I: pbuilder: network access will be disabled during build I: Current time: Tue Mar 26 06:44:06 +14 2024 I: pbuilder-time-stamp: 1711385046 I: Building the build Environment I: extracting base tarball [/var/cache/pbuilder/trixie-reproducible-base.tgz] I: copying local configuration W: --override-config is not set; not updating apt.conf Read the manpage for details. I: mounting /proc filesystem I: mounting /sys filesystem I: creating /{dev,run}/shm I: mounting /dev/pts filesystem I: redirecting /dev/ptmx to /dev/pts/ptmx I: policy-rc.d already exists I: Copying source file I: copying [milib_2.2.0+dfsg-1.dsc] I: copying [./milib_2.2.0+dfsg.orig.tar.xz] I: copying [./milib_2.2.0+dfsg-1.debian.tar.xz] I: Extracting source gpgv: Signature made Fri Dec 30 14:08:01 2022 gpgv: using RSA key 33CB284313E90BD27DCB4523600316A6DC277476 gpgv: Can't check signature: No public key dpkg-source: warning: cannot verify inline signature for ./milib_2.2.0+dfsg-1.dsc: no acceptable signature found dpkg-source: info: extracting milib in milib-2.2.0+dfsg dpkg-source: info: unpacking milib_2.2.0+dfsg.orig.tar.xz dpkg-source: info: unpacking milib_2.2.0+dfsg-1.debian.tar.xz dpkg-source: info: using patch list from debian/patches/series dpkg-source: info: applying build_gradle.patch dpkg-source: info: applying guava_interface.patch dpkg-source: info: applying deactivate_test_reading_build_properties.patch dpkg-source: info: applying flaky_test.patch I: Not using root during the build. I: Installing the build-deps I: user script /srv/workspace/pbuilder/1635/tmp/hooks/D01_modify_environment starting debug: Running on virt32c. I: Changing host+domainname to test build reproducibility I: Adding a custom variable just for the fun of it... I: Changing /bin/sh to bash '/bin/sh' -> '/bin/bash' lrwxrwxrwx 1 root root 9 Mar 25 16:44 /bin/sh -> /bin/bash I: Setting pbuilder2's login shell to /bin/bash I: Setting pbuilder2's GECOS to second user,second room,second work-phone,second home-phone,second other I: user script /srv/workspace/pbuilder/1635/tmp/hooks/D01_modify_environment finished I: user script /srv/workspace/pbuilder/1635/tmp/hooks/D02_print_environment starting I: set BASH=/bin/sh BASHOPTS=checkwinsize:cmdhist:complete_fullquote:extquote:force_fignore:globasciiranges:globskipdots:hostcomplete:interactive_comments:patsub_replacement:progcomp:promptvars:sourcepath BASH_ALIASES=() BASH_ARGC=() BASH_ARGV=() BASH_CMDS=() BASH_LINENO=([0]="12" [1]="0") BASH_LOADABLES_PATH=/usr/local/lib/bash:/usr/lib/bash:/opt/local/lib/bash:/usr/pkg/lib/bash:/opt/pkg/lib/bash:. BASH_SOURCE=([0]="/tmp/hooks/D02_print_environment" [1]="/tmp/hooks/D02_print_environment") BASH_VERSINFO=([0]="5" [1]="2" [2]="21" [3]="1" [4]="release" [5]="arm-unknown-linux-gnueabihf") BASH_VERSION='5.2.21(1)-release' BUILDDIR=/build/reproducible-path BUILDUSERGECOS='second user,second room,second work-phone,second home-phone,second other' BUILDUSERNAME=pbuilder2 BUILD_ARCH=armhf DEBIAN_FRONTEND=noninteractive DEB_BUILD_OPTIONS='buildinfo=+all reproducible=+all parallel=4 ' DIRSTACK=() DISTRIBUTION=trixie EUID=0 FUNCNAME=([0]="Echo" [1]="main") GROUPS=() HOME=/root HOSTNAME=i-capture-the-hostname HOSTTYPE=arm HOST_ARCH=armhf IFS=' ' INVOCATION_ID=29c08962425c403ea22c9f67c9abae7c LANG=C LANGUAGE=it_CH:it LC_ALL=C MACHTYPE=arm-unknown-linux-gnueabihf MAIL=/var/mail/root OPTERR=1 OPTIND=1 OSTYPE=linux-gnueabihf PATH=/usr/sbin:/usr/bin:/sbin:/bin:/usr/games:/i/capture/the/path PBCURRENTCOMMANDLINEOPERATION=build PBUILDER_OPERATION=build PBUILDER_PKGDATADIR=/usr/share/pbuilder PBUILDER_PKGLIBDIR=/usr/lib/pbuilder PBUILDER_SYSCONFDIR=/etc PIPESTATUS=([0]="0") POSIXLY_CORRECT=y PPID=1635 PS4='+ ' PWD=/ SHELL=/bin/bash SHELLOPTS=braceexpand:errexit:hashall:interactive-comments:posix SHLVL=3 SUDO_COMMAND='/usr/bin/timeout -k 24.1h 24h /usr/bin/ionice -c 3 /usr/bin/nice -n 11 /usr/bin/unshare --uts -- /usr/sbin/pbuilder --build --configfile /srv/reproducible-results/rbuild-debian/r-b-build.Xe9poXtK/pbuilderrc_KsvI --distribution trixie --hookdir /etc/pbuilder/rebuild-hooks --debbuildopts -b --basetgz /var/cache/pbuilder/trixie-reproducible-base.tgz --buildresult /srv/reproducible-results/rbuild-debian/r-b-build.Xe9poXtK/b2 --logfile b2/build.log milib_2.2.0+dfsg-1.dsc' SUDO_GID=113 SUDO_UID=107 SUDO_USER=jenkins TERM=unknown TZ=/usr/share/zoneinfo/Etc/GMT-14 UID=0 USER=root _='I: set' http_proxy=http://10.0.0.15:3142/ I: uname -a Linux i-capture-the-hostname 6.1.0-18-armmp-lpae #1 SMP Debian 6.1.76-1 (2024-02-01) armv7l GNU/Linux I: ls -l /bin lrwxrwxrwx 1 root root 7 Mar 24 11:24 /bin -> usr/bin I: user script /srv/workspace/pbuilder/1635/tmp/hooks/D02_print_environment finished -> Attempting to satisfy build-dependencies -> Creating pbuilder-satisfydepends-dummy package Package: pbuilder-satisfydepends-dummy Version: 0.invalid.0 Architecture: armhf Maintainer: Debian Pbuilder Team Description: Dummy package to satisfy dependencies with aptitude - created by pbuilder This package was created automatically by pbuilder to satisfy the build-dependencies of the package being currently built. Depends: debhelper-compat (= 13), default-jdk, gradle-debian-helper, javahelper, maven-repo-helper, junit4, libcommons-compress-java, libcommons-io-java, libcommons-math3-java, libguava-java, libjackson2-annotations-java, libjackson2-core-java, libjackson2-databind-java, libjcommander-java, liblz4-java, libmockito-java, libredberry-pipe-java, libtrove3-java dpkg-deb: building package 'pbuilder-satisfydepends-dummy' in '/tmp/satisfydepends-aptitude/pbuilder-satisfydepends-dummy.deb'. Selecting previously unselected package pbuilder-satisfydepends-dummy. (Reading database ... 19577 files and directories currently installed.) Preparing to unpack .../pbuilder-satisfydepends-dummy.deb ... Unpacking pbuilder-satisfydepends-dummy (0.invalid.0) ... dpkg: pbuilder-satisfydepends-dummy: dependency problems, but configuring anyway as you requested: pbuilder-satisfydepends-dummy depends on debhelper-compat (= 13); however: Package debhelper-compat is not installed. pbuilder-satisfydepends-dummy depends on default-jdk; however: Package default-jdk is not installed. pbuilder-satisfydepends-dummy depends on gradle-debian-helper; however: Package gradle-debian-helper is not installed. pbuilder-satisfydepends-dummy depends on javahelper; however: Package javahelper is not installed. pbuilder-satisfydepends-dummy depends on maven-repo-helper; however: Package maven-repo-helper is not installed. pbuilder-satisfydepends-dummy depends on junit4; however: Package junit4 is not installed. pbuilder-satisfydepends-dummy depends on libcommons-compress-java; however: Package libcommons-compress-java is not installed. pbuilder-satisfydepends-dummy depends on libcommons-io-java; however: Package libcommons-io-java is not installed. pbuilder-satisfydepends-dummy depends on libcommons-math3-java; however: Package libcommons-math3-java is not installed. pbuilder-satisfydepends-dummy depends on libguava-java; however: Package libguava-java is not installed. pbuilder-satisfydepends-dummy depends on libjackson2-annotations-java; however: Package libjackson2-annotations-java is not installed. pbuilder-satisfydepends-dummy depends on libjackson2-core-java; however: Package libjackson2-core-java is not installed. pbuilder-satisfydepends-dummy depends on libjackson2-databind-java; however: Package libjackson2-databind-java is not installed. pbuilder-satisfydepends-dummy depends on libjcommander-java; however: Package libjcommander-java is not installed. pbuilder-satisfydepends-dummy depends on liblz4-java; however: Package liblz4-java is not installed. pbuilder-satisfydepends-dummy depends on libmockito-java; however: Package libmockito-java is not installed. pbuilder-satisfydepends-dummy depends on libredberry-pipe-java; however: Package libredberry-pipe-java is not installed. pbuilder-satisfydepends-dummy