 1.7.4); however: Package bioperl is not installed. pbuilder-satisfydepends-dummy depends on libalgorithm-diff-perl; however: Package libalgorithm-diff-perl is not installed. pbuilder-satisfydepends-dummy depends on libipc-run-perl; however: Package libipc-run-perl is not installed. pbuilder-satisfydepends-dummy depends on libio-string-perl; however: Package libio-string-perl is not installed. pbuilder-satisfydepends-dummy depends on libxml-twig-perl; however: Package libxml-twig-perl is not installed. pbuilder-satisfydepends-dummy depends on libfile-sort-perl; however: Package libfile-sort-perl is not installed. pbuilder-satisfydepends-dummy depends on libtest-most-perl; however: Package libtest-most-perl is not installed. pbuilder-satisfydepends-dummy depends on libarray-compare-perl; however: Package libarray-compare-perl is not installed. pbuilder-satisfydepends-dummy depends on libtree-dagnode-perl; however: Package libtree-dagnode-perl is not installed. pbuilder-satisfydepends-dummy depends on libbio-cluster-perl; however: Package libbio-cluster-perl is not installed. pbuilder-satisfydepends-dummy depends on libbio-featureio-perl; however: Package libbio-featureio-perl is not installed. pbuilder-satisfydepends-dummy depends on libconfig-any-perl; however: Package libconfig-any-perl is not installed. pbuilder-satisfydepends-dummy depends on libbio-eutilities-perl; however: Package libbio-eutilities-perl is not installed. pbuilder-satisfydepends-dummy depends on libbio-tools-run-remoteblast-perl; however: Package libbio-tools-run-remoteblast-perl is not installed. pbuilder-satisfydepends-dummy depends on amap-align; however: Package amap-align is not installed. pbuilder-satisfydepends-dummy depends on bedtools-test; however: Package bedtools-test is not installed. pbuilder-satisfydepends-dummy depends on ncbi-blast+-legacy; however: Package ncbi-blast+-legacy is not installed. pbuilder-satisfydepends-dummy depends on libbio-perl-perl; however: Package libbio-perl-perl is not installed. pbuilder-satisfydepends-dummy depends on exonerate; however: Package exonerate is not installed. pbuilder-satisfydepends-dummy depends on hmmer; however: Package hmmer is not installed. pbuilder-satisfydepends-dummy depends on hyphy-pt; however: Package hyphy-pt is not installed. pbuilder-satisfydepends-dummy depends on infernal; however: Package infernal is not installed. pbuilder-satisfydepends-dummy depends on kalign; however: Package kalign is not installed. pbuilder-satisfydepends-dummy depends on mafft; however: Package mafft is not installed. pbuilder-satisfydepends-dummy depends on muscle; however: Package muscle is not installed. pbuilder-satisfydepends-dummy depends on ncoils; however: Package ncoils is not installed. pbuilder-satisfydepends-dummy depends on phyml; however: Package phyml is not installed. pbuilder-satisfydepends-dummy depends on primer3; however: Package primer3 is not installed. pbuilder-satisfydepends-dummy depends on probcons; however: Package probcons is not installed. pbuilder-satisfydepends-dummy depends on raxml; however: Package raxml is not installed. pbuilder-satisfydepends-dummy depends on sim4; however: Package sim4 is not installed. pbuilder-satisfydepends-dummy depends on wise; however: Package wise is not installed. pbuilder-satisfydepends-dummy depends on fasttree; however: Package fasttree is not installed. pbuilder-satisfydepends-dummy depends on lagan; however: Package lagan is not installed. pbuilder-satisfydepends-dummy depends on pal2nal; however: Package pal2nal is not installed. pbuilder-satisfydepends-dummy depends on libwww-perl; however: Package libwww-perl is not installed. Setting up pbuilder-satisfydepends-dummy (0.invalid.0) ... Reading package lists... Building dependency tree... Reading state information... Initializing package states... Writing extended state information... Building tag database... pbuilder-satisfydepends-dummy is already installed at the requested version (0.invalid.0) pbuilder-satisfydepends-dummy is already installed at the requested version (0.invalid.0) The following NEW packages will be installed: amap-align{a} autoconf{a} automake{a} autopoint{a} autotools-dev{a} bedtools-test{a} bioperl{a} bsdextrautils{a} ca-certificates{a} debhelper{a} dh-autoreconf{a} dh-strip-nondeterminism{a} dwz{a} exonerate{a} fasttree{a} file{a} gettext{a} gettext-base{a} groff-base{a} hmmer{a} hyphy-common{a} hyphy-pt{a} infernal{a} intltool-debian{a} kalign{a} lagan{a} libalgorithm-diff-perl{a} libarchive-zip-perl{a} libarray-compare-perl{a} libb-hooks-op-check-perl{a} libbio-asn1-entrezgene-perl{a} libbio-cluster-perl{a} libbio-eutilities-perl{a} libbio-featureio-perl{a} libbio-perl-perl{a} libbio-tools-run-remoteblast-perl{a} libbio-variation-perl{a} libbrotli1{a} libcapture-tiny-perl{a} libcbor0.10{a} libclass-data-inheritable-perl{a} libclass-method-modifiers-perl{a} libclass-xsaccessor-perl{a} libclone-perl{a} libcom-err2{a} libconfig-any-perl{a} libcurl3t64-gnutls{a} libdata-stag-perl{a} libdebhelper-perl{a} libdevel-callchecker-perl{a} libdevel-stacktrace-perl{a} libdivsufsort3{a} libdynaloader-functions-perl{a} libedit2{a} libelf1t64{a} libencode-locale-perl{a} libevent-core-2.1-7t64{a} libevent-pthreads-2.1-7t64{a} libexception-class-perl{a} libexpat1{a} libexporter-tiny-perl{a} libfabric1{a} libfido2-1{a} libfile-listing-perl{a} libfile-slurp-tiny-perl{a} libfile-sort-perl{a} libfile-stripnondeterminism-perl{a} libglib2.0-0t64{a} libgssapi-krb5-2{a} libhtml-parser-perl{a} libhtml-tagset-perl{a} libhtml-tree-perl{a} libhttp-cookies-perl{a} libhttp-date-perl{a} libhttp-message-perl{a} libhttp-negotiate-perl{a} libhwloc-plugins{a} libhwloc15{a} libibverbs1{a} libicu72{a} libimport-into-perl{a} libio-html-perl{a} libio-pty-perl{a} libio-socket-ssl-perl{a} libio-string-perl{a} libipc-run-perl{a} libk5crypto3{a} libkeyutils1{a} libkrb5-3{a} libkrb5support0{a} libldap-2.5-0{a} liblmdb0{a} liblwp-mediatypes-perl{a} liblwp-protocol-https-perl{a} libmagic-mgc{a} libmagic1t64{a} libmbedcrypto16{a} libmbedtls21{a} libmbedx509-7{a} libmodule-build-perl{a} libmodule-pluggable-perl{a} libmodule-runtime-perl{a} libmoo-perl{a} libnet-http-perl{a} libnet-ssleay-perl{a} libnghttp2-14{a} libnghttp3-9{a} libngtcp2-16{a} libngtcp2-crypto-gnutls8{a} libnl-3-200{a} libnl-route-3-200{a} libnsl2{a} libopenmpi3t64{a} libparams-classify-perl{a} libpciaccess0{a} libpipeline1{a} libpsl5t64{a} libpsm-infinipath1{a} libpython3-stdlib{a} libpython3.12-minimal{a} libpython3.12-stdlib{a} librdmacm1t64{a} libreadline8t64{a} librole-tiny-perl{a} librtmp1{a} libsasl2-2{a} libsasl2-modules-db{a} libssh2-1t64{a} libsub-quote-perl{a} libsub-uplevel-perl{a} libtest-deep-perl{a} libtest-differences-perl{a} libtest-exception-perl{a} libtest-most-perl{a} libtest-warn-perl{a} libtext-csv-perl{a} libtext-diff-perl{a} libtimedate-perl{a} libtirpc-common{a} libtirpc3t64{a} libtool{a} libtree-dagnode-perl{a} libtry-tiny-perl{a} libtype-tiny-perl{a} libuchardet0{a} liburi-perl{a} libuv1t64{a} libwww-perl{a} libwww-robotrules-perl{a} libx11-6{a} libx11-data{a} libxau6{a} libxcb1{a} libxdmcp6{a} libxext6{a} libxml-dom-perl{a} libxml-dom-xpath-perl{a} libxml-libxml-perl{a} libxml-namespacesupport-perl{a} libxml-parser-perl{a} libxml-perl{a} libxml-regexp-perl{a} libxml-sax-base-perl{a} libxml-sax-perl{a} libxml-simple-perl{a} libxml-twig-perl{a} libxml-writer-perl{a} libxml-xpathengine-perl{a} libxml2{a} libxnvctrl0{a} m4{a} mafft{a} man-db{a} media-types{a} muscle{a} ncbi-blast+{a} ncbi-blast+-legacy{a} ncbi-data{a} ncoils{a} netbase{a} ocl-icd-libopencl1{a} openmpi-bin{a} openmpi-common{a} openssh-client{a} openssl{a} pal2nal{a} perl-openssl-defaults{a} phyml{a} po-debconf{a} primer3{a} probcons{a} python3{a} python3-minimal{a} python3.12{a} python3.12-minimal{a} raxml{a} readline-common{a} sensible-utils{a} sim4{a} tzdata{a} ucf{a} wise{a} wise-data{a} The following packages are RECOMMENDED but will NOT be installed: bioperl-run curl ibverbs-providers krb5-locales libace-perl libalgorithm-diff-xs-perl libalgorithm-munkres-perl libapache-dbi-perl libarchive-cpio-perl libbio-perl-run-perl libcache-cache-perl libconfig-general-perl libconfig-tiny-perl libconvert-binary-c-perl libdata-dump-perl libdbd-mysql-perl libdbd-pg-perl libdbd-sqlite3-perl libdbi-perl libgd-perl libglib2.0-data libgraph-perl libgraphviz-perl libhtml-form-perl libhtml-format-perl libhtml-tableextract-perl libhttp-daemon-perl libio-compress-brotli-perl libldap-common liblist-moreutils-perl libltdl-dev libmail-sendmail-perl libmailtools-perl libmldbm-perl libmodule-signature-perl libnamespace-clean-perl libpod-readme-perl libpostscript-perl libref-util-perl libsasl2-modules libset-scalar-perl libsoap-lite-perl libsoftware-license-perl libsort-naturally-perl libspreadsheet-parseexcel-perl libspreadsheet-writeexcel-perl libsvg-graph-perl libsvg-perl libtext-csv-xs-perl libtext-iconv-perl libtie-ixhash-perl libtype-tiny-xs-perl libxml-libxslt-perl libxml-sax-expat-perl libxml-sax-writer-perl libxstring-perl libyaml-libyaml-perl libyaml-perl libyaml-syck-perl lynx paml perl-doc perl-tk publicsuffix ruby shared-mime-info wget xauth xdg-user-dirs 0 packages upgraded, 203 newly installed, 0 to remove and 0 not upgraded. Need to get 96.0 MB of archives. After unpacking 433 MB will be used. Writing extended state information... Get: 1 http://deb.debian.org/debian trixie/main i386 libpython3.12-minimal i386 3.12.7-3 [814 kB] Get: 2 http://deb.debian.org/debian trixie/main i386 libexpat1 i386 2.6.4-1 [107 kB] Get: 3 http://deb.debian.org/debian trixie/main i386 python3.12-minimal i386 3.12.7-3 [2236 kB] Get: 4 http://deb.debian.org/debian trixie/main i386 python3-minimal i386 3.12.6-1 [26.7 kB] Get: 5 http://deb.debian.org/debian trixie/main i386 media-types all 10.1.0 [26.9 kB] Get: 6 http://deb.debian.org/debian trixie/main i386 netbase all 6.4 [12.8 kB] Get: 7 http://deb.debian.org/debian trixie/main i386 tzdata all 2024b-3 [255 kB] Get: 8 http://deb.debian.org/debian trixie/main i386 libkrb5support0 i386 1.21.3-3 [34.9 kB] Get: 9 http://deb.debian.org/debian trixie/main i386 libcom-err2 i386 1.47.1-1+b1 [23.4 kB] Get: 10 http://deb.debian.org/debian trixie/main i386 libk5crypto3 i386 1.21.3-3 [83.6 kB] Get: 11 http://deb.debian.org/debian trixie/main i386 libkeyutils1 i386 1.6.3-4 [9600 B] Get: 12 http://deb.debian.org/debian trixie/main i386 libkrb5-3 i386 1.21.3-3 [350 kB] Get: 13 http://deb.debian.org/debian trixie/main i386 libgssapi-krb5-2 i386 1.21.3-3 [146 kB] Get: 14 http://deb.debian.org/debian trixie/main i386 libtirpc-common all 1.3.4+ds-1.3 [10.9 kB] Get: 15 http://deb.debian.org/debian trixie/main i386 libtirpc3t64 i386 1.3.4+ds-1.3+b1 [90.5 kB] Get: 16 http://deb.debian.org/debian trixie/main i386 libnsl2 i386 1.3.0-3+b3 [42.7 kB] Get: 17 http://deb.debian.org/debian trixie/main i386 readline-common all 8.2-5 [69.3 kB] Get: 18 http://deb.debian.org/debian trixie/main i386 libreadline8t64 i386 8.2-5 [173 kB] Get: 19 http://deb.debian.org/debian trixie/main i386 libpython3.12-stdlib i386 3.12.7-3 [1964 kB] Get: 20 http://deb.debian.org/debian trixie/main i386 python3.12 i386 3.12.7-3 [671 kB] Get: 21 http://deb.debian.org/debian trixie/main i386 libpython3-stdlib i386 3.12.6-1 [9692 B] Get: 22 http://deb.debian.org/debian trixie/main i386 python3 i386 3.12.6-1 [27.8 kB] Get: 23 http://deb.debian.org/debian trixie/main i386 sensible-utils all 0.0.24 [24.8 kB] Get: 24 http://deb.debian.org/debian trixie/main i386 openssl i386 3.3.2-2 [1387 kB] Get: 25 http://deb.debian.org/debian trixie/main i386 ca-certificates all 20240203 [158 kB] Get: 26 http://deb.debian.org/debian trixie/main i386 libmagic-mgc i386 1:5.45-3+b1 [314 kB] Get: 27 http://deb.debian.org/debian trixie/main i386 libmagic1t64 i386 1:5.45-3+b1 [115 kB] Get: 28 http://deb.debian.org/debian trixie/main i386 file i386 1:5.45-3+b1 [43.2 kB] Get: 29 http://deb.debian.org/debian trixie/main i386 gettext-base i386 0.22.5-2 [201 kB] Get: 30 http://deb.debian.org/debian trixie/main i386 libuchardet0 i386 0.0.8-1+b2 [69.2 kB] Get: 31 http://deb.debian.org/debian trixie/main i386 groff-base i386 1.23.0-5 [1196 kB] Get: 32 http://deb.debian.org/debian trixie/main i386 bsdextrautils i386 2.40.2-11 [95.6 kB] Get: 33 http://deb.debian.org/debian trixie/main i386 libpipeline1 i386 1.5.8-1 [41.2 kB] Get: 34 http://deb.debian.org/debian trixie/main i386 man-db i386 2.13.0-1 [1428 kB] Get: 35 http://deb.debian.org/debian trixie/main i386 libedit2 i386 3.1-20240808-1 [98.0 kB] Get: 36 http://deb.debian.org/debian trixie/main i386 libcbor0.10 i386 0.10.2-2 [30.9 kB] Get: 37 http://deb.debian.org/debian trixie/main i386 libfido2-1 i386 1.15.0-1+b1 [88.5 kB] Get: 38 http://deb.debian.org/debian trixie/main i386 openssh-client i386 1:9.9p1-3 [1020 kB] Get: 39 http://deb.debian.org/debian trixie/main i386 ucf all 3.0043+nmu1 [55.2 kB] Get: 40 http://deb.debian.org/debian trixie/main i386 amap-align i386 2.2+git20080214.600fc29+dfsg-2 [115 kB] Get: 41 http://deb.debian.org/debian trixie/main i386 m4 i386 1.4.19-4 [293 kB] Get: 42 http://deb.debian.org/debian trixie/main i386 autoconf all 2.72-3 [493 kB] Get: 43 http://deb.debian.org/debian trixie/main i386 autotools-dev all 20220109.1 [51.6 kB] Get: 44 http://deb.debian.org/debian trixie/main i386 automake all 1:1.16.5-1.3 [823 kB] Get: 45 http://deb.debian.org/debian trixie/main i386 autopoint all 0.22.5-2 [723 kB] Get: 46 http://deb.debian.org/debian trixie/main i386 bedtools-test all 2.31.1+dfsg-2 [10.9 MB] Get: 47 http://deb.debian.org/debian trixie/main i386 libio-string-perl all 1.08-4 [12.1 kB] Get: 48 http://deb.debian.org/debian trixie/main i386 libdata-stag-perl all 0.14-3 [448 kB] Get: 49 http://deb.debian.org/debian trixie/main i386 libbio-perl-perl all 1.7.8-1 [2603 kB] Get: 50 http://deb.debian.org/debian trixie/main i386 libclass-data-inheritable-perl all 0.10-1 [8632 B] Get: 51 http://deb.debian.org/debian trixie/main i386 libdevel-stacktrace-perl all 2.0500-1 [26.4 kB] Get: 52 http://deb.debian.org/debian trixie/main i386 libexception-class-perl all 1.45-1 [34.6 kB] Get: 53 http://deb.debian.org/debian trixie/main i386 libtest-deep-perl all 1.204-1 [52.9 kB] Get: 54 http://deb.debian.org/debian trixie/main i386 libcapture-tiny-perl all 0.48-2 [24.6 kB] Get: 55 http://deb.debian.org/debian trixie/main i386 libalgorithm-diff-perl all 1.201-1 [43.3 kB] Get: 56 http://deb.debian.org/debian trixie/main i386 libtext-diff-perl all 1.45-2 [27.2 kB] Get: 57 http://deb.debian.org/debian trixie/main i386 libtest-differences-perl all 0.71-1 [17.9 kB] Get: 58 http://deb.debian.org/debian trixie/main i386 libsub-uplevel-perl all 0.2800-3 [14.0 kB] Get: 59 http://deb.debian.org/debian trixie/main i386 libtest-exception-perl all 0.43-3 [16.9 kB] Get: 60 http://deb.debian.org/debian trixie/main i386 libtest-warn-perl all 0.37-2 [14.5 kB] Get: 61 http://deb.debian.org/debian trixie/main i386 libtest-most-perl all 0.38-1 [25.1 kB] Get: 62 http://deb.debian.org/debian trixie/main i386 bioperl all 1.7.8-1 [246 kB] Get: 63 http://deb.debian.org/debian trixie/main i386 libdebhelper-perl all 13.20 [89.7 kB] Get: 64 http://deb.debian.org/debian trixie/main i386 libtool all 2.4.7-8 [517 kB] Get: 65 http://deb.debian.org/debian trixie/main i386 dh-autoreconf all 20 [17.1 kB] Get: 66 http://deb.debian.org/debian trixie/main i386 libarchive-zip-perl all 1.68-1 [104 kB] Get: 67 http://deb.debian.org/debian trixie/main i386 libfile-stripnondeterminism-perl all 1.14.0-1 [19.5 kB] Get: 68 http://deb.debian.org/debian trixie/main i386 dh-strip-nondeterminism all 1.14.0-1 [8448 B] Get: 69 http://deb.debian.org/debian trixie/main i386 libelf1t64 i386 0.192-4 [195 kB] Get: 70 http://deb.debian.org/debian trixie/main i386 dwz i386 0.15-1+b1 [116 kB] Get: 71 http://deb.debian.org/debian trixie/main i386 libicu72 i386 72.1-5+b1 [9583 kB] Get: 72 http://deb.debian.org/debian trixie/main i386 libxml2 i386 2.12.7+dfsg+really2.9.14-0.2+b1 [734 kB] Get: 73 http://deb.debian.org/debian trixie/main i386 gettext i386 0.22.5-2 [1631 kB] Get: 74 http://deb.debian.org/debian trixie/main i386 intltool-debian all 0.35.0+20060710.6 [22.9 kB] Get: 75 http://deb.debian.org/debian trixie/main i386 po-debconf all 1.0.21+nmu1 [248 kB] Get: 76 http://deb.debian.org/debian trixie/main i386 debhelper all 13.20 [915 kB] Get: 77 http://deb.debian.org/debian trixie/main i386 libglib2.0-0t64 i386 2.82.2-3 [1571 kB] Get: 78 http://deb.debian.org/debian trixie/main i386 exonerate i386 2.4.0-5+b1 [2077 kB] Get: 79 http://deb.debian.org/debian trixie/main i386 fasttree i386 2.1.11-2 [183 kB] Get: 80 http://deb.debian.org/debian trixie/main i386 libdivsufsort3 i386 2.0.1-6+b1 [50.0 kB] Get: 81 http://deb.debian.org/debian trixie/main i386 hmmer i386 3.4+dfsg-2 [1094 kB] Get: 82 http://deb.debian.org/debian trixie/main i386 hyphy-common all 2.5.62+dfsg-1 [607 kB] Get: 83 http://deb.debian.org/debian trixie/main i386 libbrotli1 i386 1.1.0-2+b6 [308 kB] Get: 84 http://deb.debian.org/debian trixie/main i386 libsasl2-modules-db i386 2.1.28+dfsg1-8 [20.6 kB] Get: 85 http://deb.debian.org/debian trixie/main i386 libsasl2-2 i386 2.1.28+dfsg1-8 [61.0 kB] Get: 86 http://deb.debian.org/debian trixie/main i386 libldap-2.5-0 i386 2.5.18+dfsg-3+b1 [200 kB] Get: 87 http://deb.debian.org/debian trixie/main i386 libnghttp2-14 i386 1.64.0-1 [82.4 kB] Get: 88 http://deb.debian.org/debian trixie/main i386 libnghttp3-9 i386 1.6.0-2 [75.9 kB] Get: 89 http://deb.debian.org/debian trixie/main i386 libngtcp2-16 i386 1.9.1-1 [151 kB] Get: 90 http://deb.debian.org/debian trixie/main i386 libngtcp2-crypto-gnutls8 i386 1.9.1-1 [19.1 kB] Get: 91 http://deb.debian.org/debian trixie/main i386 libpsl5t64 i386 0.21.2-1.1+b1 [57.7 kB] Get: 92 http://deb.debian.org/debian trixie/main i386 librtmp1 i386 2.4+20151223.gitfa8646d.1-2+b5 [62.4 kB] Get: 93 http://deb.debian.org/debian trixie/main i386 libssh2-1t64 i386 1.11.1-1 [256 kB] Get: 94 http://deb.debian.org/debian trixie/main i386 libcurl3t64-gnutls i386 8.11.0-1 [403 kB] Get: 95 http://deb.debian.org/debian trixie/main i386 hyphy-pt i386 2.5.62+dfsg-1+b1 [1008 kB] Get: 96 http://deb.debian.org/debian trixie/main i386 infernal i386 1.1.5-2 [5931 kB] Get: 97 http://deb.debian.org/debian trixie/main i386 kalign i386 1:3.4.0-1+b1 [90.9 kB] Get: 98 http://deb.debian.org/debian trixie/main i386 lagan i386 2.0-10 [191 kB] Get: 99 http://deb.debian.org/debian trixie/main i386 libclass-method-modifiers-perl all 2.15-1 [18.0 kB] Get: 100 http://deb.debian.org/debian trixie/main i386 libclass-xsaccessor-perl i386 1.19-4+b4 [37.5 kB] Get: 101 http://deb.debian.org/debian trixie/main i386 libb-hooks-op-check-perl i386 0.22-3+b2 [10.7 kB] Get: 102 http://deb.debian.org/debian trixie/main i386 libdynaloader-functions-perl all 0.004-1 [12.1 kB] Get: 103 http://deb.debian.org/debian trixie/main i386 libdevel-callchecker-perl i386 0.009-1+b1 [16.2 kB] Get: 104 http://deb.debian.org/debian trixie/main i386 libparams-classify-perl i386 0.015-2+b4 [23.1 kB] Get: 105 http://deb.debian.org/debian trixie/main i386 libmodule-runtime-perl all 0.016-2 [19.6 kB] Get: 106 http://deb.debian.org/debian trixie/main i386 libimport-into-perl all 1.002005-2 [11.3 kB] Get: 107 http://deb.debian.org/debian trixie/main i386 librole-tiny-perl all 2.002004-1 [21.4 kB] Get: 108 http://deb.debian.org/debian trixie/main i386 libsub-quote-perl all 2.006008-1 [21.8 kB] Get: 109 http://deb.debian.org/debian trixie/main i386 libmoo-perl all 2.005005-1 [58.0 kB] Get: 110 http://deb.debian.org/debian trixie/main i386 libexporter-tiny-perl all 1.006002-1 [38.7 kB] Get: 111 http://deb.debian.org/debian trixie/main i386 libtype-tiny-perl all 2.004000-1 [357 kB] Get: 112 http://deb.debian.org/debian trixie/main i386 libarray-compare-perl all 3.0.8-1 [14.9 kB] Get: 113 http://deb.debian.org/debian trixie/main i386 liburi-perl all 5.30-1 [105 kB] Get: 114 http://deb.debian.org/debian trixie/main i386 libencode-locale-perl all 1.05-3 [12.9 kB] Get: 115 http://deb.debian.org/debian trixie/main i386 libtimedate-perl all 2.3300-2 [39.3 kB] Get: 116 http://deb.debian.org/debian trixie/main i386 libhttp-date-perl all 6.06-1 [10.7 kB] Get: 117 http://deb.debian.org/debian trixie/main i386 libfile-listing-perl all 6.16-1 [12.4 kB] Get: 118 http://deb.debian.org/debian trixie/main i386 libhtml-tagset-perl all 3.24-1 [14.7 kB] Get: 119 http://deb.debian.org/debian trixie/main i386 libhtml-parser-perl i386 3.83-1+b1 [101 kB] Get: 120 http://deb.debian.org/debian trixie/main i386 libhtml-tree-perl all 5.07-3 [211 kB] Get: 121 http://deb.debian.org/debian trixie/main i386 libclone-perl i386 0.47-1+b1 [14.0 kB] Get: 122 http://deb.debian.org/debian trixie/main i386 libio-html-perl all 1.004-3 [16.2 kB] Get: 123 http://deb.debian.org/debian trixie/main i386 liblwp-mediatypes-perl all 6.04-2 [20.2 kB] Get: 124 http://deb.debian.org/debian trixie/main i386 libhttp-message-perl all 7.00-2 [79.8 kB] Get: 125 http://deb.debian.org/debian trixie/main i386 libhttp-cookies-perl all 6.11-1 [19.1 kB] Get: 126 http://deb.debian.org/debian trixie/main i386 libhttp-negotiate-perl all 6.01-2 [13.1 kB] Get: 127 http://deb.debian.org/debian trixie/main i386 perl-openssl-defaults i386 7+b2 [6720 B] Get: 128 http://deb.debian.org/debian trixie/main i386 libnet-ssleay-perl i386 1.94-2 [340 kB] Get: 129 http://deb.debian.org/debian trixie/main i386 libio-socket-ssl-perl all 2.089-1 [223 kB] Get: 130 http://deb.debian.org/debian trixie/main i386 libnet-http-perl all 6.23-1 [23.9 kB] Get: 131 http://deb.debian.org/debian trixie/main i386 liblwp-protocol-https-perl all 6.14-1 [10.8 kB] Get: 132 http://deb.debian.org/debian trixie/main i386 libtry-tiny-perl all 0.32-1 [22.9 kB] Get: 133 http://deb.debian.org/debian trixie/main i386 libwww-robotrules-perl all 6.02-1 [12.9 kB] Get: 134 http://deb.debian.org/debian trixie/main i386 libwww-perl all 6.77-1 [183 kB] Get: 135 http://deb.debian.org/debian trixie/main i386 libxml-parser-perl i386 2.47-1+b3 [200 kB] Get: 136 http://deb.debian.org/debian trixie/main i386 libxml-twig-perl all 1:3.52-3 [177 kB] Get: 137 http://deb.debian.org/debian trixie/main i386 libxml-writer-perl all 0.900-2 [26.8 kB] Get: 138 http://deb.debian.org/debian trixie/main i386 libbio-variation-perl all 1.7.5-3 [72.6 kB] Get: 139 http://deb.debian.org/debian trixie/main i386 libxml-namespacesupport-perl all 1.12-2 [15.1 kB] Get: 140 http://deb.debian.org/debian trixie/main i386 libxml-sax-base-perl all 1.09-3 [20.6 kB] Get: 141 http://deb.debian.org/debian trixie/main i386 libxml-sax-perl all 1.02+dfsg-4 [53.4 kB] Get: 142 http://deb.debian.org/debian trixie/main i386 libbio-cluster-perl all 1.7.3-6 [53.3 kB] Get: 143 http://deb.debian.org/debian trixie/main i386 libbio-asn1-entrezgene-perl all 1.730-3 [46.3 kB] Get: 144 http://deb.debian.org/debian trixie/main i386 libtext-csv-perl all 2.04-1 [112 kB] Get: 145 http://deb.debian.org/debian trixie/main i386 libxml-libxml-perl i386 2.0207+dfsg+really+2.0134-5+b1 [324 kB] Get: 146 http://deb.debian.org/debian trixie/main i386 libxml-simple-perl all 2.25-2 [69.8 kB] Get: 147 http://deb.debian.org/debian trixie/main i386 libbio-eutilities-perl all 1.77-2 [124 kB] Get: 148 http://deb.debian.org/debian trixie/main i386 libfile-slurp-tiny-perl all 0.004-2 [7592 B] Get: 149 http://deb.debian.org/debian trixie/main i386 libtree-dagnode-perl all 1.32-1 [61.7 kB] Get: 150 http://deb.debian.org/debian trixie/main i386 libxml-perl all 0.08-4 [93.0 kB] Get: 151 http://deb.debian.org/debian trixie/main i386 libxml-regexp-perl all 0.04-1.1 [7500 B] Get: 152 http://deb.debian.org/debian trixie/main i386 libxml-dom-perl all 1.46-2 [152 kB] Get: 153 http://deb.debian.org/debian trixie/main i386 libxml-xpathengine-perl all 0.14-2 [33.5 kB] Get: 154 http://deb.debian.org/debian trixie/main i386 libxml-dom-xpath-perl all 0.14-4 [9352 B] Get: 155 http://deb.debian.org/debian trixie/main i386 libbio-featureio-perl all 1.6.905-2 [53.2 kB] Get: 156 http://deb.debian.org/debian trixie/main i386 libbio-tools-run-remoteblast-perl all 1.7.3-3 [17.5 kB] Get: 157 http://deb.debian.org/debian trixie/main i386 libmodule-pluggable-perl all 5.2-5 [23.0 kB] Get: 158 http://deb.debian.org/debian trixie/main i386 libconfig-any-perl all 0.33-1 [31.0 kB] Get: 159 http://deb.debian.org/debian trixie/main i386 libevent-core-2.1-7t64 i386 2.1.12-stable-10+b1 [140 kB] Get: 160 http://deb.debian.org/debian trixie/main i386 libevent-pthreads-2.1-7t64 i386 2.1.12-stable-10+b1 [54.4 kB] Get: 161 http://deb.debian.org/debian trixie/main i386 libnl-3-200 i386 3.7.0-0.3+b1 [62.3 kB] Get: 162 http://deb.debian.org/debian trixie/main i386 libnl-route-3-200 i386 3.7.0-0.3+b1 [194 kB] Get: 163 http://deb.debian.org/debian trixie/main i386 libibverbs1 i386 52.0-2+b1 [66.8 kB] Get: 164 http://deb.debian.org/debian trixie/main i386 libpsm-infinipath1 i386 3.3+20.604758e7-6.3 [177 kB] Get: 165 http://deb.debian.org/debian trixie/main i386 