depends on libtrove3-java; however: Package libtrove3-java is not installed. Setting up pbuilder-satisfydepends-dummy (0.invalid.0) ... Reading package lists... Building dependency tree... Reading state information... Initializing package states... Writing extended state information... Building tag database... pbuilder-satisfydepends-dummy is already installed at the requested version (0.invalid.0) pbuilder-satisfydepends-dummy is already installed at the requested version (0.invalid.0) The following NEW packages will be installed: adwaita-icon-theme{a} ant{a} ant-optional{a} antlr{a} at-spi2-common{a} autoconf{a} automake{a} autopoint{a} autotools-dev{a} binfmt-support{a} bnd{a} bsdextrautils{a} ca-certificates{a} ca-certificates-java{a} dctrl-tools{a} debhelper{a} default-jdk{a} default-jdk-headless{a} default-jre{a} default-jre-headless{a} devscripts{a} dh-autoreconf{a} dh-strip-nondeterminism{a} dirmngr{a} dwz{a} fastjar{a} file{a} fontconfig{a} fontconfig-config{a} fonts-dejavu-core{a} fonts-dejavu-mono{a} gettext{a} gettext-base{a} gnupg{a} gnupg-l10n{a} gnupg-utils{a} gpg{a} gpg-agent{a} gpg-wks-client{a} gpg-wks-server{a} gpgconf{a} gpgsm{a} gradle{a} gradle-debian-helper{a} groff-base{a} groovy{a} gtk-update-icon-cache{a} hicolor-icon-theme{a} intltool-debian{a} ivy{a} jarwrapper{a} java-common{a} java-wrappers{a} javahelper{a} junit4{a} libantlr-java{a} libaopalliance-java{a} libapache-pom-java{a} libarchive-zip-perl{a} libasm-java{a} libasound2{a} libasound2-data{a} libassuan0{a} libatinject-jsr330-api-java{a} libatk1.0-0{a} libavahi-client3{a} libavahi-common-data{a} libavahi-common3{a} libb-hooks-op-check-perl{a} libbcel-java{a} libbcpg-java{a} libbcprov-java{a} libbrotli1{a} libbsd0{a} libbsf-java{a} libbsh-java{a} libbyte-buddy-java{a} libcairo2{a} libcdi-api-java{a} libclass-method-modifiers-perl{a} libclass-xsaccessor-perl{a} libclone-perl{a} libcommons-cli-java{a} libcommons-codec-java{a} libcommons-collections3-java{a} libcommons-compress-java{a} libcommons-io-java{a} libcommons-lang-java{a} libcommons-lang3-java{a} libcommons-logging-java{a} libcommons-math3-java{a} libcommons-parent-java{a} libcups2{a} libdatrie1{a} libdbus-1-3{a} libdd-plist-java{a} libdebhelper-perl{a} libdeflate0{a} libdevel-callchecker-perl{a} libdom4j-java{a} libdrm-amdgpu1{a} libdrm-common{a} libdrm-nouveau2{a} libdrm-radeon1{a} libdrm2{a} libdynaloader-functions-perl{a} libeclipse-jdt-annotation-java{a} libedit2{a} libel-api-java{a} libelf1{a} libencode-locale-perl{a} liberror-prone-java{a} libexpat1{a} libfelix-framework-java{a} libfelix-gogo-runtime-java{a} libfelix-resolver-java{a} libfile-dirlist-perl{a} libfile-homedir-perl{a} libfile-listing-perl{a} libfile-stripnondeterminism-perl{a} libfile-touch-perl{a} libfile-which-perl{a} libfindbugs-java{a} libfontconfig1{a} libfreetype6{a} libfribidi0{a} libgdk-pixbuf-2.0-0{a} libgdk-pixbuf2.0-common{a} libgeronimo-annotation-1.3-spec-java{a} libgeronimo-interceptor-3.0-spec-java{a} libgif7{a} libgl1{a} libgl1-mesa-dri{a} libglapi-mesa{a} libglib2.0-0{a} libglvnd0{a} libglx-mesa0{a} libglx0{a} libgoogle-gson-java{a} libgradle-core-java{a} libgradle-plugins-java{a} libgraphite2-3{a} libgtk2.0-0{a} libgtk2.0-common{a} libguava-java{a} libguice-java{a} libhamcrest-java{a} libharfbuzz0b{a} libhawtjni-runtime-java{a} libhtml-parser-perl{a} libhtml-tagset-perl{a} libhtml-tree-perl{a} libhttp-cookies-perl{a} libhttp-date-perl{a} libhttp-message-perl{a} libhttp-negotiate-perl{a} libhttpclient-java{a} libhttpcore-java{a} libicu72{a} libimport-into-perl{a} libio-html-perl{a} libio-pty-perl{a} libio-socket-ssl-perl{a} libipc-run-perl{a} libjackson2-annotations-java{a} libjackson2-core-java{a} libjackson2-databind-java{a} libjansi-java{a} libjansi-native-java{a} libjansi1-java{a} libjarjar-java{a} libjatl-java{a} libjavaewah-java{a} libjaxen-java{a} libjbig0{a} libjcifs-java{a} libjcip-annotations-java{a} libjcommander-java{a} libjetty9-java{a} libjformatstring-java{a} libjgit-java{a} libjline2-java{a} libjna-java{a} libjna-jni{a} libjpeg62-turbo{a} libjs-jquery{a} libjsch-java{a} libjsoup-java{a} libjsp-api-java{a} libjsr305-java{a} libjzlib-java{a} libkryo-java{a} libksba8{a} liblcms2-2{a} libldap-2.5-0{a} liblerc4{a} libllvm17{a} liblogback-java{a} liblwp-mediatypes-perl{a} liblwp-protocol-https-perl{a} liblz4-java{a} liblz4-jni{a} libmagic-mgc{a} libmagic1{a} libmaven-parent-java{a} libmaven-resolver-java{a} libmaven-shared-utils-java{a} libmaven3-core-java{a} libminlog-java{a} libmockito-java{a} libmodule-runtime-perl{a} libmoo-perl{a} libnative-platform-java{a} libnative-platform-jni{a} libnekohtml-java{a} libnet-http-perl{a} libnet-ssleay-perl{a} libnpth0{a} libnspr4{a} libnss3{a} libobjenesis-java{a} libosgi-annotation-java{a} libosgi-compendium-java{a} libosgi-core-java{a} libpango-1.0-0{a} libpangocairo-1.0-0{a} libpangoft2-1.0-0{a} libparams-classify-perl{a} libpcsclite1{a} libpipeline1{a} libpixman-1-0{a} libplexus-cipher-java{a} libplexus-classworlds-java{a} libplexus-component-annotations-java{a} libplexus-container-default-java{a} libplexus-interpolation-java{a} libplexus-sec-dispatcher-java{a} libplexus-utils2-java{a} libpng16-16{a} libpolyglot-maven-java{a} libpython3-stdlib{a} libpython3.11-minimal{a} libpython3.11-stdlib{a} libqdox-java{a} libreadline8{a} libredberry-pipe-java{a} libreflectasm-java{a} librhino-java{a} librole-tiny-perl{a} libsasl2-2{a} libsasl2-modules-db{a} libsensors-config{a} libsensors5{a} libservlet-api-java{a} libsharpyuv0{a} libsimple-http-java{a} libsisu-inject-java{a} libsisu-plexus-java{a} libslf4j-java{a} libsub-override-perl{a} libsub-quote-perl{a} libthai-data{a} libthai0{a} libtiff6{a} libtimedate-perl{a} libtool{a} libtrove3-java{a} libtry-tiny-perl{a} libuchardet0{a} liburi-perl{a} libvulkan1{a} libwagon-file-java{a} libwagon-http-java{a} libwagon-provider-api-java{a} libwebp7{a} libwebsocket-api-java{a} libwww-perl{a} libwww-robotrules-perl{a} libx11-6{a} libx11-data{a} libx11-xcb1{a} libxau6{a} libxbean-reflect-java{a} libxcb-dri2-0{a} libxcb-dri3-0{a} libxcb-glx0{a} libxcb-present0{a} libxcb-randr0{a} libxcb-render0{a} libxcb-shm0{a} libxcb-sync1{a} libxcb-xfixes0{a} libxcb1{a} libxcomposite1{a} libxcursor1{a} libxdamage1{a} libxdmcp6{a} libxerces2-java{a} libxext6{a} libxfixes3{a} libxi6{a} libxinerama1{a} libxml-commons-external-java{a} libxml-commons-resolver1.1-java{a} libxml2{a} libxpp3-java{a} libxrandr2{a} libxrender1{a} libxshmfence1{a} libxstream-java{a} libxtst6{a} libxxf86vm1{a} libxz-java{a} libyaml-snake-java{a} libz3-4{a} m4{a} man-db{a} maven-repo-helper{a} media-types{a} netbase{a} openjdk-17-jdk{a} openjdk-17-jdk-headless{a} openjdk-17-jre{a} openjdk-17-jre-headless{a} openssl{a} patchutils{a} perl-openssl-defaults{a} pinentry-curses{a} po-debconf{a} python3{a} python3-minimal{a} python3.11{a} python3.11-minimal{a} readline-common{a} sensible-utils{a} shared-mime-info{a} testng{a} tzdata{a} unzip{a} wdiff{a} x11-common{a} The following packages are RECOMMENDED but will NOT be installed: alsa-topology-conf alsa-ucm-conf curl dbus debian-keyring dput dput-ng dupload equivs fonts-dejavu-extra javascript-common libarchive-cpio-perl libatk-wrapper-java-jni libbindex-java libdata-dump-perl libdistro-info-perl libgail-common libgdk-pixbuf2.0-bin libgit-wrapper-perl libgitlab-api-v4-perl libglib2.0-data libgpars-groovy-java libgtk2.0-bin libhtml-form-perl libhtml-format-perl libhttp-daemon-perl libio-compress-brotli-perl libjson-perl libldap-common liblist-compare-perl libltdl-dev libmail-sendmail-perl libmailtools-perl libnamespace-clean-perl libreflectasm-java-doc librsvg2-common libsasl2-modules libsoap-lite-perl libstring-shellquote-perl libxstring-perl libxt-dev licensecheck lintian lynx mesa-vulkan-drivers pristine-tar python3-apt python3-debian python3-magic python3-requests python3-unidiff python3-xdg strace wget xdg-user-dirs 0 