librdmacm1t64 i386 52.0-2+b1 [76.7 kB] Get: 166 http://deb.debian.org/debian trixie/main i386 libfabric1 i386 1.17.0-3.1 [542 kB] Get: 167 http://deb.debian.org/debian trixie/main i386 libfile-sort-perl all 1.01-3 [21.3 kB] Get: 168 http://deb.debian.org/debian trixie/main i386 libpciaccess0 i386 0.17-3+b2 [53.8 kB] Get: 169 http://deb.debian.org/debian trixie/main i386 libxau6 i386 1:1.0.11-1 [20.7 kB] Get: 170 http://deb.debian.org/debian trixie/main i386 libxdmcp6 i386 1:1.1.5-1 [28.2 kB] Get: 171 http://deb.debian.org/debian trixie/main i386 libxcb1 i386 1.17.0-2+b1 [148 kB] Get: 172 http://deb.debian.org/debian trixie/main i386 libx11-data all 2:1.8.10-2 [337 kB] Get: 173 http://deb.debian.org/debian trixie/main i386 libx11-6 i386 2:1.8.10-2 [834 kB] Get: 174 http://deb.debian.org/debian trixie/main i386 libxext6 i386 2:1.3.4-1+b2 [52.6 kB] Get: 175 http://deb.debian.org/debian trixie/main i386 libxnvctrl0 i386 535.171.04-1+b1 [14.1 kB] Get: 176 http://deb.debian.org/debian trixie/main i386 ocl-icd-libopencl1 i386 2.3.2-1+b2 [43.6 kB] Get: 177 http://deb.debian.org/debian trixie/main i386 libhwloc15 i386 2.11.2-1 [177 kB] Get: 178 http://deb.debian.org/debian trixie/main i386 libhwloc-plugins i386 2.11.2-1 [18.3 kB] Get: 179 http://deb.debian.org/debian trixie/main i386 libio-pty-perl i386 1:1.20-1+b2 [35.8 kB] Get: 180 http://deb.debian.org/debian trixie/main i386 libipc-run-perl all 20231003.0-2 [101 kB] Get: 181 http://deb.debian.org/debian trixie/main i386 liblmdb0 i386 0.9.31-1+b2 [46.9 kB] Get: 182 http://deb.debian.org/debian trixie/main i386 libmbedcrypto16 i386 3.6.2-3 [377 kB] Get: 183 http://deb.debian.org/debian trixie/main i386 libmbedx509-7 i386 3.6.2-3 [149 kB] Get: 184 http://deb.debian.org/debian trixie/main i386 libmbedtls21 i386 3.6.2-3 [240 kB] Get: 185 http://deb.debian.org/debian trixie/main i386 libmodule-build-perl all 0.423400-2 [252 kB] Get: 186 http://deb.debian.org/debian trixie/main i386 libopenmpi3t64 i386 4.1.6-13.3 [2626 kB] Get: 187 http://deb.debian.org/debian trixie/main i386 libuv1t64 i386 1.48.0-7 [157 kB] Get: 188 http://deb.debian.org/debian trixie/main i386 mafft i386 7.505-1 [1007 kB] Get: 189 http://deb.debian.org/debian trixie/main i386 muscle i386 1:5.1.0-1 [311 kB] Get: 190 http://deb.debian.org/debian trixie/main i386 ncbi-data all 6.1.20170106+dfsg2-5 [3537 kB] Get: 191 http://deb.debian.org/debian trixie/main i386 ncbi-blast+ i386 2.16.0+ds-6+b1 [16.6 MB] Get: 192 http://deb.debian.org/debian trixie/main i386 ncbi-blast+-legacy all 2.16.0+ds-6 [10.4 kB] Get: 193 http://deb.debian.org/debian trixie/main i386 ncoils i386 2002-9 [22.2 kB] Get: 194 http://deb.debian.org/debian trixie/main i386 openmpi-common all 4.1.6-13.3 [169 kB] Get: 195 http://deb.debian.org/debian trixie/main i386 openmpi-bin i386 4.1.6-13.3 [198 kB] Get: 196 http://deb.debian.org/debian trixie/main i386 pal2nal all 14.1-3 [17.8 kB] Get: 197 http://deb.debian.org/debian trixie/main i386 phyml i386 3:3.3.20220408-3+b1 [1058 kB] Get: 198 http://deb.debian.org/debian trixie/main i386 primer3 i386 2.6.1-4 [204 kB] Get: 199 http://deb.debian.org/debian trixie/main i386 probcons i386 1.12-14 [105 kB] Get: 200 http://deb.debian.org/debian trixie/main i386 raxml i386 8.2.13+dfsg-1+b1 [992 kB] Get: 201 http://deb.debian.org/debian trixie/main i386 sim4 i386 0.0.20121010-8 [361 kB] Get: 202 http://deb.debian.org/debian trixie/main i386 wise-data all 2.4.1-25 [76.1 kB] Get: 203 http://deb.debian.org/debian trixie/main i386 wise i386 2.4.1-25 [1120 kB] Fetched 96.0 MB in 5s (19.1 MB/s) debconf: delaying package configuration, since apt-utils is not installed Selecting previously unselected package libpython3.12-minimal:i386. (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 19956 files and directories currently installed.) Preparing to unpack .../libpython3.12-minimal_3.12.7-3_i386.deb ... Unpacking libpython3.12-minimal:i386 (3.12.7-3) ... Selecting previously unselected package libexpat1:i386. Preparing to unpack .../libexpat1_2.6.4-1_i386.deb ... Unpacking libexpat1:i386 (2.6.4-1) ... Selecting previously unselected package python3.12-minimal. Preparing to unpack .../python3.12-minimal_3.12.7-3_i386.deb ... Unpacking python3.12-minimal (3.12.7-3) ... Setting up libpython3.12-minimal:i386 (3.12.7-3) ... Setting up libexpat1:i386 (2.6.4-1) ... Setting up python3.12-minimal (3.12.7-3) ... Selecting previously unselected package python3-minimal. (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 20276 files and directories currently installed.) Preparing to unpack .../00-python3-minimal_3.12.6-1_i386.deb ... Unpacking python3-minimal (3.12.6-1) ... Selecting previously unselected package media-types. Preparing to unpack .../01-media-types_10.1.0_all.deb ... Unpacking media-types (10.1.0) ... Selecting previously unselected package netbase. Preparing to unpack .../02-netbase_6.4_all.deb ... Unpacking netbase (6.4) ... Selecting previously unselected package tzdata. Preparing to unpack .../03-tzdata_2024b-3_all.deb ... Unpacking tzdata (2024b-3) ... Selecting previously unselected package libkrb5support0:i386. Preparing to unpack .../04-libkrb5support0_1.21.3-3_i386.deb ... Unpacking libkrb5support0:i386 (1.21.3-3) ... Selecting previously unselected package libcom-err2:i386. Preparing to unpack .../05-libcom-err2_1.47.1-1+b1_i386.deb ... Unpacking libcom-err2:i386 (1.47.1-1+b1) ... Selecting previously unselected package libk5crypto3:i386. Preparing to unpack .../06-libk5crypto3_1.21.3-3_i386.deb ... Unpacking libk5crypto3:i386 (1.21.3-3) ... Selecting previously unselected package libkeyutils1:i386. Preparing to unpack .../07-libkeyutils1_1.6.3-4_i386.deb ... Unpacking libkeyutils1:i386 (1.6.3-4) ... Selecting previously unselected package libkrb5-3:i386. Preparing to unpack .../08-libkrb5-3_1.21.3-3_i386.deb ... Unpacking libkrb5-3:i386 (1.21.3-3) ... Selecting previously unselected package libgssapi-krb5-2:i386. Preparing to unpack .../09-libgssapi-krb5-2_1.21.3-3_i386.deb ... Unpacking libgssapi-krb5-2:i386 (1.21.3-3) ... Selecting previously unselected package libtirpc-common. Preparing to unpack .../10-libtirpc-common_1.3.4+ds-1.3_all.deb ... Unpacking libtirpc-common (1.3.4+ds-1.3) ... Selecting previously unselected package libtirpc3t64:i386. Preparing to unpack .../11-libtirpc3t64_1.3.4+ds-1.3+b1_i386.deb ... Adding 'diversion of /lib/i386-linux-gnu/libtirpc.so.3 to /lib/i386-linux-gnu/libtirpc.so.3.usr-is-merged by libtirpc3t64' Adding 'diversion of /lib/i386-linux-gnu/libtirpc.so.3.0.0 to /lib/i386-linux-gnu/libtirpc.so.3.0.0.usr-is-merged by libtirpc3t64' Unpacking libtirpc3t64:i386 (1.3.4+ds-1.3+b1) ... Selecting previously unselected package libnsl2:i386. Preparing to unpack .../12-libnsl2_1.3.0-3+b3_i386.deb ... Unpacking libnsl2:i386 (1.3.0-3+b3) ... Selecting previously unselected package readline-common. Preparing to unpack .../13-readline-common_8.2-5_all.deb ... Unpacking readline-common (8.2-5) ... Selecting previously unselected package libreadline8t64:i386. Preparing to unpack .../14-libreadline8t64_8.2-5_i386.deb ... Adding 'diversion of /lib/i386-linux-gnu/libhistory.so.8 to /lib/i386-linux-gnu/libhistory.so.8.usr-is-merged by libreadline8t64' Adding 'diversion of /lib/i386-linux-gnu/libhistory.so.8.2 to /lib/i386-linux-gnu/libhistory.so.8.2.usr-is-merged by libreadline8t64' Adding 'diversion of /lib/i386-linux-gnu/libreadline.so.8 to /lib/i386-linux-gnu/libreadline.so.8.usr-is-merged by libreadline8t64' Adding 'diversion of /lib/i386-linux-gnu/libreadline.so.8.2 to /lib/i386-linux-gnu/libreadline.so.8.2.usr-is-merged by libreadline8t64' Unpacking libreadline8t64:i386 (8.2-5) ... Selecting previously unselected package libpython3.12-stdlib:i386. Preparing to unpack .../15-libpython3.12-stdlib_3.12.7-3_i386.deb ... Unpacking libpython3.12-stdlib:i386 (3.12.7-3) ... Selecting previously unselected package python3.12. Preparing to unpack .../16-python3.12_3.12.7-3_i386.deb ... Unpacking python3.12 (3.12.7-3) ... Selecting previously unselected package libpython3-stdlib:i386. Preparing to unpack .../17-libpython3-stdlib_3.12.6-1_i386.deb ... Unpacking libpython3-stdlib:i386 (3.12.6-1) ... Setting up python3-minimal (3.12.6-1) ... Selecting previously unselected package python3. (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 21338 files and directories currently installed.) Preparing to unpack .../000-python3_3.12.6-1_i386.deb ... Unpacking python3 (3.12.6-1) ... Selecting previously unselected package sensible-utils. Preparing to unpack .../001-sensible-utils_0.0.24_all.deb ... Unpacking sensible-utils (0.0.24) ... Selecting previously unselected package openssl. Preparing to unpack .../002-openssl_3.3.2-2_i386.deb ... Unpacking openssl (3.3.2-2) ... Selecting previously unselected package ca-certificates. Preparing to unpack .../003-ca-certificates_20240203_all.deb ... Unpacking ca-certificates (20240203) ... Selecting previously unselected package libmagic-mgc. Preparing to unpack .../004-libmagic-mgc_1%3a5.45-3+b1_i386.deb ... Unpacking libmagic-mgc (1:5.45-3+b1) ... Selecting previously unselected package libmagic1t64:i386. Preparing to unpack .../005-libmagic1t64_1%3a5.45-3+b1_i386.deb ... Unpacking libmagic1t64:i386 (1:5.45-3+b1) ... Selecting previously unselected package file. Preparing to unpack .../006-file_1%3a5.45-3+b1_i386.deb ... Unpacking file (1:5.45-3+b1) ... Selecting previously unselected package gettext-base. Preparing to unpack .../007-gettext-base_0.22.5-2_i386.deb ... Unpacking gettext-base (0.22.5-2) ... Selecting previously unselected package libuchardet0:i386. Preparing to unpack .../008-libuchardet0_0.0.8-1+b2_i386.deb ... Unpacking libuchardet0:i386 (0.0.8-1+b2) ... Selecting previously unselected package groff-base. Preparing to unpack .../009-groff-base_1.23.0-5_i386.deb ... Unpacking groff-base (1.23.0-5) ... Selecting previously unselected package bsdextrautils. Preparing to unpack .../010-bsdextrautils_2.40.2-11_i386.deb ... Unpacking bsdextrautils (2.40.2-11) ... Selecting previously unselected package libpipeline1:i386. Preparing to unpack .../011-libpipeline1_1.5.8-1_i386.deb ... Unpacking libpipeline1:i386 (1.5.8-1) ... Selecting previously unselected package man-db. Preparing to unpack .../012-man-db_2.13.0-1_i386.deb ... Unpacking man-db (2.13.0-1) ... Selecting previously unselected package libedit2:i386. Preparing to unpack .../013-libedit2_3.1-20240808-1_i386.deb ... Unpacking libedit2:i386 (3.1-20240808-1) ... Selecting previously unselected package libcbor0.10:i386. Preparing to unpack .../014-libcbor0.10_0.10.2-2_i386.deb ... Unpacking libcbor0.10:i386 (0.10.2-2) ... Selecting previously unselected package libfido2-1:i386. Preparing to unpack .../015-libfido2-1_1.15.0-1+b1_i386.deb ... Unpacking libfido2-1:i386 (1.15.0-1+b1) ... Selecting previously unselected package openssh-client. Preparing to unpack .../016-openssh-client_1%3a9.9p1-3_i386.deb ... Unpacking openssh-client (1:9.9p1-3) ... Selecting previously unselected package ucf. Preparing to unpack .../017-ucf_3.0043+nmu1_all.deb ... Moving old data out of the way Unpacking ucf (3.0043+nmu1) ... Selecting previously unselected package amap-align. Preparing to unpack .../018-amap-align_2.2+git20080214.600fc29+dfsg-2_i386.deb ... Unpacking amap-align (2.2+git20080214.600fc29+dfsg-2) ... Selecting previously unselected package m4. Preparing to unpack .../019-m4_1.4.19-4_i386.deb ... Unpacking m4 (1.4.19-4) ... Selecting previously unselected package autoconf. Preparing to unpack .../020-autoconf_2.72-3_all.deb ... Unpacking autoconf (2.72-3) ... Selecting previously unselected package autotools-dev. Preparing to unpack .../021-autotools-dev_20220109.1_all.deb ... Unpacking autotools-dev (20220109.1) ... Selecting previously unselected package automake. Preparing to unpack .../022-automake_1%3a1.16.5-1.3_all.deb ... Unpacking automake (1:1.16.5-1.3) ... Selecting previously unselected package autopoint. Preparing to unpack .../023-autopoint_0.22.5-2_all.deb ... Unpacking autopoint (0.22.5-2) ... Selecting previously unselected package bedtools-test. Preparing to unpack .../024-bedtools-test_2.31.1+dfsg-2_all.deb ... Unpacking bedtools-test (2.31.1+dfsg-2) ... Selecting previously unselected package libio-string-perl. Preparing to unpack .../025-libio-string-perl_1.08-4_all.deb ... Unpacking libio-string-perl (1.08-4) ... Selecting previously unselected package libdata-stag-perl. Preparing to unpack .../026-libdata-stag-perl_0.14-3_all.deb ... Unpacking libdata-stag-perl (0.14-3) ... Selecting previously unselected package libbio-perl-perl. Preparing to unpack .../027-libbio-perl-perl_1.7.8-1_all.deb ... Unpacking libbio-perl-perl (1.7.8-1) ... Selecting previously unselected package libclass-data-inheritable-perl. Preparing to unpack .../028-libclass-data-inheritable-perl_0.10-1_all.deb ... Unpacking libclass-data-inheritable-perl (0.10-1) ... Selecting previously unselected package libdevel-stacktrace-perl. Preparing to unpack .../029-libdevel-stacktrace-perl_2.0500-1_all.deb ... Unpacking libdevel-stacktrace-perl (2.0500-1) ... Selecting previously unselected package libexception-class-perl. Preparing to unpack .../030-libexception-class-perl_1.45-1_all.deb ... Unpacking libexception-class-perl (1.45-1) ... Selecting previously unselected package libtest-deep-perl. Preparing to unpack .../031-libtest-deep-perl_1.204-1_all.deb ... Unpacking libtest-deep-perl (1.204-1) ... Selecting previously unselected package libcapture-tiny-perl. Preparing to unpack .../032-libcapture-tiny-perl_0.48-2_all.deb ... Unpacking libcapture-tiny-perl (0.48-2) ... Selecting previously unselected package libalgorithm-diff-perl. Preparing to unpack .../033-libalgorithm-diff-perl_1.201-1_all.deb ... Unpacking libalgorithm-diff-perl (1.201-1) ... Selecting previously unselected package libtext-diff-perl. Preparing to unpack .../034-libtext-diff-perl_1.45-2_all.deb ... Unpacking libtext-diff-perl (1.45-2) ... Selecting previously unselected package libtest-differences-perl. Preparing to unpack .../035-libtest-differences-perl_0.71-1_all.deb ... Unpacking libtest-differences-perl (0.71-1) ... Selecting previously unselected package libsub-uplevel-perl. Preparing to unpack .../036-libsub-uplevel-perl_0.2800-3_all.deb ... Unpacking libsub-uplevel-perl (0.2800-3) ... Selecting previously unselected package libtest-exception-perl. Preparing to unpack .../037-libtest-exception-perl_0.43-3_all.deb ... Unpacking libtest-exception-perl (0.43-3) ... Selecting previously unselected package libtest-warn-perl. Preparing to unpack .../038-libtest-warn-perl_0.37-2_all.deb ... Unpacking libtest-warn-perl (0.37-2) ... Selecting previously unselected package libtest-most-perl. Preparing to unpack .../039-libtest-most-perl_0.38-1_all.deb ... Unpacking libtest-most-perl (0.38-1) ... Selecting previously unselected package bioperl. Preparing to unpack .../040-bioperl_1.7.8-1_all.deb ... Unpacking bioperl (1.7.8-1) ... Selecting previously unselected package libdebhelper-perl. Preparing to unpack .../041-libdebhelper-perl_13.20_all.deb ... Unpacking libdebhelper-perl (13.20) ... Selecting previously unselected package libtool. Preparing to unpack .../042-libtool_2.4.7-8_all.deb ... Unpacking libtool (2.4.7-8) ... Selecting previously unselected package dh-autoreconf. Preparing to unpack .../043-dh-autoreconf_20_all.deb ... Unpacking dh-autoreconf (20) ... Selecting previously unselected package libarchive-zip-perl. Preparing to unpack .../044-libarchive-zip-perl_1.68-1_all.deb ... Unpacking libarchive-zip-perl (1.68-1) ... Selecting previously unselected package libfile-stripnondeterminism-perl. Preparing to unpack .../045-libfile-stripnondeterminism-perl_1.14.0-1_all.deb ... Unpacking libfile-stripnondeterminism-perl (1.14.0-1) ... Selecting previously unselected package dh-strip-nondeterminism. Preparing to unpack .../046-dh-strip-nondeterminism_1.14.0-1_all.deb ... Unpacking dh-strip-nondeterminism (1.14.0-1) ... Selecting previously unselected package libelf1t64:i386. Preparing to unpack .../047-libelf1t64_0.192-4_i386.deb ... Unpacking libelf1t64:i386 (0.192-4) ... Selecting previously unselected package dwz. Preparing to unpack .../048-dwz_0.15-1+b1_i386.deb ... Unpacking dwz (0.15-1+b1) ... Selecting previously unselected package libicu72:i386. Preparing to unpack .../049-libicu72_72.1-5+b1_i386.deb ... Unpacking libicu72:i386 (72.1-5+b1) ... Selecting previously unselected package libxml2:i386. Preparing to unpack .../050-libxml2_2.12.7+dfsg+really2.9.14-0.2+b1_i386.deb ... Unpacking libxml2:i386 (2.12.7+dfsg+really2.9.14-0.2+b1) ... Selecting previously unselected package gettext. Preparing to unpack .../051-gettext_0.22.5-2_i386.deb ... Unpacking gettext (0.22.5-2) ... Selecting previously unselected package intltool-debian. Preparing to unpack .../052-intltool-debian_0.35.0+20060710.6_all.deb ... Unpacking intltool-debian (0.35.0+20060710.6) ... Selecting previously unselected package po-debconf. Preparing to unpack .../053-po-debconf_1.0.21+nmu1_all.deb ... Unpacking po-debconf (1.0.21+nmu1) ... Selecting previously unselected package debhelper. Preparing to unpack .../054-debhelper_13.20_all.deb ... Unpacking debhelper (13.20) ... Selecting previously unselected package libglib2.0-0t64:i386. Preparing to unpack .../055-libglib2.0-0t64_2.82.2-3_i386.deb ... Unpacking libglib2.0-0t64:i386 (2.82.2-3) ... Selecting previously unselected package exonerate. Preparing to unpack .../056-exonerate_2.4.0-5+b1_i386.deb ... Unpacking exonerate (2.4.0-5+b1) ... Selecting previously unselected package fasttree. Preparing to unpack .../057-fasttree_2.1.11-2_i386.deb ... Unpacking fasttree (2.1.11-2) ... Selecting previously unselected package libdivsufsort3:i386. Preparing to unpack .../058-libdivsufsort3_2.0.1-6+b1_i386.deb ... Unpacking libdivsufsort3:i386 (2.0.1-6+b1) ... Selecting previously unselected package hmmer. Preparing to unpack .../059-hmmer_3.4+dfsg-2_i386.deb ... Unpacking hmmer (3.4+dfsg-2) ... Selecting previously unselected package hyphy-common. Preparing to unpack .../060-hyphy-common_2.5.62+dfsg-1_all.deb ... Unpacking hyphy-common (2.5.62+dfsg-1) ... Selecting previously unselected package libbrotli1:i386. Preparing to unpack .../061-libbrotli1_1.1.0-2+b6_i386.deb ... Unpacking libbrotli1:i386 (1.1.0-2+b6) ... Selecting previously unselected package libsasl2-modules-db:i386. Preparing to unpack .../062-libsasl2-modules-db_2.1.28+dfsg1-8_i386.deb ... Unpacking libsasl2-modules-db:i386 (2.1.28+dfsg1-8) ... Selecting previously unselected package libsasl2-2:i386. Preparing to unpack .../063-libsasl2-2_2.1.28+dfsg1-8_i386.deb ... Unpacking libsasl2-2:i386 (2.1.28+dfsg1-8) ... Selecting previously unselected package libldap-2.5-0:i386. Preparing to unpack .../064-libldap-2.5-0_2.5.18+dfsg-3+b1_i386.deb ... Unpacking libldap-2.5-0:i386 (2.5.18+dfsg-3+b1) ... Selecting previously unselected package libnghttp2-14:i386. Preparing to unpack .../065-libnghttp2-14_1.64.0-1_i386.deb ... Unpacking libnghttp2-14:i386 (1.64.0-1) ... Selecting previously unselected package libnghttp3-9:i386. Preparing to unpack .../066-libnghttp3-9_1.6.0-2_i386.deb ... Unpacking libnghttp3-9:i386 (1.6.0-2) ... Selecting previously unselected package libngtcp2-16:i386. Preparing to unpack .../067-libngtcp2-16_1.9.1-1_i386.deb ... Unpacking libngtcp2-16:i386 (1.9.1-1) ... Selecting previously unselected package libngtcp2-crypto-gnutls8:i386. Preparing to unpack .../068-libngtcp2-crypto-gnutls8_1.9.1-1_i386.deb ... Unpacking libngtcp2-crypto-gnutls8:i386 (1.9.1-1) ... Selecting previously unselected package libpsl5t64:i386. Preparing to unpack .../069-libpsl5t64_0.21.2-1.1+b1_i386.deb ... Unpacking libpsl5t64:i386 (0.21.2-1.1+b1) ... Selecting previously unselected package librtmp1:i386. Preparing to unpack .../070-librtmp1_2.4+20151223.gitfa8646d.1-2+b5_i386.deb ... Unpacking librtmp1:i386 (2.4+20151223.gitfa8646d.1-2+b5) ... Selecting previously unselected package libssh2-1t64:i386. Preparing to unpack .../071-libssh2-1t64_1.11.1-1_i386.deb ... Unpacking libssh2-1t64:i386 (1.11.1-1) ... Selecting previously unselected package libcurl3t64-gnutls:i386. Preparing to unpack .../072-libcurl3t64-gnutls_8.11.0-1_i386.deb ... Unpacking libcurl3t64-gnutls:i386 (8.11.0-1) ... Selecting previously unselected package hyphy-pt. Preparing to unpack .../073-hyphy-pt_2.5.62+dfsg-1+b1_i386.deb ... Unpacking hyphy-pt (2.5.62+dfsg-1+b1) ... Selecting previously unselected package infernal. Preparing to unpack .../074-infernal_1.1.5-2_i386.deb ... Unpacking infernal (1.1.5-2) ... Selecting previously unselected package kalign. Preparing to unpack .../075-kalign_1%3a3.4.0-1+b1_i386.deb ... Unpacking kalign (1:3.4.0-1+b1) ... Selecting previously unselected package lagan. Preparing to unpack .../076-lagan_2.0-10_i386.deb ... Unpacking lagan (2.0-10) ... Selecting previously unselected package libclass-method-modifiers-perl. Preparing to unpack .../077-libclass-method-modifiers-perl_2.15-1_all.deb ... Unpacking libclass-method-modifiers-perl (2.15-1) ... Selecting previously unselected package libclass-xsaccessor-perl. Preparing to unpack .../078-libclass-xsaccessor-perl_1.19-4+b4_i386.deb ... Unpacking libclass-xsaccessor-perl (1.19-4+b4) ... Selecting previously unselected package libb-hooks-op-check-perl:i386. Preparing to unpack .../079-libb-hooks-op-check-perl_0.22-3+b2_i386.deb ... Unpacking libb-hooks-op-check-perl:i386 (0.22-3+b2) ... Selecting previously unselected package libdynaloader-functions-perl. Preparing to unpack .../080-libdynaloader-functions-perl_0.004-1_all.deb ... Unpacking libdynaloader-functions-perl (0.004-1) ... Selecting previously unselected package libdevel-callchecker-perl:i386. Preparing to unpack .../081-libdevel-callchecker-perl_0.009-1+b1_i386.deb ... Unpacking libdevel-callchecker-perl:i386 (0.009-1+b1) ... Selecting previously unselected package libparams-classify-perl:i386. Preparing to unpack .../082-libparams-classify-perl_0.015-2+b4_i386.deb ... Unpacking libparams-classify-perl:i386 (0.015-2+b4) ... Selecting previously unselected package libmodule-runtime-perl. Preparing to unpack .../083-libmodule-runtime-perl_0.016-2_all.deb ... Unpacking libmodule-runtime-perl (0.016-2) ... Selecting previously unselected package libimport-into-perl. Preparing to unpack .../084-libimport-into-perl_1.002005-2_all.deb ... Unpacking libimport-into-perl (1.002005-2) ... Selecting previously unselected package librole-tiny-perl. Preparing to unpack .../085-librole-tiny-perl_2.002004-1_all.deb ... Unpacking librole-tiny-perl (2.002004-1) ... Selecting previously unselected package libsub-quote-perl. Preparing to unpack .../086-libsub-quote-perl_2.006008-1_all.deb ... Unpacking libsub-quote-perl (2.006008-1) ... Selecting previously unselected package libmoo-perl. Preparing to unpack .../087-libmoo-perl_2.005005-1_all.deb ... Unpacking libmoo-perl (2.005005-1) ... Selecting previously unselected package libexporter-tiny-perl. Preparing to unpack .../088-libexporter-tiny-perl_1.006002-1_all.deb ... Unpacking libexporter-tiny-perl (1.006002-1) ... Selecting previously unselected package libtype-tiny-perl. Preparing to unpack .../089-libtype-tiny-perl_2.004000-1_all.deb ... Unpacking libtype-tiny-perl (2.004000-1) ... Selecting previously unselected package libarray-compare-perl. Preparing to unpack .../090-libarray-compare-perl_3.0.8-1_all.deb ... Unpacking libarray-compare-perl (3.0.8-1) ... Selecting previously unselected package liburi-perl. Preparing to unpack .../091-liburi-perl_5.30-1_all.deb ... Unpacking liburi-perl (5.30-1) ... Selecting previously unselected package libencode-locale-perl. Preparing to unpack .../092-libencode-locale-perl_1.05-3_all.deb ... Unpacking libencode-locale-perl (1.05-3) ... Selecting previously unselected package libtimedate-perl. Preparing to unpack .../093-libtimedate-perl_2.3300-2_all.deb ... Unpacking libtimedate-perl (2.3300-2) ... Selecting previously unselected package libhttp-date-perl. Preparing to unpack .../094-libhttp-date-perl_6.06-1_all.deb ... Unpacking libhttp-date-perl (6.06-1) ... Selecting previously unselected package libfile-listing-perl. Preparing to unpack .../095-libfile-listing-perl_6.16-1_all.deb ... Unpacking libfile-listing-perl (6.16-1) ... Selecting previously unselected package libhtml-tagset-perl. Preparing to unpack .../096-libhtml-tagset-perl_3.24-1_all.deb ... Unpacking libhtml-tagset-perl (3.24-1) ... Selecting previously unselected package libhtml-parser-perl:i386. Preparing to unpack .../097-libhtml-parser-perl_3.83-1+b1_i386.deb ... Unpacking libhtml-parser-perl:i386 (3.83-1+b1) ... Selecting previously unselected package libhtml-tree-perl. Preparing to unpack .../098-libhtml-tree-perl_5.07-3_all.deb ... Unpacking libhtml-tree-perl (5.07-3) ... Selecting previously unselected package libclone-perl:i386. Preparing to unpack .../099-libclone-perl_0.47-1+b1_i386.deb ... Unpacking libclone-perl:i386 (0.47-1+b1) ... Selecting previously unselected package libio-html-perl. Preparing to unpack .../100-libio-html-perl_1.004-3_all.deb ... Unpacking libio-html-perl (1.004-3) ... Selecting previously unselected package liblwp-mediatypes-perl. Preparing to unpack .../101-liblwp-mediatypes-perl_6.04-2_all.deb ... Unpacking liblwp-mediatypes-perl (6.04-2) ... Selecting previously unselected package libhttp-message-perl. Preparing to unpack .../102-libhttp-message-perl_7.00-2_all.deb ... Unpacking libhttp-message-perl (7.00-2) ... Selecting previously unselected package libhttp-cookies-perl. Preparing to unpack .../103-libhttp-cookies-perl_6.11-1_all.deb ... Unpacking libhttp-cookies-perl (6.11-1) ... Selecting previously unselected package libhttp-negotiate-perl. Preparing to unpack .../104-libhttp-negotiate-perl_6.01-2_all.deb ... Unpacking libhttp-negotiate-perl (6.01-2) ... Selecting previously unselected package perl-openssl-defaults:i386. Preparing to unpack .../105-perl-openssl-defaults_7+b2_i386.deb ... Unpacking perl-openssl-defaults:i386 (7+b2) ... Selecting previously unselected package libnet-ssleay-perl:i386. Preparing to unpack .../106-libnet-ssleay-perl_1.94-2_i386.deb ... Unpacking libnet-ssleay-perl:i386 (1.94-2) ... Selecting previously unselected package libio-socket-ssl-perl. Preparing to unpack .../107-libio-socket-ssl-perl_2.089-1_all.deb ... Unpacking libio-socket-ssl-perl (2.089-1) ... Selecting previously unselected package libnet-http-perl. Preparing to unpack .../108-libnet-http-perl_6.23-1_all.deb ... Unpacking libnet-http-perl (6.23-1) ... Selecting previously unselected package liblwp-protocol-https-perl. Preparing to unpack .../109-liblwp-protocol-https-perl_6.14-1_all.deb ... Unpacking liblwp-protocol-https-perl (6.14-1) ... Selecting previously unselected package libtry-tiny-perl. Preparing to unpack .../110-libtry-tiny-perl_0.32-1_all.deb ... Unpacking libtry-tiny-perl (0.32-1) ... Selecting previously unselected package libwww-robotrules-perl. Preparing to unpack .../111-libwww-robotrules-perl_6.02-1_all.deb ... Unpacking libwww-robotrules-perl (6.02-1) ... Selecting previously unselected package libwww-perl. Preparing to unpack .../112-libwww-perl_6.77-1_all.deb ... Unpacking libwww-perl (6.77-1) ... Selecting previously unselected package libxml-parser-perl. Preparing to unpack .../113-libxml-parser-perl_2.47-1+b3_i386.deb ... Unpacking libxml-parser-perl (2.47-1+b3) ... Selecting previously unselected package libxml-twig-perl. Preparing to unpack .../114-libxml-twig-perl_1%3a3.52-3_all.deb ... Unpacking libxml-twig-perl (1:3.52-3) ... Selecting previously unselected package libxml-writer-perl. Preparing to unpack .../115-libxml-writer-perl_0.900-2_all.deb ... Unpacking libxml-writer-perl (0.900-2) ... Selecting previously unselected package libbio-variation-perl. Preparing to unpack .../116-libbio-variation-perl_1.7.5-3_all.deb ... Unpacking libbio-variation-perl (1.7.5-3) ... Selecting previously unselected package libxml-namespacesupport-perl. Preparing to unpack .../117-libxml-namespacesupport-perl_1.12-2_all.deb ... Unpacking libxml-namespacesupport-perl (1.12-2) ... Selecting previously unselected package libxml-sax-base-perl. Preparing to unpack .../118-libxml-sax-base-perl_1.09-3_all.deb ... Unpacking libxml-sax-base-perl (1.09-3) ... Selecting previously unselected package libxml-sax-perl. Preparing to unpack .../119-libxml-sax-perl_1.02+dfsg-4_all.deb ... Unpacking libxml-sax-perl (1.02+dfsg-4) ... Selecting previously unselected package libbio-cluster-perl. Preparing to unpack .../120-libbio-cluster-perl_1.7.3-6_all.deb ... Unpacking libbio-cluster-perl (1.7.3-6) ... Selecting previously unselected package libbio-asn1-entrezgene-perl. Preparing to unpack .../121-libbio-asn1-entrezgene-perl_1.730-3_all.deb ... Unpacking libbio-asn1-entrezgene-perl (1.730-3) ... Selecting previously unselected package libtext-csv-perl. Preparing to unpack .../122-libtext-csv-perl_2.04-1_all.deb ... Unpacking libtext-csv-perl (2.04-1) ... Selecting previously unselected package libxml-libxml-perl. Preparing to unpack .../123-libxml-libxml-perl_2.0207+dfsg+really+2.0134-5+b1_i386.deb ... Unpacking libxml-libxml-perl (2.0207+dfsg+really+2.0134-5+b1) ... Selecting previously unselected package libxml-simple-perl. Preparing to unpack .../124-libxml-simple-perl_2.25-2_all.deb ... Unpacking libxml-simple-perl (2.25-2) ... Selecting previously unselected package libbio-eutilities-perl. Preparing to unpack .../125-libbio-eutilities-perl_1.77-2_all.deb ... Unpacking libbio-eutilities-perl (1.77-2) ... Selecting previously unselected package libfile-slurp-tiny-perl. Preparing to unpack .../126-libfile-slurp-tiny-perl_0.004-2_all.deb ... Unpacking libfile-slurp-tiny-perl (0.004-2) ... Selecting previously unselected package libtree-dagnode-perl. Preparing to unpack .../127-libtree-dagnode-perl_1.32-1_all.deb ... Unpacking libtree-dagnode-perl (1.32-1) ... Selecting previously unselected package libxml-perl. Preparing to unpack .../128-libxml-perl_0.08-4_all.deb ... Unpacking libxml-perl (0.08-4) ... Selecting previously unselected package libxml-regexp-perl. Preparing to unpack .../129-libxml-regexp-perl_0.04-1.1_all.deb ... Unpacking libxml-regexp-perl (0.04-1.1) ... Selecting previously unselected package libxml-dom-perl. Preparing to unpack .../130-libxml-dom-perl_1.46-2_all.deb ... Unpacking libxml-dom-perl (1.46-2) ... Selecting previously unselected package libxml-xpathengine-perl. Preparing to unpack .../131-libxml-xpathengine-perl_0.14-2_all.deb ... Unpacking libxml-xpathengine-perl (0.14-2) ... Selecting previously unselected package libxml-dom-xpath-perl. Preparing to unpack .../132-libxml-dom-xpath-perl_0.14-4_all.deb ... Unpacking libxml-dom-xpath-perl (0.14-4) ... Selecting previously unselected package libbio-featureio-perl. Preparing to unpack .../133-libbio-featureio-perl_1.6.905-2_all.deb ... Unpacking libbio-featureio-perl (1.6.905-2) ... Selecting previously unselected package libbio-tools-run-remoteblast-perl. Preparing to unpack .../134-libbio-tools-run-remoteblast-perl_1.7.3-3_all.deb ... Unpacking libbio-tools-run-remoteblast-perl (1.7.3-3) ... Selecting previously unselected package libmodule-pluggable-perl. Preparing to unpack .../135-libmodule-pluggable-perl_5.2-5_all.deb ... Unpacking libmodule-pluggable-perl (5.2-5) ... Selecting previously unselected package libconfig-any-perl. Preparing to unpack .../136-libconfig-any-perl_0.33-1_all.deb ... Unpacking libconfig-any-perl (0.33-1) ... Selecting previously unselected package libevent-core-2.1-7t64:i386. Preparing to unpack .../137-libevent-core-2.1-7t64_2.1.12-stable-10+b1_i386.deb ... Unpacking libevent-core-2.1-7t64:i386 (2.1.12-stable-10+b1) ... Selecting previously unselected package libevent-pthreads-2.1-7t64:i386. Preparing to unpack .../138-libevent-pthreads-2.1-7t64_2.1.12-stable-10+b1_i386.deb ... Unpacking libevent-pthreads-2.1-7t64:i386 (2.1.12-stable-10+b1) ... Selecting previously unselected package libnl-3-200:i386. Preparing to unpack .../139-libnl-3-200_3.7.0-0.3+b1_i386.deb ... Unpacking libnl-3-200:i386 (3.7.0-0.3+b1) ... Selecting previously unselected package libnl-route-3-200:i386. Preparing to unpack .../140-libnl-route-3-200_3.7.0-0.3+b1_i386.deb ... Unpacking libnl-route-3-200:i386 (3.7.0-0.3+b1) ... Selecting previously unselected package libibverbs1:i386. Preparing to unpack .../141-libibverbs1_52.0-2+b1_i386.deb ... Unpacking libibverbs1:i386 (52.0-2+b1) ... Selecting previously unselected package libpsm-infinipath1. Preparing to unpack .../142-libpsm-infinipath1_3.3+20.604758e7-6.3_i386.deb ... Unpacking libpsm-infinipath1 (3.3+20.604758e7-6.3) ... Selecting previously unselected package librdmacm1t64:i386. Preparing to unpack .../143-librdmacm1t64_52.0-2+b1_i386.deb ... Unpacking librdmacm1t64:i386 (52.0-2+b1) ... Selecting previously unselected package libfabric1:i386. Preparing to unpack .../144-libfabric1_1.17.0-3.1_i386.deb ... Unpacking libfabric1:i386 (1.17.0-3.1) ... Selecting previously unselected package libfile-sort-perl. Preparing to unpack .../145-libfile-sort-perl_1.01-3_all.deb ... Unpacking libfile-sort-perl (1.01-3) ... Selecting previously unselected package libpciaccess0:i386. Preparing to unpack .../146-libpciaccess0_0.17-3+b2_i386.deb ... Unpacking libpciaccess0:i386 (0.17-3+b2) ... Selecting previously unselected package libxau6:i386. Preparing to unpack .../147-libxau6_1%3a1.0.11-1_i386.deb ... Unpacking libxau6:i386 (1:1.0.11-1) ... Selecting previously unselected package libxdmcp6:i386. Preparing to unpack .../148-libxdmcp6_1%3a1.1.5-1_i386.deb ... Unpacking libxdmcp6:i386 (1:1.1.5-1) ... Selecting previously unselected package libxcb1:i386. Preparing to unpack .../149-libxcb1_1.17.0-2+b1_i386.deb ... Unpacking libxcb1:i386 (1.17.0-2+b1) ... Selecting previously unselected package libx11-data. Preparing to unpack .../150-libx11-data_2%3a1.8.10-2_all.deb ... Unpacking libx11-data (2:1.8.10-2) ... Selecting previously unselected package libx11-6:i386. Preparing to unpack .../151-libx11-6_2%3a1.8.10-2_i386.deb ... Unpacking libx11-6:i386 (2:1.8.10-2) ... Selecting previously unselected package libxext6:i386. Preparing to unpack .../152-libxext6_2%3a1.3.4-1+b2_i386.deb ... Unpacking libxext6:i386 (2:1.3.4-1+b2) ... Selecting previously unselected package libxnvctrl0:i386. Preparing to unpack .../153-libxnvctrl0_535.171.04-1+b1_i386.deb ... Unpacking libxnvctrl0:i386 (535.171.04-1+b1) ... Selecting previously unselected package ocl-icd-libopencl1:i386. Preparing to unpack .../154-ocl-icd-libopencl1_2.3.2-1+b2_i386.deb ... Unpacking ocl-icd-libopencl1:i386 (2.3.2-1+b2) ... Selecting previously unselected package libhwloc15:i386. Preparing to unpack .../155-libhwloc15_2.11.2-1_i386.deb ... Unpacking libhwloc15:i386 (2.11.2-1) ... Selecting previously unselected package libhwloc-plugins:i386. Preparing to unpack .../156-libhwloc-plugins_2.11.2-1_i386.deb ... Unpacking libhwloc-plugins:i386 (2.11.2-1) ... Selecting previously unselected package libio-pty-perl. Preparing to unpack .../157-libio-pty-perl_1%3a1.20-1+b2_i386.deb ... Unpacking libio-pty-perl (1:1.20-1+b2) ... Selecting previously unselected package libipc-run-perl. Preparing to unpack .../158-libipc-run-perl_20231003.0-2_all.deb ... Unpacking libipc-run-perl (20231003.0-2) ... Selecting previously unselected package liblmdb0:i386. Preparing to unpack .../159-liblmdb0_0.9.31-1+b2_i386.deb ... Unpacking liblmdb0:i386 (0.9.31-1+b2) ... Selecting previously unselected package libmbedcrypto16:i386. Preparing to unpack .../160-libmbedcrypto16_3.6.2-3_i386.deb ... Unpacking libmbedcrypto16:i386 (3.6.2-3) ... Selecting previously unselected package libmbedx509-7:i386. Preparing to unpack .../161-libmbedx509-7_3.6.2-3_i386.deb ... Unpacking libmbedx509-7:i386 (3.6.2-3) ... Selecting previously unselected package libmbedtls21:i386. Preparing to unpack .../162-libmbedtls21_3.6.2-3_i386.deb ... Unpacking libmbedtls21:i386 (3.6.2-3) ... Selecting previously unselected package libmodule-build-perl. Preparing to unpack .../163-libmodule-build-perl_0.423400-2_all.deb ... Adding 'diversion of /usr/bin/config_data to /usr/bin/config_data.diverted by libmodule-build-perl' Adding 'diversion of /usr/share/man/man1/config_data.1.gz to /usr/share/man/man1/config_data.diverted.1.gz by libmodule-build-perl' Unpacking libmodule-build-perl (0.423400-2) ... Selecting previously unselected package libopenmpi3t64:i386. Preparing to unpack .../164-libopenmpi3t64_4.1.6-13.3_i386.deb ... Unpacking libopenmpi3t64:i386 (4.1.6-13.3) ... Selecting previously unselected package libuv1t64:i386. Preparing to unpack .../165-libuv1t64_1.48.0-7_i386.deb ... Unpacking libuv1t64:i386 (1.48.0-7) ... Selecting previously unselected package mafft. Preparing to unpack .../166-mafft_7.505-1_i386.deb ... Unpacking mafft (7.505-1) ... Selecting previously unselected package muscle. Preparing to unpack .../167-muscle_1%3a5.1.0-1_i386.deb ... Unpacking muscle (1:5.1.0-1) ... Selecting previously unselected package ncbi-data. Preparing to unpack .../168-ncbi-data_6.1.20170106+dfsg2-5_all.deb ... Unpacking ncbi-data (6.1.20170106+dfsg2-5) ... Selecting previously unselected package ncbi-blast+. Preparing to unpack .../169-ncbi-blast+_2.16.0+ds-6+b1_i386.deb ... Unpacking ncbi-blast+ (2.16.0+ds-6+b1) ... Selecting previously unselected package ncbi-blast+-legacy. Preparing to unpack .../170-ncbi-blast+-legacy_2.16.0+ds-6_all.deb ... Unpacking ncbi-blast+-legacy (2.16.0+ds-6) ... Selecting previously unselected package ncoils. Preparing to unpack .../171-ncoils_2002-9_i386.deb ... Unpacking ncoils (2002-9) ... Selecting previously unselected package openmpi-common. Preparing to unpack .../172-openmpi-common_4.1.6-13.3_all.deb ... Unpacking openmpi-common (4.1.6-13.3) ... Selecting previously unselected package openmpi-bin. Preparing to unpack .../173-openmpi-bin_4.1.6-13.3_i386.deb ... Unpacking openmpi-bin (4.1.6-13.3) ... Selecting previously unselected package pal2nal. Preparing to unpack .../174-pal2nal_14.1-3_all.deb ... Unpacking pal2nal (14.1-3) ... Selecting previously unselected package phyml. Preparing to unpack .../175-phyml_3%3a3.3.20220408-3+b1_i386.deb ... Unpacking phyml (3:3.3.20220408-3+b1) ... Selecting previously unselected package primer3. Preparing to unpack .../176-primer3_2.6.1-4_i386.deb ... Unpacking primer3 (2.6.1-4) ... Selecting previously unselected package probcons. Preparing to unpack .../177-probcons_1.12-14_i386.deb ... Unpacking probcons (1.12-14) ... Selecting previously unselected package raxml. Preparing to unpack .../178-raxml_8.2.13+dfsg-1+b1_i386.deb ... Unpacking raxml (8.2.13+dfsg-1+b1) ... Selecting previously unselected package sim4. Preparing to unpack .../179-sim4_0.0.20121010-8_i386.deb ... Unpacking sim4 (0.0.20121010-8) ... Selecting previously unselected package wise-data. Preparing to unpack .../180-wise-data_2.4.1-25_all.deb ... Unpacking wise-data (2.4.1-25) ... Selecting previously unselected package wise. Preparing to unpack .../181-wise_2.4.1-25_i386.deb ... Unpacking wise (2.4.1-25) ... Setting up media-types (10.1.0) ... Setting up libmodule-pluggable-perl (5.2-5) ... Setting up libpipeline1:i386 (1.5.8-1) ... Setting up liblmdb0:i386 (0.9.31-1+b2) ... Setting up ncbi-data (6.1.20170106+dfsg2-5) ... Setting up libpciaccess0:i386 (0.17-3+b2) ... Setting up libxau6:i386 (1:1.0.11-1) ... Setting up libxdmcp6:i386 (1:1.1.5-1) ... Setting up libkeyutils1:i386 (1.6.3-4) ... Setting up libxcb1:i386 (1.17.0-2+b1) ... Setting up libicu72:i386 (72.1-5+b1) ... Setting up bsdextrautils (2.40.2-11) ... Setting up probcons (1.12-14) ... Setting up libdynaloader-functions-perl (0.004-1) ... Setting up libtest-deep-perl (1.204-1) ... Setting up libclass-method-modifiers-perl (2.15-1) ... Setting up libxml-regexp-perl (0.04-1.1) ... Setting up libio-pty-perl (1:1.20-1+b2) ... Setting up libmagic-mgc (1:5.45-3+b1) ... Setting up libcbor0.10:i386 (0.10.2-2) ... Setting up mafft (7.505-1) ... Setting up libclone-perl:i386 (0.47-1+b1) ... Setting up libalgorithm-diff-perl (1.201-1) ... Setting up libarchive-zip-perl (1.68-1) ... Setting up libtirpc-common (1.3.4+ds-1.3) ... Setting up libhtml-tagset-perl (3.24-1) ... Setting up libdebhelper-perl (13.20) ... Setting up libbrotli1:i386 (1.1.0-2+b6) ... Setting up libedit2:i386 (3.1-20240808-1) ... Setting up libfile-slurp-tiny-perl (0.004-2) ... Setting up liblwp-mediatypes-perl (6.04-2) ... Setting up libuv1t64:i386 (1.48.0-7) ... Setting up libmagic1t64:i386 (1:5.45-3+b1) ... Setting up libtry-tiny-perl (0.32-1) ... Setting up libpsl5t64:i386 (0.21.2-1.1+b1) ... Setting up libnghttp2-14:i386 (1.64.0-1) ... Setting up perl-openssl-defaults:i386 (7+b2) ... Setting up libxml-namespacesupport-perl (1.12-2) ... Setting up gettext-base (0.22.5-2) ... Setting up m4 (1.4.19-4) ... Setting up libencode-locale-perl (1.05-3) ... Setting up ncoils (2002-9) ... Setting up libcom-err2:i386 (1.47.1-1+b1) ... Setting up hyphy-common (2.5.62+dfsg-1) ... Setting up file (1:5.45-3+b1) ... Setting up muscle (1:5.1.0-1) ... Setting up libelf1t64:i386 (0.192-4) ... Setting up libmodule-build-perl (0.423400-2) ... Setting up libkrb5support0:i386 (1.21.3-3) ... Setting up libsasl2-modules-db:i386 (2.1.28+dfsg1-8) ... Setting up tzdata (2024b-3) ... Current default time zone: 'Etc/UTC' Local time is now: Wed Jan 7 05:35:31 UTC 2026. Universal Time is now: Wed Jan 7 05:35:31 UTC 2026. Run 'dpkg-reconfigure tzdata' if you wish to change it. Setting up infernal (1.1.5-2) ... Setting up libxml-sax-base-perl (1.09-3) ... Setting up libio-string-perl (1.08-4) ... Setting up primer3 (2.6.1-4) ... Setting up kalign (1:3.4.0-1+b1) ... Setting up autotools-dev (20220109.1) ... Setting up libglib2.0-0t64:i386 (2.82.2-3) ... No schema files found: doing nothing. Setting up libclass-data-inheritable-perl (0.10-1) ... Setting up lagan (2.0-10) ... Setting up libx11-data (2:1.8.10-2) ... Setting up libtext-diff-perl (1.45-2) ... Setting up librtmp1:i386 (2.4+20151223.gitfa8646d.1-2+b5) ... Setting up libxml-xpathengine-perl (0.14-2) ... Setting up sim4 (0.0.20121010-8) ... Setting up libxml-writer-perl (0.900-2) ... Setting up libhwloc15:i386 (2.11.2-1) ... Setting up libio-html-perl (1.004-3) ... Setting up autopoint (0.22.5-2) ... Setting up libb-hooks-op-check-perl:i386 (0.22-3+b2) ... Setting up libipc-run-perl (20231003.0-2) ... Setting up wise-data (2.4.1-25) ... Setting up libk5crypto3:i386 (1.21.3-3) ... Setting up amap-align (2.2+git20080214.600fc29+dfsg-2) ... Setting up libsasl2-2:i386 (2.1.28+dfsg1-8) ... Setting up autoconf (2.72-3) ... Setting up libnghttp3-9:i386 (1.6.0-2) ... Setting up libcapture-tiny-perl (0.48-2) ... Setting up libtimedate-perl (2.3300-2) ... Setting up libtree-dagnode-perl (1.32-1) ... Setting up dwz (0.15-1+b1) ... Setting up libdata-stag-perl (0.14-3) ... Setting up sensible-utils (0.0.24) ... Setting up ocl-icd-libopencl1:i386 (2.3.2-1+b2) ... Setting up libuchardet0:i386 (0.0.8-1+b2) ... Setting up pal2nal (14.1-3) ... Setting up libnl-3-200:i386 (3.7.0-0.3+b1) ... Setting up librole-tiny-perl (2.002004-1) ... Setting up openmpi-common (4.1.6-13.3) ... Setting up libconfig-any-perl (0.33-1) ... Setting up libsub-uplevel-perl (0.2800-3) ... Setting up libx11-6:i386 (2:1.8.10-2) ... Setting up fasttree (2.1.11-2) ... Setting up netbase (6.4) ... Setting up libngtcp2-16:i386 (1.9.1-1) ... Setting up libsub-quote-perl (2.006008-1) ... Setting up libdevel-stacktrace-perl (2.0500-1) ... Setting up libclass-xsaccessor-perl (1.19-4+b4) ... Setting up libkrb5-3:i386 (1.21.3-3) ... Setting up libevent-core-2.1-7t64:i386 (2.1.12-stable-10+b1) ... Setting up libbio-perl-perl (1.7.8-1) ... Setting up libmbedcrypto16:i386 (3.6.2-3) ... Setting up libpsm-infinipath1 (3.3+20.604758e7-6.3) ... update-alternatives: using /usr/lib/libpsm1/libpsm_infinipath.so.1.16 to provide /usr/lib/i386-linux-gnu/libpsm_infinipath.so.1 (libpsm_infinipath.so.1) in auto mode Setting up libssh2-1t64:i386 (1.11.1-1) ... Setting up libexporter-tiny-perl (1.006002-1) ... Setting up libfido2-1:i386 (1.15.0-1+b1) ... Setting up libdivsufsort3:i386 (2.0.1-6+b1) ... Setting up openssl (3.3.2-2) ... Setting up readline-common (8.2-5) ... Setting up libxml2:i386 (2.12.7+dfsg+really2.9.14-0.2+b1) ... Setting up exonerate (2.4.0-5+b1) ... Setting up liburi-perl (5.30-1) ... Setting up libngtcp2-crypto-gnutls8:i386 (1.9.1-1) ... Setting up libfile-sort-perl (1.01-3) ... Setting up raxml (8.2.13+dfsg-1+b1) ... Setting up libtext-csv-perl (2.04-1) ... Setting up libnet-ssleay-perl:i386 (1.94-2) ... Setting up automake (1:1.16.5-1.3) ... update-alternatives: using /usr/bin/automake-1.16 to provide /usr/bin/automake (automake) in auto mode Setting up libfile-stripnondeterminism-perl (1.14.0-1) ... Setting up libhttp-date-perl (6.06-1) ... Setting up gettext (0.22.5-2) ... Setting up libfile-listing-perl (6.16-1) ... Setting up libtool (2.4.7-8) ... Setting up libevent-pthreads-2.1-7t64:i386 (2.1.12-stable-10+b1) ... Setting up wise (2.4.1-25) ... Setting up libtest-warn-perl (0.37-2) ... Setting up libtype-tiny-perl (2.004000-1) ... Setting up libtest-differences-perl (0.71-1) ... Setting up libxext6:i386 (2:1.3.4-1+b2) ... Setting up libnet-http-perl (6.23-1) ... Setting up libexception-class-perl (1.45-1) ... Setting up libdevel-callchecker-perl:i386 (0.009-1+b1) ... Setting up libldap-2.5-0:i386 (2.5.18+dfsg-3+b1) ... Setting up intltool-debian (0.35.0+20060710.6) ... Setting up libnl-route-3-200:i386 (3.7.0-0.3+b1) ... Setting up libxnvctrl0:i386 (535.171.04-1+b1) ... Setting up dh-autoreconf (20) ... Setting up ca-certificates (20240203) ... Updating certificates in /etc/ssl/certs... 146 added, 0 removed; done. Setting up libmbedx509-7:i386 (3.6.2-3) ... Setting up libtest-exception-perl (0.43-3) ... Setting up libgssapi-krb5-2:i386 (1.21.3-3) ... Setting up ucf (3.0043+nmu1) ... Setting up libmbedtls21:i386 (3.6.2-3) ... Setting up libreadline8t64:i386 (8.2-5) ... Setting up dh-strip-nondeterminism (1.14.0-1) ... Setting up libwww-robotrules-perl (6.02-1) ... Setting up groff-base (1.23.0-5) ... Setting up libhtml-parser-perl:i386 (3.83-1+b1) ... Setting up hmmer (3.4+dfsg-2) ... Setting up libio-socket-ssl-perl (2.089-1) ... Setting up libhttp-message-perl (7.00-2) ... Setting up libhttp-negotiate-perl (6.01-2) ... Setting up libibverbs1:i386 (52.0-2+b1) ... Setting up libtirpc3t64:i386 (1.3.4+ds-1.3+b1) ... Setting up libhttp-cookies-perl (6.11-1) ... Setting up libtest-most-perl (0.38-1) ... Setting up openssh-client (1:9.9p1-3) ... Setting up po-debconf (1.0.21+nmu1) ... Setting up libhtml-tree-perl (5.07-3) ... Setting up libparams-classify-perl:i386 (0.015-2+b4) ... Setting up libcurl3t64-gnutls:i386 (8.11.0-1) ... Setting up hyphy-pt (2.5.62+dfsg-1+b1) ... Setting up libhwloc-plugins:i386 (2.11.2-1) ... Setting up man-db (2.13.0-1) ... Not building database; man-db/auto-update is not 'true'. Setting up libxml-sax-perl (1.02+dfsg-4) ... update-perl-sax-parsers: Registering Perl SAX parser XML::SAX::PurePerl with priority 10... update-perl-sax-parsers: Updating overall Perl SAX parser modules info file... Creating config file /etc/perl/XML/SAX/ParserDetails.ini with new version Setting up libmodule-runtime-perl (0.016-2) ... Setting up libxml-libxml-perl (2.0207+dfsg+really+2.0134-5+b1) ... update-perl-sax-parsers: Registering Perl SAX parser XML::LibXML::SAX::Parser with priority 50... update-perl-sax-parsers: Registering Perl SAX parser XML::LibXML::SAX with priority 50... update-perl-sax-parsers: Updating overall Perl SAX parser modules info file... Replacing config file /etc/perl/XML/SAX/ParserDetails.ini with new version Setting up libnsl2:i386 (1.3.0-3+b3) ... Setting up librdmacm1t64:i386 (52.0-2+b1) ... Setting up bioperl (1.7.8-1) ... Setting up libfabric1:i386 (1.17.0-3.1) ... Setting up libpython3.12-stdlib:i386 (3.12.7-3) ... Setting up libimport-into-perl (1.002005-2) ... Setting up libmoo-perl (2.005005-1) ... Setting up python3.12 (3.12.7-3) ... Setting up debhelper (13.20) ... Setting up libarray-compare-perl (3.0.8-1) ... Setting up libxml-simple-perl (2.25-2) ... Setting up libopenmpi3t64:i386 (4.1.6-13.3) ... Setting up openmpi-bin (4.1.6-13.3) ... update-alternatives: using /usr/bin/mpirun.openmpi to provide /usr/bin/mpirun (mpirun) in auto mode update-alternatives: using /usr/bin/mpicc.openmpi to provide /usr/bin/mpicc (mpi) in auto mode Setting up phyml (3:3.3.20220408-3+b1) ... Setting up libpython3-stdlib:i386 (3.12.6-1) ... Setting up python3 (3.12.6-1) ... Setting up ncbi-blast+ (2.16.0+ds-6+b1) ... Setting up bedtools-test (2.31.1+dfsg-2) ... Setting up ncbi-blast+-legacy (2.16.0+ds-6) ... Setting up liblwp-protocol-https-perl (6.14-1) ... Setting up libwww-perl (6.77-1) ... Setting up libbio-tools-run-remoteblast-perl (1.7.3-3) ... Setting up libxml-parser-perl (2.47-1+b3) ... Setting up libxml-twig-perl (1:3.52-3) ... Setting up libbio-variation-perl (1.7.5-3) ... Setting up libxml-perl (0.08-4) ... Setting up libbio-cluster-perl (1.7.3-6) ... Setting up libxml-dom-perl (1.46-2) ... Setting up libbio-asn1-entrezgene-perl (1.730-3) ... Setting up libxml-dom-xpath-perl (0.14-4) ... Setting up libbio-eutilities-perl (1.77-2) ... Setting up libbio-featureio-perl (1.6.905-2) ... Processing triggers for libc-bin (2.40-3) ... Processing triggers for ca-certificates (20240203) ... Updating certificates in /etc/ssl/certs... 