packages upgraded, 341 newly installed, 0 to remove and 0 not upgraded. Need to get 291 MB of archives. After unpacking 717 MB will be used. Writing extended state information... Get: 1 http://deb.debian.org/debian trixie/main armhf libpipeline1 armhf 1.5.7-1+b2 [33.4 kB] Get: 2 http://deb.debian.org/debian trixie/main armhf binfmt-support armhf 2.2.2-6 [55.2 kB] Get: 3 http://deb.debian.org/debian trixie/main armhf libpython3.11-minimal armhf 3.11.8-1 [802 kB] Get: 4 http://deb.debian.org/debian trixie/main armhf libexpat1 armhf 2.5.0-2+b2 [80.2 kB] Get: 5 http://deb.debian.org/debian trixie/main armhf python3.11-minimal armhf 3.11.8-1 [1707 kB] Get: 6 http://deb.debian.org/debian trixie/main armhf python3-minimal armhf 3.11.6-1 [26.2 kB] Get: 7 http://deb.debian.org/debian trixie/main armhf media-types all 10.1.0 [26.9 kB] Get: 8 http://deb.debian.org/debian trixie/main armhf netbase all 6.4 [12.8 kB] Get: 9 http://deb.debian.org/debian trixie/main armhf tzdata all 2024a-1 [255 kB] Get: 10 http://deb.debian.org/debian trixie/main armhf readline-common all 8.2-3 [69.1 kB] Get: 11 http://deb.debian.org/debian trixie/main armhf libreadline8 armhf 8.2-3+b1 [144 kB] Get: 12 http://deb.debian.org/debian trixie/main armhf libpython3.11-stdlib armhf 3.11.8-1 [1709 kB] Get: 13 http://deb.debian.org/debian trixie/main armhf python3.11 armhf 3.11.8-1 [597 kB] Get: 14 http://deb.debian.org/debian trixie/main armhf libpython3-stdlib armhf 3.11.6-1 [9224 B] Get: 15 http://deb.debian.org/debian trixie/main armhf python3 armhf 3.11.6-1 [26.2 kB] Get: 16 http://deb.debian.org/debian trixie/main armhf sensible-utils all 0.0.22 [22.4 kB] Get: 17 http://deb.debian.org/debian trixie/main armhf openssl armhf 3.1.5-1 [1208 kB] Get: 18 http://deb.debian.org/debian trixie/main armhf ca-certificates all 20240203 [158 kB] Get: 19 http://deb.debian.org/debian trixie/main armhf libmagic-mgc armhf 1:5.45-2+b1 [314 kB] Get: 20 http://deb.debian.org/debian trixie/main armhf libmagic1 armhf 1:5.45-2+b1 [97.9 kB] Get: 21 http://deb.debian.org/debian trixie/main armhf file armhf 1:5.45-2+b1 [42.2 kB] Get: 22 http://deb.debian.org/debian trixie/main armhf gettext-base armhf 0.21-14+b1 [157 kB] Get: 23 http://deb.debian.org/debian trixie/main armhf libuchardet0 armhf 0.0.8-1+b1 [65.7 kB] Get: 24 http://deb.debian.org/debian trixie/main armhf groff-base armhf 1.23.0-3 [1088 kB] Get: 25 http://deb.debian.org/debian trixie/main armhf bsdextrautils armhf 2.39.3-6 [81.2 kB] Get: 26 http://deb.debian.org/debian trixie/main armhf man-db armhf 2.12.0-3 [1367 kB] Get: 27 http://deb.debian.org/debian trixie/main armhf libgdk-pixbuf2.0-common all 2.42.10+dfsg-3 [307 kB] Get: 28 http://deb.debian.org/debian trixie/main armhf libglib2.0-0 armhf 2.78.4-1 [1281 kB] Get: 29 http://deb.debian.org/debian trixie/main armhf libicu72 armhf 72.1-4+b1 [9070 kB] Get: 30 http://deb.debian.org/debian trixie/main armhf libxml2 armhf 2.9.14+dfsg-1.3+b2 [599 kB] Get: 31 http://deb.debian.org/debian trixie/main armhf shared-mime-info armhf 2.4-1 [746 kB] Get: 32 http://deb.debian.org/debian trixie/main armhf libjpeg62-turbo armhf 1:2.1.5-2+b2 [143 kB] Get: 33 http://deb.debian.org/debian trixie/main armhf libpng16-16 armhf 1.6.43-1 [262 kB] Get: 34 http://deb.debian.org/debian trixie/main armhf libdeflate0 armhf 1.19-1 [39.1 kB] Get: 35 http://deb.debian.org/debian trixie/main armhf libjbig0 armhf 2.1-6.1+b1 [27.3 kB] Get: 36 http://deb.debian.org/debian trixie/main armhf liblerc4 armhf 4.0.0+ds-4+b1 [137 kB] Get: 37 http://deb.debian.org/debian trixie/main armhf libsharpyuv0 armhf 1.3.2-0.4 [105 kB] Get: 38 http://deb.debian.org/debian trixie/main armhf libwebp7 armhf 1.3.2-0.4 [261 kB] Get: 39 http://deb.debian.org/debian trixie/main armhf libtiff6 armhf 4.5.1+git230720-4 [301 kB] Get: 40 http://deb.debian.org/debian trixie/main armhf libgdk-pixbuf-2.0-0 armhf 2.42.10+dfsg-3+b1 [124 kB] Get: 41 http://deb.debian.org/debian trixie/main armhf