0 added, 0 removed; done. Running hooks in /etc/ca-certificates/update.d... done. Reading package lists... Building dependency tree... Reading state information... Reading extended state information... Initializing package states... Writing extended state information... Building tag database... -> Finished parsing the build-deps I: Building the package I: user script /srv/workspace/pbuilder/12030/tmp/hooks/A99_set_merged_usr starting Not re-configuring usrmerge for trixie I: user script /srv/workspace/pbuilder/12030/tmp/hooks/A99_set_merged_usr finished hostname: Name or service not known I: Running cd /build/reproducible-path/bioperl-run-1.7.3/ && env PATH="/usr/sbin:/usr/bin:/sbin:/bin:/usr/games:/i/capture/the/path" HOME="/nonexistent/second-build" dpkg-buildpackage -us -uc -b && env PATH="/usr/sbin:/usr/bin:/sbin:/bin:/usr/games:/i/capture/the/path" HOME="/nonexistent/second-build" dpkg-genchanges -S > ../bioperl-run_1.7.3-13_source.changes dpkg-buildpackage: info: source package bioperl-run dpkg-buildpackage: info: source version 1.7.3-13 dpkg-buildpackage: info: source distribution unstable dpkg-buildpackage: info: source changed by Étienne Mollier dpkg-source --before-build . dpkg-buildpackage: info: host architecture i386 debian/rules clean dh clean dh_clean debian/rules binary dh binary dh_update_autotools_config dh_autoreconf debian/rules override_dh_auto_configure make[1]: Entering directory '/build/reproducible-path/bioperl-run-1.7.3' dh_auto_configure -- --install_scripts /usr/bin/perl Build.PL --installdirs vendor --config "optimize=-g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/bioperl-run-1.7.3=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2" --config "ld=i686-linux-gnu-gcc -g -O2 -Werror=implicit-function-declaration -ffile-prefix-map=/build/reproducible-path/bioperl-run-1.7.3=. -fstack-protector-strong -Wformat -Werror=format-security -Wl,-z,relro" --install_scripts Do you want to run tests that require connection to servers across the internet (likely to cause some failures)? y/n [n ]n Can't find dist packages without a MANIFEST file Run 'Build manifest' to generate one WARNING: Possible missing or corrupt 'MANIFEST' file. Nothing to enter for 'provides' field in metafile. - will not run internet-requiring tests Created MYMETA.yml and MYMETA.json Creating new 'Build' script for 'BioPerl-Run' version '1.007003' make[1]: Leaving directory '/build/reproducible-path/bioperl-run-1.7.3' dh_auto_build /usr/bin/perl Build Building BioPerl-Run debian/rules override_dh_auto_test make[1]: Entering directory '/build/reproducible-path/bioperl-run-1.7.3' mkdir t.skip for t in Blat Eponine Glimmer2 RepeatMasker Phyml Hyphy MCS ; do mv t/${t}.t t.skip ; done PATH=$PATH:/usr/lib/emboss:/usr/lib/phylip/bin/:/usr/lib/tigr-glimmer:debian/test_hack_bin \ PHYLIPDIR=/usr/lib/phylip/bin HOME_4_TCOFFEE=/tmp COILSDIR=/usr/share/ncoils/ \ dh_auto_test --no-parallel /usr/bin/perl Build test --verbose 1 AMAP version AMAP.2.2 - align multiple protein sequences and print to standard output PROBCONS Written by Chuong Do AMAP algorithm implemented by Ariel Schwartz Using parameter set: initDistrib[] = { 0.400000006 0.3000000119 0.3000000119 } gapOpen[] = { 0.01993141696 0.01993141696 } gapExtend[] = { 0.7943345308 0.7943345308 } Loading sequence file: t/data/cysprot.fa Computing posterior matrices Building DAG Starting the sequence annealing process Creating candidate edge list Adding edges to the DAG AMAP version AMAP.2.2 - align multiple protein sequences and print to standard output PROBCONS Written by Chuong Do AMAP algorithm implemented by Ariel Schwartz Using parameter set: initDistrib[] = { 0.400000006 0.3000000119 0.3000000119 } gapOpen[] = { 0.01993141696 0.01993141696 } gapExtend[] = { 0.7943345308 0.7943345308 } Loading sequence file: /tmp/cXxhswS60q Computing posterior matrices Building DAG Starting the sequence annealing process Creating candidate edge list Adding edges to the DAG t/Amap.t ...................... 1..18 ok 1 - use Bio::Tools::Run::Alignment::Amap; ok 2 - use Bio::SeqIO; ok 3 - use File::Spec; ok 4 - Found input file ok 5 - An object of class 'Bio::Tools::Run::Alignment::Amap' isa 'Bio::Tools::Run::Alignment::Amap' ok 6 - program_dir returned correct default ok 7 - error_string returned correct default ok 8 - aformat returned correct default ok 9 - outfile_name returned correct default ok 10 - Correct exe default name ok 11 - Correct minimum program version ok 12 - No error occured ok 13 - outfile_name returned something ok 14 - An object of class 'Bio::SimpleAlign' isa 'Bio::SimpleAlign' ok 15 - Correct number of seqs returned ok 16 - An object of class 'Bio::SimpleAlign' isa 'Bio::SimpleAlign' ok 17 - Correct number of seqs returned ok 18 - Got the correct ave % identity ok # Required executable for Bio::Tools::Run::BEDTools is not present t/BEDTools.t .................. 1..423 ok 1 - make a default factory ok 2 - default to command 'bam_to_bed' ok 3 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 4 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 5 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 6 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 7 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 8 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 9 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 10 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 11 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 12 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 13 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 14 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 15 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 16 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 17 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 18 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 19 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 20 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 21 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 22 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 23 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 24 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 25 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 26 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 27 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 28 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 29 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 30 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 31 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 32 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 33 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 34 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 35 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 36 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 37 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 38 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 39 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 40 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 41 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 42 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 43 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 44 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 45 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 46 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 47 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 48 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 49 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 50 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 51 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 52 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 53 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 54 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 55 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 56 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 57 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 58 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 59 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 60 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 61 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 62 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 63 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 64 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 65 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 66 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 67 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 68 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 69 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 70 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 71 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 72 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 73 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 74 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 75 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 76 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 77 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 78 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 79 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 80 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 81 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 82 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 83 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 84 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 85 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 86 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 87 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 88 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 89 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 90 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 91 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 92 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 93 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 94 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 95 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 96 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 97 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 98 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 99 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 100 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 101 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 102 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 103 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 104 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 105 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 106 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 107 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 108 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 109 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 110 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 111 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 112 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 113 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 114 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 115 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 116 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 117 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 118 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 119 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 120 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 121 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 122 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 123 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 124 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 125 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 126 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 127 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 128 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 129 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 130 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 131 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 132 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 133 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 134 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 135 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 136 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 137 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 138 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 139 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 140 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 141 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 142 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 143 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 144 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 145 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 146 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 147 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 148 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 149 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 150 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 151 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 152 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 153 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 154 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 155 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 156 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 157 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 158 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 159 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 160 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 161 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 162 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 163 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 164 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 165 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 166 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 167 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 168 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 169 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 170 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 171 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 172 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 173 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 174 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 175 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 176 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 177 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 178 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 179 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 180 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 181 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 182 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 183 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 184 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 185 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 186 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 187 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 188 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 189 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 190 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 191 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 192 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 193 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 194 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 195 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 196 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 197 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 198 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 199 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 200 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 201 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 202 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 203 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 204 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 205 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 206 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 207 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 208 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 209 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 210 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 211 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 212 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 213 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 214 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 215 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 216 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 217 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 218 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 219 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 220 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 221 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 222 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 223 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 224 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 225 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 226 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 227 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 228 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 229 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 230 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 231 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 232 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 233 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 234 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 235 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 236 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 237 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 238 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 239 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 240 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 241 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 242 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 243 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 244 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 245 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 246 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 247 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 248 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 249 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 250 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 251 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 252 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 253 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 254 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 255 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 256 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 257 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 258 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 259 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 260 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 261 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 262 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 263 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 264 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 265 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 266 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 267 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 268 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 269 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 270 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 271 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 272 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 273 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 274 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 275 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 276 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 277 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 278 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 279 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 280 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 281 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 282 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 283 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 284 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 285 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 286 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 287 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 288 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 289 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 290 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 291 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 292 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 293 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 294 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 295 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 296 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 297 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 298 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 299 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 300 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 301 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 302 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 303 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 304 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 305 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 306 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 307 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 308 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 309 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 310 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 311 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 312 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 313 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 314 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 315 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 316 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 317 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 318 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 319 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 320 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 321 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 322 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 323 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 324 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 325 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 326 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 327 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 328 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 329 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 330 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 331 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 332 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 333 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 334 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 335 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 336 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 337 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 338 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 339 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 340 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 341 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 342 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 343 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 344 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 345 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 346 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 347 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 348 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 349 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 350 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 351 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 352 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 353 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 354 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 355 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 356 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 