gtk-update-icon-cache armhf 3.24.41-1 [44.6 kB] Get: 42 http://deb.debian.org/debian trixie/main armhf hicolor-icon-theme all 0.17-2 [11.4 kB] Get: 43 http://deb.debian.org/debian trixie/main armhf adwaita-icon-theme all 46.0-1 [614 kB] Get: 44 http://deb.debian.org/debian trixie/main armhf ca-certificates-java all 20240118 [11.6 kB] Get: 45 http://deb.debian.org/debian trixie/main armhf java-common all 0.75 [6640 B] Get: 46 http://deb.debian.org/debian trixie/main armhf libavahi-common-data armhf 0.8-13+b1 [111 kB] Get: 47 http://deb.debian.org/debian trixie/main armhf libavahi-common3 armhf 0.8-13+b1 [40.1 kB] Get: 48 http://deb.debian.org/debian trixie/main armhf libdbus-1-3 armhf 1.14.10-4 [180 kB] Get: 49 http://deb.debian.org/debian trixie/main armhf libavahi-client3 armhf 0.8-13+b1 [43.4 kB] Get: 50 http://deb.debian.org/debian trixie/main armhf libcups2 armhf 2.4.7-1+b1 [212 kB] Get: 51 http://deb.debian.org/debian trixie/main armhf liblcms2-2 armhf 2.14-2+b1 [126 kB] Get: 52 http://deb.debian.org/debian trixie/main armhf libbrotli1 armhf 1.1.0-2+b3 [284 kB] Get: 53 http://deb.debian.org/debian trixie/main armhf libfreetype6 armhf 2.13.2+dfsg-1+b1 [371 kB] Get: 54 http://deb.debian.org/debian trixie/main armhf fonts-dejavu-mono all 2.37-8 [489 kB] Get: 55 http://deb.debian.org/debian trixie/main armhf fonts-dejavu-core all 2.37-8 [840 kB] Get: 56 http://deb.debian.org/debian trixie/main armhf fontconfig-config armhf 2.15.0-1.1 [317 kB] Get: 57 http://deb.debian.org/debian trixie/main armhf libfontconfig1 armhf 2.15.0-1.1 [370 kB] Get: 58 http://deb.debian.org/debian trixie/main armhf libnspr4 armhf 2:4.35-1.1+b1 [87.2 kB] Get: 59 http://deb.debian.org/debian trixie/main armhf libnss3 armhf 2:3.99-1 [1220 kB] Get: 60 http://deb.debian.org/debian trixie/main armhf libasound2-data all 1.2.10-3 [20.7 kB] Get: 61 http://deb.debian.org/debian trixie/main armhf libasound2 armhf 1.2.10-3 [316 kB] Get: 62 http://deb.debian.org/debian trixie/main armhf libgraphite2-3 armhf 1.3.14-2 [63.2 kB] Get: 63 http://deb.debian.org/debian trixie/main armhf libharfbuzz0b armhf 8.3.0-2 [2155 kB] Get: 64 http://deb.debian.org/debian trixie/main armhf libpcsclite1 armhf 2.0.1-1+b1 [47.8 kB] Get: 65 http://deb.debian.org/debian trixie/main armhf openjdk-17-jre-headless armhf 17.0.10+7-1 [38.2 MB] Get: 66 http://deb.debian.org/debian trixie/main armhf default-jre-headless armhf 2:1.17-75 [3068 B] Get: 67 http://deb.debian.org/debian trixie/main armhf ant all 1.10.14-1 [2162 kB] Get: 68 http://deb.debian.org/debian trixie/main armhf ant-optional all 1.10.14-1 [455 kB] Get: 69 http://deb.debian.org/debian trixie/main armhf libantlr-java all 2.7.7+dfsg-13 [458 kB] Get: 70 http://deb.debian.org/debian trixie/main armhf antlr all 2.7.7+dfsg-13 [8272 B] Get: 71 http://deb.debian.org/debian trixie/main armhf at-spi2-common all 2.50.0-1 [163 kB] Get: 72 http://deb.debian.org/debian trixie/main armhf m4 armhf 1.4.19-4 [264 kB] Get: 73 http://deb.debian.org/debian trixie/main armhf autoconf all 2.71-3 [332 kB] Get: 74 http://deb.debian.org/debian trixie/main armhf autotools-dev all 20220109.1 [51.6 kB] Get: 75 http://deb.debian.org/debian trixie/main armhf automake all 1:1.16.5-1.3 [823 kB] Get: 76 http://deb.debian.org/debian trixie/main armhf autopoint all 0.21-14 [496 kB] Get: 77 http://deb.debian.org/debian trixie/main armhf unzip armhf 6.0-28 [152 kB] Get: 78 http://deb.debian.org/debian trixie/main armhf java-wrappers all 0.4 [8916 B] Get: 79 http://deb.debian.org/debian trixie/main armhf libhamcrest-java all 2.2-2 [121 kB] Get: 80 http://deb.debian.org/debian trixie/main armhf junit4 all 4.13.2-4 [349 kB] Get: 81 http://deb.debian.org/debian trixie/main armhf libfelix-framework-java all 4.6.1-2.1 [569 kB] Get: 82 http://deb.debian.org/debian trixie/main armhf libfelix-gogo-runtime-java all 0.16.2-1.1 [114 kB] Get: 83 http://deb.debian.org/debian trixie/main armhf libosgi-annotation-java all 8.1.0-1 [9436 