357 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 358 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 359 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 360 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 361 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 362 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 363 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 364 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 365 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 366 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 367 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 368 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 369 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 370 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 371 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 372 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 373 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 374 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 375 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 376 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 377 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 378 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 379 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 380 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 381 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 382 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 383 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 384 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 385 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 386 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 387 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 388 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 389 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 390 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 391 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 392 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 393 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 394 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 395 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 396 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 397 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 398 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 399 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 400 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 401 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 402 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 403 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 404 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 405 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 406 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 407 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 408 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 409 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 410 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 411 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 412 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 413 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 414 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 415 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 416 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 417 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 418 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 419 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 420 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 421 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 422 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok 423 # skip Required executable for Bio::Tools::Run::BEDTools is not present ok # You named your test '71'. You shouldn't use numbers for your test names. # Very confusing. # You named your test '91'. You shouldn't use numbers for your test names. # Very confusing. t/Coil.t ...................... 1..6 ok 1 - use Bio::Tools::Run::Coil; ok 2 - use Bio::SeqIO; ok 3 ok 4 ok 5 - 71 ok 6 - 91 ok # Required executable for Bio::Tools::Run::Phylo::Phylip::Consense is not present t/Consense.t .................. 1..8 ok 1 - use Bio::Tools::Run::Phylo::Phylip::Consense; ok 2 - use Bio::AlignIO; ok 3 # skip Required executable for Bio::Tools::Run::Phylo::Phylip::Consense is not present ok 4 # skip Required executable for Bio::Tools::Run::Phylo::Phylip::Consense is not present ok 5 # skip Required executable for Bio::Tools::Run::Phylo::Phylip::Consense is not present ok 6 # skip Required executable for Bio::Tools::Run::Phylo::Phylip::Consense is not present ok 7 # skip Required executable for Bio::Tools::Run::Phylo::Phylip::Consense is not present ok 8 # skip Required executable for Bio::Tools::Run::Phylo::Phylip::Consense is not present ok Find start end points: 1000 Cells done [ 2%] 2000 Cells done [ 4%] 3000 Cells done [ 6%] 4000 Cells done [ 8%] 5000 Cells done [10%] 6000 Cells done [12%] 7000 Cells done [14%] 8000 Cells done [17%] 9000 Cells done [19%] 10000 Cells done [21%] 11000 Cells done [23%] 12000 Cells done [25%] 13000 Cells done [27%] 14000 Cells done [29%] 15000 Cells done [32%] 16000 Cells done [34%] 17000 Cells done [36%] 18000 Cells done [38%] 19000 Cells done [40%] 20000 Cells done [42%] 21000 Cells done [44%] 22000 Cells done [46%] 23000 Cells done [49%] 24000 Cells done [51%] 25000 Cells done [53%] 26000 Cells done [55%] 27000 Cells done [57%] 28000 Cells done [59%] 29000 Cells done [61%] 30000 Cells done [64%] 31000 Cells done [66%] 32000 Cells done [68%] 33000 Cells done [70%] 34000 Cells done [72%] 35000 Cells done [74%] 36000 Cells done [76%] 37000 Cells done [79%] 38000 Cells done [81%] 39000 Cells done [83%] 40000 Cells done [85%] 41000 Cells done [87%] 42000 Cells done [89%] 43000 Cells done [91%] 44000 Cells done [93%] 45000 Cells done [96%] 46000 Cells done [98%][0,0][0,0] Score 0 Recovering alignment: [0,0][0,0] Explicit read offWarning Error Major problem (!) - in DnaMatchBlock read off, position 0,0 state 0 no source found! Warning Error In DnaMatchBlock hidden read off, between 0:0,0:0 - at got bad read off. Problem! Warning Error In full dc, at 0:0,0:0 got a bad hidden explicit read off... Warning Error Major problem (!) - in DnaMatchBlock matrix to special read off, position 0,0 state 0 no source found! Warning Error Problem in reading off special state system, hit a non start state (or an internal error) in a single alignment mode Find start end points: 1000 Cells done [ 2%] 2000 Cells done [ 4%] 3000 Cells done [ 7%] 4000 Cells done [ 9%] 5000 Cells done [12%] 6000 Cells done [14%] 7000 Cells done [17%] 8000 Cells done [19%] 9000 Cells done [21%] 10000 Cells done [24%] 11000 Cells done [26%] 12000 Cells done [29%] 13000 Cells done [31%] 14000 Cells done [34%] 15000 Cells done [36%] 16000 Cells done [38%] 17000 Cells done [41%] 18000 Cells done [43%] 19000 Cells done [46%] 20000 Cells done [48%] 21000 Cells done [51%] 22000 Cells done [53%] 23000 Cells done [55%] 24000 Cells done [58%] 25000 Cells done [60%] 26000 Cells done [63%] 27000 Cells done [65%] 28000 Cells done [68%] 29000 Cells done [70%] 30000 Cells done [72%] 31000 Cells done [75%] 32000 Cells done [77%] 33000 Cells done [80%] 34000 Cells done [82%] 35000 Cells done [85%] 36000 Cells done [87%] 37000 Cells done [89%] 38000 Cells done [92%] 39000 Cells done [94%] 40000 Cells done [97%] 41000 Cells done [99%][0,0][0,0] Score 0 Recovering alignment: [0,0][0,0] Explicit read offWarning Error Major problem (!) - in DnaMatchBlock read off, position 0,0 state 0 no source found! Warning Error In DnaMatchBlock hidden read off, between 0:0,0:0 - at got bad read off. Problem! Warning Error In full dc, at 0:0,0:0 got a bad hidden explicit read off... Warning Error Major problem (!) - in DnaMatchBlock matrix to special read off, position 0,0 state 0 no source found! Warning Error Problem in reading off special state system, hit a non start state (or an internal error) in a single alignment mode Find start end points: 1000 Cells done [ 2%] 2000 Cells done [ 4%] 3000 Cells done [ 6%] 4000 Cells done [ 8%] 5000 Cells done [10%] 6000 Cells done [12%] 7000 Cells done [14%] 8000 Cells done [17%] 9000 Cells done [19%] 10000 Cells done [21%] 11000 Cells done [23%] 12000 Cells done [25%] 13000 Cells done [27%] 14000 Cells done [29%] 15000 Cells done [32%] 16000 Cells done [34%] 17000 Cells done [36%] 18000 Cells done [38%] 19000 Cells done [40%] 20000 Cells done [42%] 21000 Cells done [44%] 22000 Cells done [46%] 23000 Cells done [49%] 24000 Cells done [51%] 25000 Cells done [53%] 26000 Cells done [55%] 27000 Cells done [57%] 28000 Cells done [59%] 29000 Cells done [61%] 30000 Cells done [64%] 31000 Cells done [66%] 32000 Cells done [68%] 33000 Cells done [70%] 34000 Cells done [72%] 35000 Cells done [74%] 36000 Cells done [76%] 37000 Cells done [79%] 38000 Cells done [81%] 39000 Cells done [83%] 40000 Cells done [85%] 41000 Cells done [87%] 42000 Cells done [89%] 43000 Cells done [91%] 44000 Cells done [93%] 45000 Cells done [96%] 46000 Cells done [98%][0,0][0,0] Score 0 Recovering alignment: [0,0][0,0] Explicit read offWarning Error Major problem (!) - in DnaMatchBlock read off, position 0,0 state 0 no source found! Warning Error In DnaMatchBlock hidden read off, between 0:0,0:0 - at got bad read off. Problem! Warning Error In full dc, at 0:0,0:0 got a bad hidden explicit read off... Warning Error Major problem (!) - in DnaMatchBlock matrix to special read off, position 0,0 state 0 no source found! Warning Error Problem in reading off special state system, hit a non start state (or an internal error) in a single alignment mode t/DBA.t ....................... 1..5 ok 1 - use Bio::Tools::Run::Alignment::DBA; ok 2 - use Bio::SimpleAlign; ok 3 - use Bio::AlignIO; ok 4 - use Bio::SeqIO; ok 5 - An object of class 'Bio::Tools::Run::Alignment::DBA' isa 'Bio::Tools::Run::Alignment::DBA' ok # Required executable for Bio::Tools::Run::Phylo::Phylip::DrawGram is not present t/DrawGram.t .................. 1..6 ok 1 - use Bio::Tools::Run::Phylo::Phylip::DrawGram; ok 2 - use Bio::TreeIO; ok 3 # skip Required executable for Bio::Tools::Run::Phylo::Phylip::DrawGram is not present ok 4 # skip Required executable for Bio::Tools::Run::Phylo::Phylip::DrawGram is not present ok 5 # skip Required executable for Bio::Tools::Run::Phylo::Phylip::DrawGram is not present ok 6 # skip Required executable for Bio::Tools::Run::Phylo::Phylip::DrawGram is not present ok # Required executable for Bio::Tools::Run::Phylo::Phylip::DrawTree is not present t/DrawTree.t .................. 1..6 ok 1 - use Bio::Tools::Run::Phylo::Phylip::DrawTree; ok 2 - use Bio::TreeIO; ok 3 # skip Required executable for Bio::Tools::Run::Phylo::Phylip::DrawTree is not present ok 4 # skip Required executable for Bio::Tools::Run::Phylo::Phylip::DrawTree is not present ok 5 # skip Required executable for Bio::Tools::Run::Phylo::Phylip::DrawTree is not present ok 6 # skip Required executable for Bio::Tools::Run::Phylo::Phylip::DrawTree is not present ok t/EMBOSS.t .................... 1..31 ok 1 - use Bio::Root::IO; ok 2 - use Bio::SeqIO; ok 3 - use Bio::AlignIO; ok 4 - use Bio::Factory::EMBOSS; ok 5 ok 6 # skip EMBOSS not installed ok 7 # skip EMBOSS not installed ok 8 # skip EMBOSS not installed ok 9 # skip EMBOSS not installed ok 10 # skip EMBOSS not installed ok 11 # skip EMBOSS not installed ok 12 # skip EMBOSS not installed ok 13 # skip EMBOSS not installed ok 14 # skip EMBOSS not installed ok 15 # skip EMBOSS not installed ok 16 # skip EMBOSS not installed ok 17 # skip EMBOSS not installed ok 18 # skip EMBOSS not installed ok 19 # skip EMBOSS not installed ok 20 # skip EMBOSS not installed ok 21 # skip EMBOSS not installed ok 22 # skip EMBOSS not installed ok 23 # skip EMBOSS not installed ok 24 # skip EMBOSS not installed ok 25 # skip EMBOSS not installed ok 26 # skip EMBOSS not installed ok 27 # skip EMBOSS not installed ok 28 # skip EMBOSS not installed ok 29 # skip EMBOSS not installed ok 30 # skip EMBOSS not installed ok 31 # skip EMBOSS not installed ok t/Exonerate.t ................. 1..89 ok 1 - use Bio::Tools::Run::Alignment::Exonerate; ok 2 - An object of class 'Bio::Tools::Run::Alignment::Exonerate' isa 'Bio::Tools::Run::Alignment::Exonerate' ok 3 ok 4 - An object of class 'Bio::SearchIO::exonerate' isa 'Bio::SearchIO' ok 5 ok 6 ok 7 ok 8 ok 9 ok 10 ok 11 ok 12 ok 13 ok 14 ok 15 ok 16 ok 17 ok 18 ok 19 ok 20 ok 21 ok 22 ok 23 ok 24 ok 25 ok 26 ok 27 ok 28 ok 29 ok 30 ok 31 ok 32 ok 33 ok 34 ok 35 ok 36 ok 37 ok 38 ok 39 ok 40 ok 41 ok 42 ok 43 ok 44 ok 45 ok 46 ok 47 - An object of class 'Bio::SearchIO::exonerate' isa 'Bio::SearchIO' ok 48 ok 49 ok 50 ok 51 ok 52 ok 53 ok 54 ok 55 ok 56 ok 57 ok 58 ok 59 ok 60 ok 61 ok 62 ok 63 ok 64 ok 65 ok 66 ok 67 ok 68 ok 69 ok 70 ok 71 ok 72 ok 73 ok 74 ok 75 ok 76 ok 77 ok 78 ok 79 ok 80 ok 81 ok 82 ok 83 ok 84 ok 85 ok 86 ok 87 ok 88 ok 89 ok t/FastTree.t .................. 1..9 ok 1 - use Bio::Root::IO; ok 2 - use Bio::Tools::Run::Phylo::FastTree; ok 3 - use Bio::AlignIO; ok 4 - Make the object ok 5 - Tree is defined ok 6 - Number of nodes is correct ok 7 - Tree is defined ok 8 - Tree is defined ok 9 - Tree is defined ok # Required executable for Bio::Tools::Run::FootPrinter is not present t/FootPrinter.t ............... 1..24 ok 1 - use Bio::Tools::Run::FootPrinter; ok 2 - use Bio::SeqIO; ok 3 # skip Required executable for Bio::Tools::Run::FootPrinter is not present ok 4 # skip Required executable for Bio::Tools::Run::FootPrinter is not present ok 5 # skip Required executable for Bio::Tools::Run::FootPrinter is not present ok 6 # skip Required executable for Bio::Tools::Run::FootPrinter is not present ok 7 # skip Required executable for Bio::Tools::Run::FootPrinter is not present ok 8 # skip Required executable for Bio::Tools::Run::FootPrinter is not present ok 9 # skip Required executable for Bio::Tools::Run::FootPrinter is not present ok 10 # skip Required executable for Bio::Tools::Run::FootPrinter is not present ok 11 # skip Required executable for Bio::Tools::Run::FootPrinter is not present ok 12 # skip Required executable for Bio::Tools::Run::FootPrinter is not present ok 13 # skip Required executable for Bio::Tools::Run::FootPrinter is not present ok 14 # skip Required executable for Bio::Tools::Run::FootPrinter is not present ok 15 # skip Required executable for Bio::Tools::Run::FootPrinter is not present ok 16 # skip Required executable for Bio::Tools::Run::FootPrinter is not present ok 17 # skip Required executable for Bio::Tools::Run::FootPrinter is not present ok 18 # skip Required executable for Bio::Tools::Run::FootPrinter is not present ok 19 # skip Required executable for Bio::Tools::Run::FootPrinter is not present ok 20 # skip Required executable for Bio::Tools::Run::FootPrinter is not present ok 21 # skip Required executable for Bio::Tools::Run::FootPrinter is not present ok 22 # skip Required executable for Bio::Tools::Run::FootPrinter is not present ok 23 # skip Required executable for Bio::Tools::Run::FootPrinter is not present ok 24 # skip Required executable for Bio::Tools::Run::FootPrinter is not present ok # Required environment variable $GENEMARK_MODELS is not set t/Genemark.hmm.prokaryotic.t .. 1..99 ok 1 - use Bio::Tools::Run::Genemark; ok 2 - use Bio::Root::IO; ok 3 - use Bio::Seq; ok 4 # skip Required environment variable $GENEMARK_MODELS is not set ok 5 # skip Required environment variable $GENEMARK_MODELS is not set ok 6 # skip Required environment variable $GENEMARK_MODELS is not set ok 7 # skip Required environment variable $GENEMARK_MODELS is not set ok 8 # skip Required environment variable $GENEMARK_MODELS is not set ok 9 # skip Required environment variable $GENEMARK_MODELS is not set ok 10 # skip Required environment variable $GENEMARK_MODELS is not set ok 11 # skip Required environment variable $GENEMARK_MODELS is not set ok 12 # skip Required environment variable $GENEMARK_MODELS is not set ok 13 # skip Required environment variable $GENEMARK_MODELS is not set ok 14 # skip Required environment variable $GENEMARK_MODELS is not set ok 15 # skip Required environment variable $GENEMARK_MODELS is not set ok 16 # skip Required environment variable $GENEMARK_MODELS is not set ok 17 # skip Required environment variable $GENEMARK_MODELS is not set ok 18 # skip Required environment variable $GENEMARK_MODELS is not set ok 19 # skip Required environment variable $GENEMARK_MODELS is not set ok 20 # skip Required environment variable $GENEMARK_MODELS is not set ok 21 # skip Required environment variable $GENEMARK_MODELS is not set ok 22 # skip Required environment variable $GENEMARK_MODELS is not set ok 23 # skip Required environment variable $GENEMARK_MODELS is not set ok 24 # skip Required environment variable $GENEMARK_MODELS is not set ok 25 # skip Required environment variable $GENEMARK_MODELS is not set ok 26 # skip Required environment variable $GENEMARK_MODELS is not set ok 27 # skip Required environment variable $GENEMARK_MODELS is not set ok 28 # skip Required environment variable $GENEMARK_MODELS is not set ok 29 # skip Required environment variable $GENEMARK_MODELS is not set ok 30 # skip Required environment variable $GENEMARK_MODELS is not set ok 31 # skip Required environment variable $GENEMARK_MODELS is not set ok 32 # skip Required environment variable $GENEMARK_MODELS is not set ok 33 # skip Required environment variable $GENEMARK_MODELS is not set ok 34 # skip Required environment variable $GENEMARK_MODELS is not set ok 35 # skip Required environment variable $GENEMARK_MODELS is not set ok 36 # skip Required environment variable $GENEMARK_MODELS is not set ok 37 # skip Required environment variable $GENEMARK_MODELS is not set ok 38 # skip Required environment variable $GENEMARK_MODELS is not set ok 39 # skip Required environment variable $GENEMARK_MODELS is not set ok 40 # skip Required environment variable $GENEMARK_MODELS is not set ok 41 # skip Required environment variable $GENEMARK_MODELS is not set ok 42 # skip Required environment variable $GENEMARK_MODELS is not set ok 43 # skip Required environment variable $GENEMARK_MODELS is not set ok 44 # skip Required environment variable $GENEMARK_MODELS is not set ok 45 # skip Required environment variable $GENEMARK_MODELS is not set ok 46 # skip Required environment variable $GENEMARK_MODELS is not set ok 47 # skip Required environment variable $GENEMARK_MODELS is not set ok 48 # skip Required environment variable $GENEMARK_MODELS is not set ok 49 # skip Required environment variable $GENEMARK_MODELS is not set ok 50 # skip Required environment variable $GENEMARK_MODELS is not set ok 51 # skip Required environment variable $GENEMARK_MODELS is not set ok 52 # skip Required environment variable $GENEMARK_MODELS is not set ok 53 # skip Required environment variable $GENEMARK_MODELS is not set ok 54 # skip Required environment variable $GENEMARK_MODELS is not set ok 55 # skip Required environment variable $GENEMARK_MODELS is not set ok 56 # skip Required environment variable $GENEMARK_MODELS is not set ok 57 # skip Required environment variable $GENEMARK_MODELS is not set ok 58 # skip Required environment variable $GENEMARK_MODELS is not set ok 59 # skip Required environment variable $GENEMARK_MODELS is not set ok 60 # skip Required environment variable $GENEMARK_MODELS is not set ok 61 # skip Required environment variable $GENEMARK_MODELS is not set ok 62 # skip Required environment variable $GENEMARK_MODELS is not set ok 63 # skip Required environment variable $GENEMARK_MODELS is not set ok 64 # skip Required environment variable $GENEMARK_MODELS is not set ok 65 # skip Required environment variable $GENEMARK_MODELS is not set ok 66 # skip Required environment variable $GENEMARK_MODELS is not set ok 67 # skip Required environment variable $GENEMARK_MODELS is not set ok 68 # skip Required environment variable $GENEMARK_MODELS is not set ok 69 # skip Required environment variable $GENEMARK_MODELS is not set ok 70 # skip Required environment variable $GENEMARK_MODELS is not set ok 71 # skip Required environment variable $GENEMARK_MODELS is not set ok 72 # skip Required environment variable $GENEMARK_MODELS is not set ok 73 # skip Required environment variable $GENEMARK_MODELS is not set ok 74 # skip Required environment variable $GENEMARK_MODELS is not set ok 75 # skip Required environment variable $GENEMARK_MODELS is not set ok 76 # skip Required environment variable $GENEMARK_MODELS is not set ok 77 # skip Required environment variable $GENEMARK_MODELS is not set ok 78 # skip Required environment variable $GENEMARK_MODELS is not set ok 79 # skip Required environment variable $GENEMARK_MODELS is not set ok 80 # skip Required environment variable $GENEMARK_MODELS is not set ok 81 # skip Required environment variable $GENEMARK_MODELS is not set ok 82 # skip Required environment variable $GENEMARK_MODELS is not set ok 83 # skip Required environment variable $GENEMARK_MODELS is not set ok 84 # skip Required environment variable $GENEMARK_MODELS is not set ok 85 # skip Required environment variable $GENEMARK_MODELS is not set ok 86 # skip Required environment variable $GENEMARK_MODELS is not set ok 87 # skip Required environment variable $GENEMARK_MODELS is not set ok 88 # skip Required environment variable $GENEMARK_MODELS is not set ok 89 # skip Required environment variable $GENEMARK_MODELS is not set ok 90 # skip Required environment variable $GENEMARK_MODELS is not set ok 91 # skip Required environment variable $GENEMARK_MODELS is not set ok 92 # skip Required environment variable $GENEMARK_MODELS is not set ok 93 # skip Required environment variable $GENEMARK_MODELS is not set ok 94 # skip Required environment variable $GENEMARK_MODELS is not set ok 95 # skip Required environment variable $GENEMARK_MODELS is not set ok 96 # skip Required environment variable $GENEMARK_MODELS is not set ok 97 # skip Required environment variable $GENEMARK_MODELS is not set ok 98 # skip Required environment variable $GENEMARK_MODELS is not set ok 99 # skip Required environment variable $GENEMARK_MODELS is not set ok These tests may fail because I'm not sure about your genewise version -- using wise 2.2.3-rc7 values t/Genewise.t .................. 1..17 ok 1 - use Bio::Tools::Run::Genewise; ok 2 - use Bio::Root::IO; ok 3 - use Bio::Seq; ok 4 - An object of class 'Bio::Tools::Run::Genewise' isa 'Bio::Tools::Run::Genewise' ok 5 ok 6 ok 7 ok 8 ok 9 ok 10 ok 11 ok 12 ok 13 ok 14 ok 15 ok 16 ok 17 ok # Required environment variable $GENSCANDIR is not set t/Genscan.t ................... 1..6 ok 1 - use Bio::Tools::Run::Genscan; ok 2 - use Bio::Root::IO; ok 3 # skip Required environment variable $GENSCANDIR is not set ok 4 # skip Required environment variable $GENSCANDIR is not set ok 5 # skip Required environment variable $GENSCANDIR is not set ok 6 # skip Required environment variable $GENSCANDIR is not set ok # Required executable for Bio::Tools::Run::Phylo::Gerp is not present t/Gerp.t ...................... 1..33 ok 1 - use Bio::Tools::Run::Phylo::Gerp; ok 2 - use Bio::AlignIO; ok 3 - use Bio::TreeIO; ok 4 - use Bio::Root::Utilities; ok 5 - Found input alignment file ok 6 - Found input tree file ok 7 - An object of class 'Bio::Tools::Run::Phylo::Gerp' isa 'Bio::Tools::Run::Phylo::Gerp' ok 8 - has a created method not in args supplied to new ok 9 - quiet was set ok 10 - program_dir returned correct default ok 11 - Correct exe default name ok 12 # skip Required executable for Bio::Tools::Run::Phylo::Gerp is not present ok 13 # skip Required executable for Bio::Tools::Run::Phylo::Gerp is not present ok 14 # skip Required executable for Bio::Tools::Run::Phylo::Gerp is not present ok 15 # skip Required executable for Bio::Tools::Run::Phylo::Gerp is not present ok 16 # skip Required executable for Bio::Tools::Run::Phylo::Gerp is not present ok 17 # skip Required executable for Bio::Tools::Run::Phylo::Gerp is not present ok 18 # skip Required executable for Bio::Tools::Run::Phylo::Gerp is not present ok 19 # skip Required executable for Bio::Tools::Run::Phylo::Gerp is not present ok 20 # skip Required executable for Bio::Tools::Run::Phylo::Gerp is not present ok 21 # skip Required executable for Bio::Tools::Run::Phylo::Gerp is not present ok 22 # skip Required executable for Bio::Tools::Run::Phylo::Gerp is not present ok 23 # skip Required executable for Bio::Tools::Run::Phylo::Gerp is not present ok 24 # skip Required executable for Bio::Tools::Run::Phylo::Gerp is not present ok 25 # skip Required executable for Bio::Tools::Run::Phylo::Gerp is not present ok 26 # skip Required executable for Bio::Tools::Run::Phylo::Gerp is not present ok 27 # skip Required executable for Bio::Tools::Run::Phylo::Gerp is not present ok 28 # skip Required executable for Bio::Tools::Run::Phylo::Gerp is not present ok 29 # skip Required executable for Bio::Tools::Run::Phylo::Gerp is not present ok 30 # skip Required executable for Bio::Tools::Run::Phylo::Gerp is not present ok 31 # skip Required executable for Bio::Tools::Run::Phylo::Gerp is not present ok 32 # skip Required executable for Bio::Tools::Run::Phylo::Gerp is not present ok 33 # skip Required executable for Bio::Tools::Run::Phylo::Gerp is not present ok # Required executable for Bio::Tools::Run::Glimmer is not present t/Glimmer3.t .................. 