B] Get: 84 http://deb.debian.org/debian trixie/main armhf libosgi-core-java all 8.0.0-2 [182 kB] Get: 85 http://deb.debian.org/debian trixie/main armhf libfelix-resolver-java all 1.16.0-1 [180 kB] Get: 86 http://deb.debian.org/debian trixie/main armhf libhawtjni-runtime-java all 1.18-1 [36.3 kB] Get: 87 http://deb.debian.org/debian trixie/main armhf libjansi-native-java all 1.8-2 [26.0 kB] Get: 88 http://deb.debian.org/debian trixie/main armhf libjansi1-java all 1.18-3 [66.5 kB] Get: 89 http://deb.debian.org/debian trixie/main armhf libjline2-java all 2.14.6-5 [151 kB] Get: 90 http://deb.debian.org/debian trixie/main armhf libosgi-compendium-java all 7.0.0-1 [477 kB] Get: 91 http://deb.debian.org/debian trixie/main armhf libslf4j-java all 1.7.32-1 [144 kB] Get: 92 http://deb.debian.org/debian trixie/main armhf libxz-java all 1.9-1 [143 kB] Get: 93 http://deb.debian.org/debian trixie/main armhf libyaml-snake-java all 1.33-2 [321 kB] Get: 94 http://deb.debian.org/debian trixie/main armhf bnd all 5.0.1-5 [10.1 MB] Get: 95 http://deb.debian.org/debian trixie/main armhf dctrl-tools armhf 2.24-3 [96.0 kB] Get: 96 http://deb.debian.org/debian trixie/main armhf libdebhelper-perl all 13.14.1 [85.6 kB] Get: 97 http://deb.debian.org/debian trixie/main armhf libtool all 2.4.7-7 [517 kB] Get: 98 http://deb.debian.org/debian trixie/main armhf dh-autoreconf all 20 [17.1 kB] Get: 99 http://deb.debian.org/debian trixie/main armhf libarchive-zip-perl all 1.68-1 [104 kB] Get: 100 http://deb.debian.org/debian trixie/main armhf libsub-override-perl all 0.10-1 [10.6 kB] Get: 101 http://deb.debian.org/debian trixie/main armhf libfile-stripnondeterminism-perl all 1.13.1-1 [19.4 kB] Get: 102 http://deb.debian.org/debian trixie/main armhf dh-strip-nondeterminism all 1.13.1-1 [8620 B] Get: 103 http://deb.debian.org/debian trixie/main armhf libelf1 armhf 0.190-1+b1 [171 kB] Get: 104 http://deb.debian.org/debian trixie/main armhf dwz armhf 0.15-1 [101 kB] Get: 105 http://deb.debian.org/debian trixie/main armhf gettext armhf 0.21-14+b1 [1230 kB] Get: 106 http://deb.debian.org/debian trixie/main armhf intltool-debian all 0.35.0+20060710.6 [22.9 kB] Get: 107 http://deb.debian.org/debian trixie/main armhf po-debconf all 1.0.21+nmu1 [248 kB] Get: 108 http://deb.debian.org/debian trixie/main armhf debhelper all 13.14.1 [890 kB] Get: 109 http://deb.debian.org/debian trixie/main armhf libgtk2.0-common all 2.24.33-3 [2659 kB] Get: 110 http://deb.debian.org/debian trixie/main armhf libatk1.0-0 armhf 2.50.0-1+b1 [43.3 kB] Get: 111 http://deb.debian.org/debian trixie/main armhf libpixman-1-0 armhf 0.42.2-1+b1 [476 kB] Get: 112 http://deb.debian.org/debian trixie/main armhf libxau6 armhf 1:1.0.9-1 [19.0 kB] Get: 113 http://deb.debian.org/debian trixie/main armhf libbsd0 armhf 0.12.2-1 [127 kB] Get: 114 http://deb.debian.org/debian trixie/main armhf libxdmcp6 armhf 1:1.1.2-3 [24.9 kB] Get: 115 http://deb.debian.org/debian trixie/main armhf libxcb1 armhf 1.15-1 [140 kB] Get: 116 http://deb.debian.org/debian trixie/main armhf libx11-data all 2:1.8.7-1 [328 kB] Get: 117 http://deb.debian.org/debian trixie/main armhf libx11-6 armhf 2:1.8.7-1 [735 kB] Get: 118 http://deb.debian.org/debian trixie/main armhf libxcb-render0 armhf 1.15-1 [114 kB] Get: 119 http://deb.debian.org/debian trixie/main armhf libxcb-shm0 armhf 1.15-1 [106 kB] Get: 120 http://deb.debian.org/debian trixie/main armhf libxext6 armhf 2:1.3.4-1+b1 [47.8 kB] Get: 121 http://deb.debian.org/debian trixie/main armhf libxrender1 armhf 1:0.9.10-1.1 [30.1 kB] Get: 122 http://deb.debian.org/debian trixie/main armhf libcairo2 armhf 1.18.0-1+b1 [441 kB] Get: 123 http://deb.debian.org/debian trixie/main armhf fontconfig armhf 2.15.0-1.1 [461 kB] Get: 124 http://deb.debian.org/debian trixie/main armhf libfribidi0 armhf 1.0.13-3+b1 [69.4 kB] Get: 125 http://deb.debian.org/debian trixie/main armhf libthai-data all 0.1.29-2 [168 kB] Get: 126 http://deb.debian.org/debian