1..111 ok 1 - use Bio::Tools::Run::Glimmer; ok 2 - use Bio::Root::IO; ok 3 - use Bio::Seq; ok 4 - An object of class 'Bio::Tools::Run::Glimmer' isa 'Bio::Tools::Run::Glimmer' ok 5 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 6 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 7 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 8 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 9 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 10 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 11 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 12 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 13 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 14 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 15 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 16 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 17 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 18 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 19 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 20 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 21 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 22 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 23 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 24 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 25 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 26 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 27 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 28 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 29 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 30 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 31 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 32 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 33 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 34 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 35 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 36 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 37 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 38 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 39 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 40 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 41 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 42 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 43 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 44 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 45 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 46 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 47 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 48 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 49 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 50 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 51 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 52 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 53 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 54 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 55 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 56 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 57 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 58 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 59 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 60 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 61 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 62 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 63 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 64 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 65 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 66 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 67 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 68 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 69 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 70 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 71 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 72 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 73 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 74 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 75 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 76 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 77 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 78 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 79 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 80 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 81 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 82 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 83 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 84 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 85 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 86 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 87 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 88 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 89 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 90 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 91 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 92 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 93 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 94 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 95 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 96 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 97 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 98 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 99 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 100 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 101 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 102 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 103 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 104 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 105 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 106 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 107 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 108 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 109 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 110 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok 111 # skip Required executable for Bio::Tools::Run::Glimmer is not present ok # Required executable for Bio::Tools::Run::Hmmer is not present t/Hmmer.t ..................... 1..27 ok 1 - use Bio::Tools::Run::Hmmer; ok 2 - use Bio::SeqIO; ok 3 - use Bio::AlignIO; ok 4 - An object of class 'Bio::Tools::Run::Hmmer' isa 'Bio::Tools::Run::Hmmer' ok 5 ok 6 ok 7 ok 8 # skip Required executable for Bio::Tools::Run::Hmmer is not present ok 9 # skip Required executable for Bio::Tools::Run::Hmmer is not present ok 10 # skip Required executable for Bio::Tools::Run::Hmmer is not present ok 11 # skip Required executable for Bio::Tools::Run::Hmmer is not present ok 12 # skip Required executable for Bio::Tools::Run::Hmmer is not present ok 13 # skip Required executable for Bio::Tools::Run::Hmmer is not present ok 14 # skip Required executable for Bio::Tools::Run::Hmmer is not present ok 15 # skip Required executable for Bio::Tools::Run::Hmmer is not present ok 16 # skip Required executable for Bio::Tools::Run::Hmmer is not present ok 17 # skip Required executable for Bio::Tools::Run::Hmmer is not present ok 18 # skip Required executable for Bio::Tools::Run::Hmmer is not present ok 19 # skip Required executable for Bio::Tools::Run::Hmmer is not present ok 20 # skip Required executable for Bio::Tools::Run::Hmmer is not present ok 21 # skip Required executable for Bio::Tools::Run::Hmmer is not present ok 22 # skip Required executable for Bio::Tools::Run::Hmmer is not present ok 23 # skip Required executable for Bio::Tools::Run::Hmmer is not present ok 24 # skip Required executable for Bio::Tools::Run::Hmmer is not present ok 25 # skip Required executable for Bio::Tools::Run::Hmmer is not present ok 26 # skip Required executable for Bio::Tools::Run::Hmmer is not present ok 27 # skip Required executable for Bio::Tools::Run::Hmmer is not present ok t/Infernal.t .................. 1..3 ok 1 - use Bio::Tools::Run::Infernal; ok 2 - use Bio::SeqIO; ok 3 - use Bio::AlignIO; ok t/Kalign.t .................... 1..7 ok 1 - use Bio::Tools::Run::Alignment::Kalign; ok 2 - use Bio::AlignIO; ok 3 - use Bio::SeqIO; ok 4 - Code tested only on kalign versions >= 2 Kalign (3.4.0) Copyright (C) 2006,2019,2020,2021,2023 Timo Lassmann This program comes with ABSOLUTELY NO WARRANTY; for details type: `kalign -showw'. This is free software, and you are welcome to redistribute it under certain conditions; consult the COPYING file for details. Please cite: Lassmann, Timo. "Kalign 3: multiple sequence alignment of large data sets." Bioinformatics (2019) https://doi.org/10.1093/bioinformatics/btz795 [2026-01-07 19:36:16] : LOG : Detected protein sequences. [2026-01-07 19:36:16] : LOG : Read 7 sequences from standard input. [2026-01-07 19:36:16] : LOG : CPU Time: 0.00u 00:00:00.00 Elapsed: 00:00:00.00 [2026-01-07 19:36:16] : LOG : Calculating pairwise distances [2026-01-07 19:36:16] : LOG : CPU Time: 0.02u 00:00:00.01 Elapsed: 00:00:00.00 [2026-01-07 19:36:16] : LOG : Building guide tree. [2026-01-07 19:36:16] : LOG : CPU Time: 0.02u 00:00:00.02 Elapsed: 00:00:00.00 [2026-01-07 19:36:16] : LOG : Aligning [2026-01-07 19:36:16] : LOG : CPU Time: 0.06u 00:00:00.06 Elapsed: 00:00:00.00 ok 5 ok 6 Kalign (3.4.0) Copyright (C) 2006,2019,2020,2021,2023 Timo Lassmann This program comes with ABSOLUTELY NO WARRANTY; for details type: `kalign -showw'. This is free software, and you are welcome to redistribute it under certain conditions; consult the COPYING file for details. Please cite: Lassmann, Timo. "Kalign 3: multiple sequence alignment of large data sets." Bioinformatics (2019) https://doi.org/10.1093/bioinformatics/btz795 [2026-01-07 19:36:16] : LOG : Detected protein sequences. [2026-01-07 19:36:16] : LOG : Read 7 sequences from standard input. [2026-01-07 19:36:16] : LOG : CPU Time: 0.00u 00:00:00.00 Elapsed: 00:00:00.00 [2026-01-07 19:36:16] : LOG : Calculating pairwise distances [2026-01-07 19:36:16] : LOG : CPU Time: 0.00u 00:00:00.00 Elapsed: 00:00:00.00 [2026-01-07 19:36:16] : LOG : Building guide tree. [2026-01-07 19:36:16] : LOG : CPU Time: 0.01u 00:00:00.00 Elapsed: 00:00:00.00 [2026-01-07 19:36:16] : LOG : Aligning [2026-01-07 19:36:16] : LOG : CPU Time: 0.04u 00:00:00.04 Elapsed: 00:00:00.00 ok 7 ok # Required executable for Bio::Tools::Run::Phylo::LVB is not present t/LVB.t ....................... 1..19 ok 1 - use Bio::Tools::Run::Phylo::LVB; ok 2 - use Bio::AlignIO; ok 3 - An object of class 'Bio::Tools::Run::Phylo::LVB' isa 'Bio::Tools::Run::Phylo::LVB' ok 4 # skip Required executable for Bio::Tools::Run::Phylo::LVB is not present ok 5 # skip Required executable for Bio::Tools::Run::Phylo::LVB is not present ok 6 # skip Required executable for Bio::Tools::Run::Phylo::LVB is not present ok 7 # skip Required executable for Bio::Tools::Run::Phylo::LVB is not present ok 8 # skip Required executable for Bio::Tools::Run::Phylo::LVB is not present ok 9 # skip Required executable for Bio::Tools::Run::Phylo::LVB is not present ok 10 # skip Required executable for Bio::Tools::Run::Phylo::LVB is not present ok 11 # skip Required executable for Bio::Tools::Run::Phylo::LVB is not present ok 12 # skip Required executable for Bio::Tools::Run::Phylo::LVB is not present ok 13 # skip Required executable for Bio::Tools::Run::Phylo::LVB is not present ok 14 # skip Required executable for Bio::Tools::Run::Phylo::LVB is not present ok 15 # skip Required executable for Bio::Tools::Run::Phylo::LVB is not present ok 16 # skip Required executable for Bio::Tools::Run::Phylo::LVB is not present ok 17 # skip Required executable for Bio::Tools::Run::Phylo::LVB is not present ok 18 # skip Required executable for Bio::Tools::Run::Phylo::LVB is not present ok 19 # skip Required executable for Bio::Tools::Run::Phylo::LVB is not present ok # Required executable for Bio::Tools::Run::Alignment::Lagan is not present t/Lagan.t ..................... 1..12 ok 1 - use Bio::AlignIO; ok 2 - use Bio::Tools::Run::Alignment::Lagan; ok 3 - use Bio::Root::IO; ok 4 - use Bio::SeqIO; ok 5 - use Bio::Seq; ok 6 - use Bio::Matrix::Mlagan; ok 7 - An object of class 'Bio::Tools::Run::Alignment::Lagan' isa 'Bio::Tools::Run::Alignment::Lagan' ok 8 # skip Required executable for Bio::Tools::Run::Alignment::Lagan is not present ok 9 # skip Required executable for Bio::Tools::Run::Alignment::Lagan is not present ok 10 # skip Required executable for Bio::Tools::Run::Alignment::Lagan is not present ok 11 # skip Required executable for Bio::Tools::Run::Alignment::Lagan is not present ok 12 # skip Required executable for Bio::Tools::Run::Alignment::Lagan is not present ok t/MAFFT.t ..................... 1..23 ok 1 - use Bio::Tools::Run::Alignment::MAFFT; ok 2 - use Bio::AlignIO; ok 3 - use Bio::SeqIO; ok 4 - An object of class 'Bio::Tools::Run::Alignment::MAFFT' isa 'Bio::Tools::Run::Alignment::MAFFT' ok 5 ok 6 ok 7 ok 8 ok 9 - 42 or 43 expected ok 10 ok 11 ok 12 ok 13 ok 14 ok 15 ok 16 ok 17 ok 18 # skip Tests require version 6 of MAFFT ok 19 # skip Tests require version 6 of MAFFT ok 20 # skip Tests require version 6 of MAFFT ok 21 # skip Tests require version 6 of MAFFT ok 22 # skip Tests require version 6 of MAFFT ok 23 # skip Tests require version 6 of MAFFT ok # Required executable for Bio::Tools::Run::Alignment::MSAProbs is not present t/MSAProbs.t .................. 1..19 ok 1 - use Bio::Tools::Run::Alignment::MSAProbs; ok 2 - use Bio::Tools::GuessSeqFormat; ok 3 - use Bio::AlignIO; ok 4 - use Bio::SeqIO; ok 5 - use Bio::Root::IO; ok 6 - use POSIX; ok 7 ok 8 # skip Required executable for Bio::Tools::Run::Alignment::MSAProbs is not present ok 9 # skip Required executable for Bio::Tools::Run::Alignment::MSAProbs is not present ok 10 # skip Required executable for Bio::Tools::Run::Alignment::MSAProbs is not present ok 11 # skip Required executable for Bio::Tools::Run::Alignment::MSAProbs is not present ok 12 # skip Required executable for Bio::Tools::Run::Alignment::MSAProbs is not present ok 13 # skip Required executable for Bio::Tools::Run::Alignment::MSAProbs is not present ok 14 # skip Required executable for Bio::Tools::Run::Alignment::MSAProbs is not present ok 15 # skip Required executable for Bio::Tools::Run::Alignment::MSAProbs is not present ok 16 # skip Required executable for Bio::Tools::Run::Alignment::MSAProbs is not present ok 17 # skip Required executable for Bio::Tools::Run::Alignment::MSAProbs is not present ok 18 # skip Required executable for Bio::Tools::Run::Alignment::MSAProbs is not present ok 19 # skip Required executable for Bio::Tools::Run::Alignment::MSAProbs is not present ok # Required executable for Bio::Tools::Run::Match is not present t/Match.t ..................... 1..7 ok 1 - use Bio::Tools::Run::Match; ok 2 - An object of class 'Bio::Tools::Run::Match' isa 'Bio::Tools::Run::Match' ok 3 - mxlib parameter was set ok 4 - program_dir returned correct default ok 5 - Correct exe default name ok 6 # skip Required executable for Bio::Tools::Run::Match is not present ok 7 # skip Required executable for Bio::Tools::Run::Match is not present ok # Required executable for Bio::Tools::Run::Mdust is not present t/Mdust.t ..................... 1..5 ok 1 - use Bio::Tools::Run::Mdust; ok 2 - use Bio::SeqIO; ok 3 - An object of class 'Bio::Tools::Run::Mdust' isa 'Bio::Tools::Run::Mdust' ok 4 # skip Required executable for Bio::Tools::Run::Mdust is not present ok 5 # skip Required executable for Bio::Tools::Run::Mdust is not present ok # Required executable for Bio::Tools::Run::Phylo::Molphy::ProtML is not present t/Molphy.t .................... 1..10 ok 1 - use Bio::Tools::Phylo::Molphy; ok 2 - use Bio::Tools::Run::Phylo::Molphy::ProtML; ok 3 - use Bio::AlignIO; ok 4 # skip Required executable for Bio::Tools::Run::Phylo::Molphy::ProtML is not present ok 5 # skip Required executable for Bio::Tools::Run::Phylo::Molphy::ProtML is not present ok 6 # skip Required executable for Bio::Tools::Run::Phylo::Molphy::ProtML is not present ok 7 # skip Required executable for Bio::Tools::Run::Phylo::Molphy::ProtML is not present ok 8 # skip Required executable for Bio::Tools::Run::Phylo::Molphy::ProtML is not present ok 9 # skip Required executable for Bio::Tools::Run::Phylo::Molphy::ProtML is not present ok 10 # skip Required executable for Bio::Tools::Run::Phylo::Molphy::ProtML is not present ok t/Muscle.t .................... 1..16 ok 1 - use Bio::Tools::Run::Alignment::Muscle; ok 2 - use Bio::AlignIO; ok 3 - use Bio::SeqIO; ok 4 - use Bio::Root::IO; ok 5 - use POSIX; ok 6 ok 7 # skip Only muscle version 3.6 or higher is supported by these tests. Skipping tests ok 8 # skip Only muscle version 3.6 or higher is supported by these tests. Skipping tests ok 9 # skip Only muscle version 3.6 or higher is supported by these tests. Skipping tests ok 10 # skip Only muscle version 3.6 or higher is supported by these tests. Skipping tests ok 11 # skip Only muscle version 3.6 or higher is supported by these tests. Skipping tests ok 12 # skip Only muscle version 3.6 or higher is supported by these tests. Skipping tests ok 13 # skip Only muscle version 3.6 or higher is supported by these tests. Skipping tests ok 14 # skip Only muscle version 3.6 or higher is supported by these tests. Skipping tests ok 15 # skip Only muscle version 3.6 or higher is supported by these tests. Skipping tests ok 16 # skip Only muscle version 3.6 or higher is supported by these tests. Skipping tests ok # Required executable for Bio::Tools::Run::Phylo::Phylip::Neighbor is not present t/Neighbor.t .................. 1..19 ok 1 - use Bio::Tools::Run::Phylo::Phylip::ProtDist; ok 2 - use Bio::Tools::Run::Phylo::Phylip::Neighbor; ok 3 # skip Required executable for Bio::Tools::Run::Phylo::Phylip::Neighbor is not present ok 4 # skip Required executable for Bio::Tools::Run::Phylo::Phylip::Neighbor is not present ok 5 # skip Required executable for Bio::Tools::Run::Phylo::Phylip::Neighbor is not present ok 6 # skip Required executable for Bio::Tools::Run::Phylo::Phylip::Neighbor is not present ok 7 # skip Required executable for Bio::Tools::Run::Phylo::Phylip::Neighbor is not present ok 8 # skip Required executable for Bio::Tools::Run::Phylo::Phylip::Neighbor is not present ok 9 # skip Required executable for Bio::Tools::Run::Phylo::Phylip::Neighbor is not present ok 10 # skip Required executable for Bio::Tools::Run::Phylo::Phylip::Neighbor is not present ok 11 # skip Required executable for Bio::Tools::Run::Phylo::Phylip::Neighbor is not present ok 12 # skip Required executable for Bio::Tools::Run::Phylo::Phylip::Neighbor is not present ok 13 # skip Required executable for Bio::Tools::Run::Phylo::Phylip::Neighbor is not present ok 14 # skip Required executable for Bio::Tools::Run::Phylo::Phylip::Neighbor is not present ok 15 # skip Required executable for Bio::Tools::Run::Phylo::Phylip::Neighbor is not present ok 16 # skip Required executable for Bio::Tools::Run::Phylo::Phylip::Neighbor is not present ok 17 # skip Required executable for Bio::Tools::Run::Phylo::Phylip::Neighbor is not present ok 18 # skip Required executable for Bio::Tools::Run::Phylo::Phylip::Neighbor is not present ok 19 # skip Required executable for Bio::Tools::Run::Phylo::Phylip::Neighbor is not present ok # Required executable for Bio::Tools::Run::Phylo::Njtree::Best is not present t/Njtree.t .................... 1..6 ok 1 - use Bio::Root::IO; ok 2 - use Bio::Tools::Run::Phylo::Njtree::Best; ok 3 - use Bio::AlignIO; ok 4 - use Bio::TreeIO; ok 5 ok 6 # skip Required executable for Bio::Tools::Run::Phylo::Njtree::Best is not present ok --------------------- WARNING --------------------- MSG: In sequence pseudogene residue count gives end value 183. Overriding value [178] with value 183 for Bio::LocatableSeq::end(). ----LNCIVNDSQKMGIIRNGDLP*PQLKNKF2-FQRMTTPSSAEGKENLVFLIRKNWFSITEKNQPLKYIINLVVSRESKEPPQRPPFLD*SLGDALKRIEQLKLANKQDVFFTVGGSSVYKESMN*-DHFKLFVTWIMQDFQSDTFFS4EGDLEKYKLLPEYPQGVVSDVEEEKGIKYKFEVYEKND --------------------------------------------------- --------------------- WARNING --------------------- MSG: In sequence pseudogene residue count gives end value 183. Overriding value [178] with value 183 for Bio::LocatableSeq::end(). ----LNCIVNDSQKMGIIRNGDLP*PQLKNKF2-FQRMTTPSSAEGKENLVFLIRKNWFSITEKNQPLKYIINLVVSRESKEPPQRPPFLD*SLGDALKRIEQLKLANKQDVFFTVGGSSVYKESMN*-DHFKLFVTWIMQDFQSDTFFS4EGDLEKYKLLPEYPQGVVSDVEEEKGIKYKFEVYEKND --------------------------------------------------- t/Pal2Nal.t ................... 1..9 ok 1 - use Bio::Tools::Run::Alignment::Pal2Nal; ok 2 - An object of class 'Bio::Tools::Run::Alignment::Pal2Nal' isa 'Bio::Tools::Run::Alignment::Pal2Nal' ok 3 - program_dir returned correct default ok 4 - Correct exe default name ok 5 ok 6 - use Bio::AlignIO; ok 7 - use Bio::SeqIO; ok 8 ok 9 ok # Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present t/PhastCons.t ................. 1..181 ok 1 - use Bio::AlignIO; ok 2 - use Bio::TreeIO; ok 3 - use Bio::DB::Taxonomy; ok 4 - Found input alignment file ok 5 - Found input tree file ok 6 - use Bio::Tools::Run::Phylo::Phast::PhastCons; ok 7 - An object of class 'Bio::Tools::Run::Phylo::Phast::PhastCons' isa 'Bio::Tools::Run::Phylo::Phast::PhastCons' ok 8 - has a created method not in args ok 9 - dashed parameter with internal dash was set ok 10 - wrong-case method wasn't created ok 11 - dashless wrong-case parameter was set ok 12 - synonym installed and accessed primary value ok 13 - double-dashed parameter was set ok 14 - program_dir returned correct default ok 15 - Correct exe default name ok 16 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 17 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 18 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 19 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 20 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 21 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 22 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 23 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 24 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 25 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 26 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 27 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 28 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 29 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 30 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 31 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 32 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 33 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 34 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 35 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 36 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 37 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 38 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 39 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 40 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 41 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 42 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 43 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 44 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 45 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 46 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 47 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 48 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 49 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 50 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 51 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 52 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 53 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 54 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 55 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 56 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 57 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 58 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 59 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 60 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 61 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 62 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 63 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 64 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 65 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 66 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 67 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 68 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 69 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 70 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 71 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 72 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 73 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 74 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 75 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 76 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 77 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 78 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 79 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 80 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 81 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 82 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 83 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 84 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 85 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 86 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 87 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 88 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 89 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 90 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 91 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 92 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 93 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 94 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 95 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 96 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 97 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 98 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 99 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 100 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 101 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 102 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 103 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 104 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 105 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 106 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 107 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 108 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 109 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 110 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 111 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 112 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 113 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 114 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 115 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 116 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 117 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 118 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 119 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 120 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 121 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 122 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 123 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 124 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 125 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 126 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 127 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 128 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 129 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 130 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 131 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 132 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 133 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 134 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 135 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 136 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 137 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 138 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 139 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 140 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 141 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 142 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 143 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 144 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 145 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 146 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 147 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 148 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 149 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 150 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 151 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 152 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 153 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 154 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 155 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 156 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 157 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 158 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 159 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 160 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 161 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 162 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 163 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 164 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 165 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 166 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 167 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 168 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 169 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 170 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 171 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 172 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 173 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 174 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 175 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 176 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 177 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 178 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 179 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 180 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok 181 # skip Required executable for Bio::Tools::Run::Phylo::Phast::PhastCons is not present ok # Required executable for Bio::Tools::Run::Primate is not present t/Primate.t ................... 1..8 ok 1 - use Bio::Tools::Run::Primate; ok 2 - use Bio::SeqIO; ok 3 # skip Required executable for Bio::Tools::Run::Primate is not present ok 4 # skip Required executable for Bio::Tools::Run::Primate is not present ok 5 # skip Required executable for Bio::Tools::Run::Primate is not present ok 6 # skip Required executable for Bio::Tools::Run::Primate is not present ok 7 # skip Required executable for Bio::Tools::Run::Primate is not present ok 8 # skip Required executable for Bio::Tools::Run::Primate is not present ok t/Primer3.t ................... 1..9 ok 1 - use Bio::Tools::Run::Primer3; ok 2 - use Bio::SeqIO; ok 3 ok 4 # skip Primer3 wrapper only supports Primer3 v1 ok 5 # skip Primer3 wrapper only supports Primer3 v1 ok 6 # skip Primer3 wrapper only supports Primer3 v1 ok 7 # skip Primer3 wrapper only supports Primer3 v1 ok 8 # skip Primer3 wrapper only supports Primer3 v1 ok 9 # skip Primer3 wrapper only supports Primer3 v1 ok # Required executable for Bio::Tools::Run::Prints is not present t/Prints.t .................... 1..7 ok 1 - use Bio::Tools::Run::Prints; ok 2 - use Bio::SeqIO; ok 3 - use Bio::Seq; ok 4 - An object of class 'Bio::Tools::Run::Prints' isa 'Bio::Tools::Run::Prints' ok 5 # skip Required executable for Bio::Tools::Run::Prints is not present ok 6 # skip Required executable for Bio::Tools::Run::Prints is not present ok 7 # skip Required executable for Bio::Tools::Run::Prints is not present ok # Required executable for Bio::Tools::Run::Alignment::Probalign is not present t/Probalign.t ................. 1..13 ok 1 - use Bio::Tools::Run::Alignment::Probalign; ok 2 - use Bio::AlignIO; ok 3 - use Bio::SeqIO; ok 4 - use Cwd; ok 5 - use POSIX; ok 6 # skip Required executable for Bio::Tools::Run::Alignment::Probalign is not present ok 7 # skip Required executable for Bio::Tools::Run::Alignment::Probalign is not present ok 8 # skip Required executable for Bio::Tools::Run::Alignment::Probalign is not present ok 9 # skip Required executable for Bio::Tools::Run::Alignment::Probalign is not present ok 10 # skip Required executable for Bio::Tools::Run::Alignment::Probalign is not present ok 11 # skip Required executable for Bio::Tools::Run::Alignment::Probalign is not present ok 12 # skip Required executable for Bio::Tools::Run::Alignment::Probalign is not present ok 13 # skip Required executable for Bio::Tools::Run::Alignment::Probalign is not present ok PROBCONS version 1.12 - align multiple protein sequences and print to standard output Written by Chuong Do Using parameter set: initDistrib[] = { 0.6814756989 8.615339902e-05 8.615339902e-05 0.1591759622 0.1591759622 } gapOpen[] = { 0.0119511066 0.0119511066 0.008008334786 0.008008334786 } gapExtend[] = { 0.3965826333 0.3965826333 0.8988758326 0.8988758326 } Loading sequence file: t/data/cysprot.fa Alignment tree: ((CYS1_DICDI (CATL_HUMAN CATL_RAT)) ((ALEU_HORVU (CATH_HUMAN CATH_RAT)) PAPA_CARPA)) PROBCONS version 1.12 - align multiple protein sequences and print to standard output Written by Chuong Do Using parameter set: initDistrib[] = { 0.6814756989 8.615339902e-05 8.615339902e-05 0.1591759622 0.1591759622 } gapOpen[] = { 0.0119511066 0.0119511066 0.008008334786 0.008008334786 } gapExtend[] = { 0.3965826333 0.3965826333 0.8988758326 0.8988758326 } Loading sequence file: /tmp/RZa_Fo9Qqt Alignment tree: ((CYS1_DICDI (CATL_HUMAN CATL_RAT)) ((ALEU_HORVU (CATH_HUMAN CATH_RAT)) PAPA_CARPA)) PROBCONS version 1.12 - align multiple protein sequences and print to standard output Written by Chuong Do Using parameter set: initDistrib[] = { 0.6814756989 8.615339902e-05 8.615339902e-05 0.1591759622 0.1591759622 } gapOpen[] = { 0.0119511066 0.0119511066 0.008008334786 0.008008334786 } gapExtend[] = { 0.3965826333 0.3965826333 0.8988758326 0.8988758326 } Loading sequence file: /tmp/RDAdQLbxIo Computing posterior matrix: (1) CYS1_DICDI vs. (2) ALEU_HORVU -- done. Computing posterior matrix: (1) CYS1_DICDI vs. (3) CATH_HUMAN -- done. Computing posterior matrix: (1) CYS1_DICDI vs. (4) CATH_RAT -- done. Computing posterior matrix: (1) CYS1_DICDI vs. (5) CATL_HUMAN -- done. Computing posterior matrix: (1) CYS1_DICDI vs. (6) CATL_RAT -- done. Computing posterior matrix: (1) CYS1_DICDI vs. (7) PAPA_CARPA -- done. Computing posterior matrix: (2) ALEU_HORVU vs. (3) CATH_HUMAN -- done. Computing posterior matrix: (2) ALEU_HORVU vs. (4) CATH_RAT -- done. Computing posterior matrix: (2) ALEU_HORVU vs. (5) CATL_HUMAN -- done. Computing posterior matrix: (2) ALEU_HORVU vs. (6) CATL_RAT -- done. Computing posterior matrix: (2) ALEU_HORVU vs. (7) PAPA_CARPA -- done. Computing posterior matrix: (3) CATH_HUMAN vs. (4) CATH_RAT -- done. Computing posterior matrix: (3) CATH_HUMAN vs. (5) CATL_HUMAN -- done. Computing posterior matrix: (3) CATH_HUMAN vs. (6) CATL_RAT -- done. Computing posterior matrix: (3) CATH_HUMAN vs. (7) PAPA_CARPA -- done. Computing posterior matrix: (4) CATH_RAT vs. (5) CATL_HUMAN -- done. Computing posterior matrix: (4) CATH_RAT vs. (6) CATL_RAT -- done. Computing posterior matrix: (4) CATH_RAT vs. (7) PAPA_CARPA -- done. Computing posterior matrix: (5) CATL_HUMAN vs. (6) CATL_RAT -- done. Computing posterior matrix: (5) CATL_HUMAN vs. (7) PAPA_CARPA -- done. Computing posterior matrix: (6) CATL_RAT vs. (7) PAPA_CARPA -- done. Trained parameter set: initDistrib[] = { 0.8318780065 5.246741057e-05 5.246741057e-05 0.08400853723 0.08400853723 } gapOpen[] = { 0.01386913192 0.01386913192 0.006558840629 0.006558840629 } gapExtend[] = { 0.3603840172 0.3603840172 0.7831536531 0.7831536531 } PROBCONS version 1.12 - align multiple protein sequences and print to standard output Written by Chuong Do Using parameter set: initDistrib[] = { 0.8318780065 5.246739966e-05 5.246739966e-05 0.08400853723 0.08400853723 } gapOpen[] = { 0.01386913192 0.01386913192 0.006558840629 0.006558840629 } gapExtend[] = { 0.3603840172 0.3603840172 0.7831536531 0.7831536531 } Loading sequence file: /tmp/19jrrTVgvr Alignment tree: ((CYS1_DICDI (CATL_HUMAN CATL_RAT)) ((ALEU_HORVU (CATH_HUMAN CATH_RAT)) PAPA_CARPA)) t/Probcons.t .................. 1..11 ok 1 - use Bio::Tools::Run::Alignment::Probcons; ok 2 - use Bio::AlignIO; ok 3 - use Bio::SeqIO; ok 4 - Code tested only on probcons versions > 1.09 ok 5 ok 6 ok 7 ok 8 ok 9 ok 10 ok 11 ok # Required executable for Bio::Tools::Run::Profile is not present t/Profile.t ................... 1..7 ok 1 - use Bio::Tools::Run::Profile; ok 2 - use Bio::SeqIO; ok 3 - use Bio::Seq; ok 4 - An object of class 'Bio::Tools::Run::Profile' isa 'Bio::Tools::Run::Profile' ok 5 # skip Required executable for Bio::Tools::Run::Profile is not present ok 6 # skip Required executable for Bio::Tools::Run::Profile is not present ok 7 # skip Required executable for Bio::Tools::Run::Profile is not present ok t/Promoterwise.t .............. 1..9 ok 1 - use Bio::Tools::Run::Promoterwise; ok 2 - use Bio::Seq; ok 3 - An object of class 'Bio::Tools::Run::Promoterwise' isa 'Bio::Tools::Run::Promoterwise' ok 4 ok 5 ok 6 ok 7 ok 8 ok 9 ok t/ProtDist.t .................. 1..14 ok 1 - use Bio::Tools::Run::Phylo::Phylip::ProtDist; ok 2 # skip The optional module Bio::Tools::Run::Alignment::Clustalw (or dependencies thereof) was not installed ok 3 # skip The optional module Bio::Tools::Run::Alignment::Clustalw (or dependencies thereof) was not installed ok 4 # skip The optional module Bio::Tools::Run::Alignment::Clustalw (or dependencies thereof) was not installed ok 5 # skip The optional module Bio::Tools::Run::Alignment::Clustalw (or dependencies thereof) was not installed ok 6 # skip The optional module Bio::Tools::Run::Alignment::Clustalw (or dependencies thereof) was not installed ok 7 # skip The optional module Bio::Tools::Run::Alignment::Clustalw (or dependencies thereof) was not installed ok 8 # skip The optional module Bio::Tools::Run::Alignment::Clustalw (or dependencies thereof) was not installed ok 9 # skip The optional module Bio::Tools::Run::Alignment::Clustalw (or dependencies thereof) was not installed ok 10 # skip The optional module Bio::Tools::Run::Alignment::Clustalw (or dependencies thereof) was not installed ok 11 # skip The optional module Bio::Tools::Run::Alignment::Clustalw (or dependencies thereof) was not installed ok 12 # skip The optional module Bio::Tools::Run::Alignment::Clustalw (or dependencies thereof) was not installed ok 13 # skip The optional module Bio::Tools::Run::Alignment::Clustalw (or dependencies thereof) was not installed ok 14 # skip The optional module Bio::Tools::Run::Alignment::Clustalw (or dependencies thereof) was not installed ok t/ProtPars.t .................. 1..11 ok 1 - use Bio::Tools::Run::Phylo::Phylip::ProtPars; ok 2 - An object of class 'Bio::Tools::Run::Phylo::Phylip::ProtPars' isa 'Bio::Tools::Run::Phylo::Phylip::ProtPars' ok 3 # skip The optional module Bio::Tools::Run::Alignment::Clustalw (or dependencies thereof) was not installed ok 4 # skip The optional module Bio::Tools::Run::Alignment::Clustalw (or dependencies thereof) was not installed ok 5 # skip The optional module Bio::Tools::Run::Alignment::Clustalw (or dependencies thereof) was not installed ok 6 # skip The optional module Bio::Tools::Run::Alignment::Clustalw (or dependencies thereof) was not installed ok 7 # skip The optional module Bio::Tools::Run::Alignment::Clustalw (or dependencies thereof) was not installed ok 8 # skip The optional module Bio::Tools::Run::Alignment::Clustalw (or dependencies thereof) was not installed ok 9 # skip The optional module Bio::Tools::Run::Alignment::Clustalw (or dependencies thereof) was not installed ok 10 # skip The optional module Bio::Tools::Run::Alignment::Clustalw (or dependencies thereof) was not installed ok 11 # skip The optional module Bio::Tools::Run::Alignment::Clustalw (or dependencies thereof) was not installed ok # Required executable for Bio::Tools::Run::Pseudowise is not present t/Pseudowise.t ................ 1..18 ok 1 - use Bio::Tools::Run::Pseudowise; ok 2 - use Bio::Root::IO; ok 3 - use Bio::Seq; ok 4 ok 5 # skip Required executable for Bio::Tools::Run::Pseudowise is not present ok 6 # skip Required executable for Bio::Tools::Run::Pseudowise is not present ok 7 # skip Required executable for Bio::Tools::Run::Pseudowise is not present ok 8 # skip Required executable for Bio::Tools::Run::Pseudowise is not present ok 9 # skip Required executable for Bio::Tools::Run::Pseudowise is not present ok 10 # skip Required executable for Bio::Tools::Run::Pseudowise is not present ok 11 # skip Required executable for Bio::Tools::Run::Pseudowise is not present ok 12 # skip Required executable for Bio::Tools::Run::Pseudowise is not present ok 13 # skip Required executable for Bio::Tools::Run::Pseudowise is not present ok 14 # skip Required executable for Bio::Tools::Run::Pseudowise is not present ok 15 # skip Required executable for Bio::Tools::Run::Pseudowise is not present ok 16 # skip Required executable for Bio::Tools::Run::Pseudowise is not present ok 17 # skip Required executable for Bio::Tools::Run::Pseudowise is not present ok 18 # skip Required executable for Bio::Tools::Run::Pseudowise is not present ok # Required executable for Bio::Tools::Run::Phylo::QuickTree is not present t/QuickTree.t ................. 1..13 ok 1 - use Bio::Tools::Run::Phylo::QuickTree; ok 2 - use Bio::AlignIO; ok 3 - Found input file ok 4 - An object of class 'Bio::Tools::Run::Phylo::QuickTree' isa 'Bio::Tools::Run::Phylo::QuickTree' ok 5 - program_dir returned correct default ok 6 - Correct exe default name ok 7 # skip Required executable for Bio::Tools::Run::Phylo::QuickTree is not present ok 8 # skip Required executable for Bio::Tools::Run::Phylo::QuickTree is not present ok 9 # skip Required executable for Bio::Tools::Run::Phylo::QuickTree is not present ok 10 # skip Required executable for Bio::Tools::Run::Phylo::QuickTree is not present ok 11 # skip Required executable for Bio::Tools::Run::Phylo::QuickTree is not present ok 12 # skip Required executable for Bio::Tools::Run::Phylo::QuickTree is not present ok 13 # skip Required executable for Bio::Tools::Run::Phylo::QuickTree is not present ok t/Raxml.t ..................... 1..12 ok 1 - use Bio::Root::IO; ok 2 - use Bio::Tools::Run::Phylo::Raxml; ok 3 - use Bio::AlignIO; ok 4 - Make the object ok 5 - An object of class 'Bio::Tools::Run::Phylo::Raxml' isa 'Bio::Tools::Run::Phylo::Raxml' ok 6 - Tree is defined ok 7 - Tree is defined ok 8 - File containing best tree exists in tempdir ok 9 - Tree is defined ok 10 - Tree is defined ok 11 - Number of nodes is correct ok 12 - Tree is defined ok # DB and mask make tests # run BLAST methods t/SABlastPlus.t ............... 1..71 ok 1 - use Bio::Tools::Run::StandAloneBlastPlus; ok 2 - use Bio::Tools::Run::WrapperBase; ok 3 - use Bio::Tools::Run::WrapperBase::CommandExts; ok 4 - BlastPlus factory ok 5 - make factory ok 6 - test db made with fasta ok 7 - temp db ok 8 - right type ok 9 ok 10 - named db made ok 11 - check_db ok 12 - correct name ok 13 - dbinfo hash returned ok 14 - correct type ok 15 - windowmasker mask made ok 16 - dustmasker mask made ok 17 - check_db with arg ok 18 - db_info with arg ok 19 - protein db made ok 20 - correct type ok 21 - segmasker mask made ok 22 - segmasker mask made; blastdb as data ok 23 ok 24 - protein db made with pre-built mask ok 25 - db_info records mask info ok 26 ok 27 - mask built and db made on construction (windowmasker) ok 28 ok 29 - mask built and db made on construction (segmasker) ok 30 ok 31 - mask built and db made on construction (dustmasker) ok 32 ok 33 ok 34 ok 35 - make db from Bio::SeqIO ok 36 ok 37 - make db from Bio::AlignIO ok 38 ok 39 - make db from \@seqs ok 40 - dbdir : ./a/b; dbname : test; create ok 41 - make db ok 42 ok 43 ok 44 ok 45 ok 46 - run blastn ok 47 - default hit limit ok 48 - return more alignments (arg spec) ok 49 - got more hits ok 50 - run blastn with Bio::Seq query ok 51 - run tblastn ok 52 - tblastn hits ok 53 - run tblastx ok 54 - tblastx hits ok 55 ok 56 - run blastp ok 57 - blastp hits ok 58 - bl2seq (blastn) ok 59 - got hit ok 60 - bl2seq (tblastx) ok 61 - got hit ok 62 - bl2seq (blastx) ok 63 - got hit ok 64 - bl2seq (blastp) ok 65 - no hit ok 66 - bl2seq (blastp) ok 67 - got hit ok 68 - bl2seq (tblastx) - multiple outfmt options ok 69 - bl2seq (tblastx) - multiple outfmt options (use method arg) ok 70 - bl2seq (tblastx) - multiple outfmt options (no explict quotes should also work) ok 71 - bl2seq (tblastx) - multiple outfmt options (a single format number in quotes ok # Required executable for Bio::Tools::Run::Phylo::SLR is not present t/SLR.t ....................... 1..7 ok 1 - use Bio::Root::IO; ok 2 - use Bio::Tools::Run::Phylo::SLR; ok 3 - use Bio::AlignIO; ok 4 - use Bio::TreeIO; ok 5 ok 6 # skip Required executable for Bio::Tools::Run::Phylo::SLR is not present ok 7 # skip Required executable for Bio::Tools::Run::Phylo::SLR is not present ok # Required executable for Bio::Tools::Run::Samtools is not present t/Samtools.t .................. 1..41 ok 1 - make a factory using command 'pileup' ok 2 - parameters changed on construction ok 3 - access parameter ok 4 - parameters_changed cleared on read ok 5 - set a param not set in constructor ok 6 - parameters_changed set ok 7 - parameter really set ok 8 - original parameter unchanged ok 9 - parameters_changed cleared on read ok 10 - change an original parameter ok 11 - parameter really changed ok 12 - reset parameters with arg ok 13 - original parameters undefined ok 14 - parameter really reset via arg ok 15 - parameters changed ok 16 - all available options ok 17 - available parameters ok 18 - available switches ok 19 - get_parameters correct ok 20 - command attribute set ok 21 - internal command array set ok 22 - internal prefix hash set ok 23 - commands filtered by prefix ok 24 - translate_params: command correct ok 25 - translate_params: options correct ok 26 # skip Required executable for Bio::Tools::Run::Samtools is not present ok 27 # skip Required executable for Bio::Tools::Run::Samtools is not present ok 28 # skip Required executable for Bio::Tools::Run::Samtools is not present ok 29 # skip Required executable for Bio::Tools::Run::Samtools is not present ok 30 # skip Required executable for Bio::Tools::Run::Samtools is not present ok 31 # skip Required executable for Bio::Tools::Run::Samtools is not present ok 32 # skip Required executable for Bio::Tools::Run::Samtools is not present ok 33 # skip Required executable for Bio::Tools::Run::Samtools is not present ok 34 # skip Required executable for Bio::Tools::Run::Samtools is not present ok 35 # skip Required executable for Bio::Tools::Run::Samtools is not present ok 36 # skip Required executable for Bio::Tools::Run::Samtools is not present ok 37 # skip Required executable for Bio::Tools::Run::Samtools is not present ok 38 # skip Required executable for Bio::Tools::Run::Samtools is not present ok 39 # skip Required executable for Bio::Tools::Run::Samtools is not present ok 40 # skip Required executable for Bio::Tools::Run::Samtools is not present ok 41 # skip Required executable for Bio::Tools::Run::Samtools is not present ok # Required executable for Bio::Tools::Run::Seg is not present t/Seg.t ....................... 1..8 ok 1 - use Bio::Tools::Run::Seg; ok 2 - use Bio::SeqIO; ok 3 - use Bio::Seq; ok 4 - An object of class 'Bio::Tools::Run::Seg' isa 'Bio::Tools::Run::Seg' ok 5 # skip Required executable for Bio::Tools::Run::Seg is not present ok 6 # skip Required executable for Bio::Tools::Run::Seg is not present ok 7 # skip Required executable for Bio::Tools::Run::Seg is not present ok 8 # skip Required executable for Bio::Tools::Run::Seg is not present ok # Required executable for Bio::Tools::Run::Phylo::Semphy is not present t/Semphy.t .................... 1..19 ok 1 - use Bio::Tools::Run::Phylo::Semphy; ok 2 - An object of class 'Bio::Tools::Run::Phylo::Semphy' isa 'Bio::Tools::Run::Phylo::Semphy' ok 3 - has a created method not in args ok 4 - ratio param was set via -z ok 5 - jtt switch was set ok 6 - program_dir returned correct default ok 7 - Correct exe default name ok 8 # skip Required executable for Bio::Tools::Run::Phylo::Semphy is not present ok 9 # skip Required executable for Bio::Tools::Run::Phylo::Semphy is not present ok 10 # skip Required executable for Bio::Tools::Run::Phylo::Semphy is not present ok 11 # skip Required executable for Bio::Tools::Run::Phylo::Semphy is not present ok 12 # skip Required executable for Bio::Tools::Run::Phylo::Semphy is not present ok 13 # skip Required executable for Bio::Tools::Run::Phylo::Semphy is not present ok 14 # skip Required executable for Bio::Tools::Run::Phylo::Semphy is not present ok 15 # skip Required executable for Bio::Tools::Run::Phylo::Semphy is not present ok 16 # skip Required executable for Bio::Tools::Run::Phylo::Semphy is not present ok 17 # skip Required executable for Bio::Tools::Run::Phylo::Semphy is not present ok 18 # skip Required executable for Bio::Tools::Run::Phylo::Semphy is not present ok 19 # skip Required executable for Bio::Tools::Run::Phylo::Semphy is not present ok # Required executable for Bio::Tools::Run::Phylo::Phylip::SeqBoot is not present t/SeqBoot.t ................... 1..9 ok 1 - use Bio::Tools::Run::Phylo::Phylip::SeqBoot; ok 2 - use Bio::AlignIO; ok 3 # skip Required executable for Bio::Tools::Run::Phylo::Phylip::SeqBoot is not present ok 4 # skip Required executable for Bio::Tools::Run::Phylo::Phylip::SeqBoot is not present ok 5 # skip Required executable for Bio::Tools::Run::Phylo::Phylip::SeqBoot is not present ok 6 # skip Required executable for Bio::Tools::Run::Phylo::Phylip::SeqBoot is not present ok 7 # skip Required executable for Bio::Tools::Run::Phylo::Phylip::SeqBoot is not present ok 8 # skip Required executable for Bio::Tools::Run::Phylo::Phylip::SeqBoot is not present ok 9 # skip Required executable for Bio::Tools::Run::Phylo::Phylip::SeqBoot is not present ok # Required executable for Bio::Tools::Run::Signalp is not present t/Signalp.t ................... 1..7 ok 1 - use Bio::Tools::Run::Signalp; ok 2 - use Bio::SeqIO; ok 3 - use Bio::Seq; ok 4 - An object of class 'Bio::Tools::Run::Signalp' isa 'Bio::Tools::Run::Signalp' ok 5 # skip Required executable for Bio::Tools::Run::Signalp is not present ok 6 # skip Required executable for Bio::Tools::Run::Signalp is not present ok 7 # skip Required executable for Bio::Tools::Run::Signalp is not present ok t/Sim4.t ...................... 1..23 ok 1 - use Bio::Tools::Run::Alignment::Sim4; ok 2 - use Bio::SimpleAlign; ok 3 - use Bio::AlignIO; ok 4 - use Bio::SeqIO; ok 5 - An object of class 'Bio::Tools::Run::Alignment::Sim4' isa 'Bio::Tools::Run::Alignment::Sim4' ok 6 ok 7 ok 8 ok 9 ok 10 ok 11 ok 12 ok 13 ok 14 ok 15 ok 16 ok 17 ok 18 ok 19 ok 20 ok 21 ok 22 ok 23 ok # Required executable for Bio::Tools::Run::Simprot is not present t/Simprot.t ................... 1..6 ok 1 - use Bio::Root::IO; ok 2 - use Bio::Tools::Run::Simprot; ok 3 - use Bio::AlignIO; ok 4 - use Bio::TreeIO; ok 5 ok 6 # skip Required executable for Bio::Tools::Run::Simprot is not present ok t/SoapEU-function.t ........... skipped: The optional module Bio::DB::ESoap (or dependencies thereof) was not installed t/SoapEU-unit.t ............... skipped: The optional module Bio::DB::ESoap (or dependencies thereof) was not installed # Required executable for Bio::Tools::Run::Alignment::StandAloneFasta is not present t/StandAloneFasta.t ........... 1..15 ok 1 - use Bio::Tools::Run::Alignment::StandAloneFasta; ok 2 - use Bio::SeqIO; ok 3 ok 4 # skip Required executable for Bio::Tools::Run::Alignment::StandAloneFasta is not present ok 5 # skip Required executable for Bio::Tools::Run::Alignment::StandAloneFasta is not present ok 6 # skip Required executable for Bio::Tools::Run::Alignment::StandAloneFasta is not present ok 7 # skip Required executable for Bio::Tools::Run::Alignment::StandAloneFasta is not present ok 8 # skip Required executable for Bio::Tools::Run::Alignment::StandAloneFasta is not present ok 9 # skip Required executable for Bio::Tools::Run::Alignment::StandAloneFasta is not present ok 10 # skip Required executable for Bio::Tools::Run::Alignment::StandAloneFasta is not present ok 11 # skip Required executable for Bio::Tools::Run::Alignment::StandAloneFasta is not present ok 12 # skip Required executable for Bio::Tools::Run::Alignment::StandAloneFasta is not present ok 13 # skip Required executable for Bio::Tools::Run::Alignment::StandAloneFasta is not present ok 14 # skip Required executable for Bio::Tools::Run::Alignment::StandAloneFasta is not present ok 15 # skip Required executable for Bio::Tools::Run::Alignment::StandAloneFasta is not present ok # Required executable for Bio::Tools::Run::Tmhmm is not present t/Tmhmm.t ..................... 1..9 ok 1 - use Bio::Tools::Run::Tmhmm; ok 2 - use Bio::SeqIO; ok 3 - An object of class 'Bio::Tools::Run::Tmhmm' isa 'Bio::Tools::Run::Tmhmm' ok 4 # skip Required executable for Bio::Tools::Run::Tmhmm is not present ok 5 # skip Required executable for Bio::Tools::Run::Tmhmm is not present ok 6 # skip Required executable for Bio::Tools::Run::Tmhmm is not present ok 7 # skip Required executable for Bio::Tools::Run::Tmhmm is not present ok 8 # skip Required executable for Bio::Tools::Run::Tmhmm is not present ok 9 # skip Required executable for Bio::Tools::Run::Tmhmm is not present ok t/TribeMCL.t .................. 1..24 ok 1 - use Bio::Tools::Run::TribeMCL; ok 2 - use Bio::SearchIO; ok 3 - An object of class 'Bio::Tools::Run::TribeMCL' isa 'Bio::Tools::Run::TribeMCL' ok 4 # skip Tribe Matrix program not found. Skipping tests... ok 5 # skip Tribe Matrix program not found. Skipping tests... ok 6 # skip Tribe Matrix program not found. Skipping tests... ok 7 # skip Tribe Matrix program not found. Skipping tests... ok 8 # skip Tribe Matrix program not found. Skipping tests... ok 9 # skip Tribe Matrix program not found. Skipping tests... ok 10 # skip Tribe Matrix program not found. Skipping tests... ok 11 # skip Tribe Matrix program not found. Skipping tests... ok 12 # skip Tribe Matrix program not found. Skipping tests... ok 13 # skip Tribe Matrix program not found. Skipping tests... ok 14 # skip Tribe Matrix program not found. Skipping tests... ok 15 # skip Tribe Matrix program not found. Skipping tests... ok 16 # skip Tribe Matrix program not found. Skipping tests... ok 17 # skip Tribe Matrix program not found. Skipping tests... ok 18 # skip Tribe Matrix program not found. Skipping tests... ok 19 # skip Tribe Matrix program not found. Skipping tests... ok 20 # skip Tribe Matrix program not found. Skipping tests... ok 21 # skip Tribe Matrix program not found. Skipping tests... ok 22 # skip Tribe Matrix program not found. Skipping tests... ok 23 # skip Tribe Matrix program not found. Skipping tests... ok 24 # skip Tribe Matrix program not found. Skipping tests... ok t/Vista.t ..................... 1..7 ok 1 - use Bio::Tools::Run::Vista; ok 2 - use Bio::AlignIO; ok 3 # skip Skipping due to old java version ok 4 # skip Skipping due to old java version ok 5 # skip Skipping due to old java version ok 6 # skip Skipping due to old java version ok 7 # skip Skipping due to old java version ok # Required executable for Bio::Tools::Run::Alignment::Gmap is not present t/gmap-run.t .................. 1..8 ok 1 - use Bio::Tools::Run::Alignment::Gmap; ok 2 # skip Required executable for Bio::Tools::Run::Alignment::Gmap is not present ok 3 # skip Required executable for Bio::Tools::Run::Alignment::Gmap is not present ok 4 # skip Required executable for Bio::Tools::Run::Alignment::Gmap is not present ok 5 # skip Required executable for Bio::Tools::Run::Alignment::Gmap is not present ok 6 # skip Required executable for Bio::Tools::Run::Alignment::Gmap is not present ok 7 # skip Required executable for Bio::Tools::Run::Alignment::Gmap is not present ok 8 # skip Required executable for Bio::Tools::Run::Alignment::Gmap is not present ok # Required executable for Bio::Tools::Run::tRNAscanSE is not present t/tRNAscanSE.t ................ 1..12 ok 1 - use Bio::Tools::Run::tRNAscanSE; ok 2 - use Bio::Root::IO; ok 3 - use Bio::Seq; ok 4 - An object of class 'Bio::Tools::Run::tRNAscanSE' isa 'Bio::Tools::Run::tRNAscanSE' ok 5 # skip Required executable for Bio::Tools::Run::tRNAscanSE is not present ok 6 # skip Required executable for Bio::Tools::Run::tRNAscanSE is not present ok 7 # skip Required executable for Bio::Tools::Run::tRNAscanSE is not present ok 8 # skip Required executable for Bio::Tools::Run::tRNAscanSE is not present ok 9 # skip Required executable for Bio::Tools::Run::tRNAscanSE is not present ok 10 # skip Required executable for Bio::Tools::Run::tRNAscanSE is not present ok 11 # skip Required executable for Bio::Tools::Run::tRNAscanSE is not present ok 12 # skip Required executable for Bio::Tools::Run::tRNAscanSE is not present ok All tests successful. Files=60, Tests=1652, 68 wallclock secs ( 0.18 usr 0.10 sys + 53.48 cusr 3.44 csys = 57.20 CPU) Result: PASS mv t.skip/* t rm -rf t.skip make[1]: Leaving directory '/build/reproducible-path/bioperl-run-1.7.3' create-stamp debian/debhelper-build-stamp dh_prep dh_auto_install /usr/bin/perl Build install --destdir /build/reproducible-path/bioperl-run-1.7.3/debian/tmp --create_packlist 0 Building BioPerl-Run Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man1/bp_run_neighbor.pl.1p Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man1/bp_multi_hmmsearch.pl.1p Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man1/bp_panalysis.pl.1p Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man1/bp_run_protdist.pl.1p Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man1/bp_papplmaker.pl.1p Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Genscan.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/BlastPlus.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Signalp.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Prints.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Simprot.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Mdust.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Profile.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/EMBOSSApplication.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Primer3.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Primate.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Genewise.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Glimmer.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Pseudowise.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/MCS.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/FootPrinter.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Promoterwise.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/tRNAscanSE.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/StandAloneWUBlast.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Genemark.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/ERPIN.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Infernal.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/EMBOSSacd.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Samtools.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/StandAloneNCBIBlast.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/StandAloneBlast.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/BEDTools.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Tmhmm.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/RNAMotif.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Ensembl.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/StandAloneBlastPlus.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Match.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Vista.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Coil.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Eponine.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Seg.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/TribeMCL.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Hmmer.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/RepeatMasker.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Samtools/Config.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Analysis/soap.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/AnalysisFactory/soap.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/BlastPlus/Config.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Phylo/QuickTree.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Phylo/Gerp.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Phylo/Semphy.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Phylo/Phyml.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Phylo/LVB.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Phylo/SLR.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Phylo/Raxml.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Phylo/FastTree.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Phylo/Njtree/Best.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Phylo/Phast/PhyloFit.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Phylo/Phast/PhastCons.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Phylo/Phylip/Neighbor.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Phylo/Phylip/ProtPars.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Phylo/Phylip/ProtDist.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Phylo/Phylip/DrawTree.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Phylo/Phylip/PhylipConf.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Phylo/Phylip/Consense.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Phylo/Phylip/DrawGram.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Phylo/Phylip/Base.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Phylo/Phylip/SeqBoot.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Phylo/Molphy/ProtML.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Phylo/Hyphy/FEL.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Phylo/Hyphy/Modeltest.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Phylo/Hyphy/REL.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Phylo/Hyphy/SLAC.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Phylo/Hyphy/Base.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Phylo/Hyphy/BatchFile.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Alignment/Gmap.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Alignment/Kalign.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Alignment/Proda.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Alignment/StandAloneFasta.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Alignment/MSAProbs.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Alignment/Pal2Nal.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Alignment/MAFFT.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Alignment/Lagan.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Alignment/Probalign.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Alignment/DBA.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Alignment/Amap.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Alignment/Muscle.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Alignment/Probcons.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Alignment/Sim4.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Alignment/Exonerate.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/Alignment/Blat.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/BEDTools/Config.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Tools/Run/StandAloneBlastPlus/BlastMethods.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/DB/SoapEUtilities.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/DB/ESoap.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/DB/SoapEUtilities/LinkAdaptor.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/DB/SoapEUtilities/DocSumAdaptor.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/DB/SoapEUtilities/Result.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/DB/SoapEUtilities/GQueryAdaptor.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/DB/SoapEUtilities/FetchAdaptor.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/DB/SoapEUtilities/FetchAdaptor/species.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/DB/SoapEUtilities/FetchAdaptor/seq.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/DB/ESoap/WSDL.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/perl5/Bio/Factory/EMBOSS.pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Hmmer.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Vista.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Tmhmm.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::StandAloneBlastPlus::BlastMethods.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Pseudowise.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Phylo::Hyphy::BatchFile.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::DB::ESoap.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Phylo::Hyphy::Base.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Eponine.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Phylo::Phylip::SeqBoot.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::FootPrinter.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Phylo::Raxml.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::tRNAscanSE.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Genewise.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Alignment::Lagan.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Profile.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::DB::SoapEUtilities::GQueryAdaptor.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::EMBOSSacd.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Phylo::LVB.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Alignment::MSAProbs.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Promoterwise.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Genscan.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::BlastPlus.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Phylo::SLR.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Alignment::Kalign.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Phylo::Phylip::PhylipConf.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Phylo::Hyphy::Modeltest.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Simprot.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Genemark.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Signalp.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::DB::SoapEUtilities::LinkAdaptor.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Alignment::Gmap.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Coil.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::DB::SoapEUtilities.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::RepeatMasker.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Alignment::Proda.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Ensembl.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Alignment::Pal2Nal.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Phylo::Molphy::ProtML.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Phylo::Hyphy::FEL.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Phylo::Phast::PhyloFit.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Alignment::MAFFT.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::StandAloneBlastPlus.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Phylo::Njtree::Best.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Prints.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::DB::SoapEUtilities::DocSumAdaptor.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Samtools.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Alignment::Amap.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::StandAloneWUBlast.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Phylo::Semphy.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Alignment::Probalign.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::EMBOSSApplication.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::StandAloneBlast.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Phylo::Phyml.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::MCS.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Match.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::ERPIN.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Seg.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Infernal.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::DB::SoapEUtilities::Result.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::DB::SoapEUtilities::FetchAdaptor::species.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::DB::SoapEUtilities::FetchAdaptor.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Phylo::Phast::PhastCons.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Factory::EMBOSS.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::BEDTools::Config.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Phylo::Phylip::Consense.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::BEDTools.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Phylo::Hyphy::REL.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Primate.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Phylo::Phylip::Neighbor.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::DB::SoapEUtilities::FetchAdaptor::seq.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Phylo::Phylip::Base.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Phylo::Gerp.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::RNAMotif.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Phylo::QuickTree.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Alignment::Sim4.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Alignment::Probcons.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Samtools::Config.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Phylo::Phylip::ProtPars.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::TribeMCL.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Phylo::Phylip::ProtDist.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Alignment::Exonerate.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Alignment::Blat.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Primer3.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Phylo::Phylip::DrawGram.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Alignment::StandAloneFasta.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Analysis::soap.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Phylo::Phylip::DrawTree.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Phylo::FastTree.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::DB::ESoap::WSDL.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Alignment::Muscle.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::AnalysisFactory::soap.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Mdust.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Glimmer.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::StandAloneNCBIBlast.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Alignment::DBA.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/share/man/man3/Bio::Tools::Run::Phylo::Hyphy::SLAC.3pm Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/bin/bp_run_protdist.pl Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/bin/bp_multi_hmmsearch.pl Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/bin/bp_panalysis.pl Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/bin/bp_run_neighbor.pl Installing /build/reproducible-path/bioperl-run-1.7.3/debian/tmp/usr/bin/bp_papplmaker.pl dh_install dh_installdocs dh_installchangelogs dh_installman dh_lintian dh_perl dh_link dh_strip_nondeterminism dh_compress dh_fixperms dh_missing dh_installdeb dh_gencontrol dh_md5sums dh_builddeb dpkg-deb: building package 'bioperl-run' in '../bioperl-run_1.7.3-13_all.deb'. dpkg-deb: building package 'libbio-perl-run-perl' in '../libbio-perl-run-perl_1.7.3-13_all.deb'. dpkg-genbuildinfo --build=binary -O../bioperl-run_1.7.3-13_i386.buildinfo dpkg-genchanges --build=binary -O../bioperl-run_1.7.3-13_i386.changes dpkg-genchanges: info: binary-only upload (no source code included) dpkg-source --after-build . dpkg-buildpackage: info: binary-only upload (no source included) dpkg-genchanges: info: not including original source code in upload I: copying local configuration I: user script /srv/workspace/pbuilder/12030/tmp/hooks/B01_cleanup starting I: user script /srv/workspace/pbuilder/12030/tmp/hooks/B01_cleanup finished I: unmounting dev/ptmx filesystem I: unmounting dev/pts filesystem I: unmounting dev/shm filesystem I: unmounting proc filesystem I: unmounting sys filesystem I: cleaning the build env I: removing directory /srv/workspace/pbuilder/12030 and its subdirectories I: Current time: Wed Jan 7 19:37:02 +14 2026 I: pbuilder-time-stamp: 1767764222