trixie/main armhf libdatrie1 armhf 0.2.13-3 [34.4 kB] Get: 127 http://deb.debian.org/debian trixie/main armhf libthai0 armhf 0.1.29-2 [45.8 kB] Get: 128 http://deb.debian.org/debian trixie/main armhf libpango-1.0-0 armhf 1.52.0+ds-1 [192 kB] Get: 129 http://deb.debian.org/debian trixie/main armhf libpangoft2-1.0-0 armhf 1.52.0+ds-1 [41.8 kB] Get: 130 http://deb.debian.org/debian trixie/main armhf libpangocairo-1.0-0 armhf 1.52.0+ds-1 [31.2 kB] Get: 131 http://deb.debian.org/debian trixie/main armhf libxcomposite1 armhf 1:0.4.5-1 [16.1 kB] Get: 132 http://deb.debian.org/debian trixie/main armhf libxfixes3 armhf 1:6.0.0-2 [21.1 kB] Get: 133 http://deb.debian.org/debian trixie/main armhf libxcursor1 armhf 1:1.2.1-1 [37.9 kB] Get: 134 http://deb.debian.org/debian trixie/main armhf libxdamage1 armhf 1:1.1.6-1 [14.6 kB] Get: 135 http://deb.debian.org/debian trixie/main armhf libxi6 armhf 2:1.8.1-1 [73.8 kB] Get: 136 http://deb.debian.org/debian trixie/main armhf libxinerama1 armhf 2:1.1.4-3 [17.4 kB] Get: 137 http://deb.debian.org/debian trixie/main armhf libxrandr2 armhf 2:1.5.4-1 [33.0 kB] Get: 138 http://deb.debian.org/debian trixie/main armhf libgtk2.0-0 armhf 2.24.33-3 [1555 kB] Get: 139 http://deb.debian.org/debian trixie/main armhf libglvnd0 armhf 1.7.0-1 [52.3 kB] Get: 140 http://deb.debian.org/debian trixie/main armhf libdrm-common all 2.4.120-2 [7688 B] Get: 141 http://deb.debian.org/debian trixie/main armhf libdrm2 armhf 2.4.120-2 [33.8 kB] Get: 142 http://deb.debian.org/debian trixie/main armhf libglapi-mesa armhf 23.3.5-1 [42.5 kB] Get: 143 http://deb.debian.org/debian trixie/main armhf libx11-xcb1 armhf 2:1.8.7-1 [231 kB] Get: 144 http://deb.debian.org/debian trixie/main armhf libxcb-dri2-0 armhf 1.15-1 [107 kB] Get: 145 http://deb.debian.org/debian trixie/main armhf libxcb-dri3-0 armhf 1.15-1 [107 kB] Get: 146 http://deb.debian.org/debian trixie/main armhf libxcb-glx0 armhf 1.15-1 [120 kB] Get: 147 http://deb.debian.org/debian trixie/main armhf libxcb-present0 armhf 1.15-1 [105 kB] Get: 148 http://deb.debian.org/debian trixie/main armhf libxcb-randr0 armhf 1.15-1 [116 kB] Get: 149 http://deb.debian.org/debian trixie/main armhf libxcb-sync1 armhf 1.15-1 [108 kB] Get: 150 http://deb.debian.org/debian trixie/main armhf libxcb-xfixes0 armhf 1.15-1 [110 kB] Get: 151 http://deb.debian.org/debian trixie/main armhf libxshmfence1 armhf 1.3-1 [8592 B] Get: 152 http://deb.debian.org/debian trixie/main armhf libxxf86vm1 armhf 1:1.1.4-1+b2 [20.2 kB] Get: 153 http://deb.debian.org/debian trixie/main armhf libvulkan1 armhf 1.3.275.0-1 [109 kB] Get: 154 http://deb.debian.org/debian trixie/main armhf libdrm-amdgpu1 armhf 2.4.120-2 [20.0 kB] Get: 155 http://deb.debian.org/debian trixie/main armhf libdrm-nouveau2 armhf 2.4.120-2 [16.9 kB] Get: 156 http://deb.debian.org/debian trixie/main armhf libdrm-radeon1 armhf 2.4.120-2 [19.5 kB] Get: 157 http://deb.debian.org/debian trixie/main armhf libedit2 armhf 3.1-20230828-1 [76.8 kB] Get: 158 http://deb.debian.org/debian trixie/main armhf libz3-4 armhf 4.8.12-3.1+b2 [6324 kB] Get: 159 http://deb.debian.org/debian trixie/main armhf libllvm17 armhf 1:17.0.6-5 [21.6 MB] Get: 160 http://deb.debian.org/debian trixie/main armhf libsensors-config all 1:3.6.0-9 [14.6 kB] Get: 161 http://deb.debian.org/debian trixie/main armhf libsensors5 armhf 1:3.6.0-9 [31.9 kB] Get: 162 http://deb.debian.org/debian trixie/main armhf libgl1-mesa-dri armhf 23.3.5-1 [6405 kB] Get: 163 http://deb.debian.org/debian trixie/main armhf libglx-mesa0 armhf 23.3.5-1 [130 kB] Get: 164 http://deb.debian.org/debian trixie/main armhf libglx0 armhf 1.7.0-1 [32.2 kB] Get: 165 http://deb.debian.org/debian trixie/main armhf libgl1 armhf 1.7.0-1 [90.8 kB] Get: 166 http://deb.debian.org/debian trixie/main armhf libgif7 armhf 5.2.2-1 [41.2 kB] Get: 167 http://deb.debian.org/debian trixie/main armhf x11-common all 1:7.7+23 [252 kB] Get: 168 http://deb.debian.org/debian trixie/main armhf libxtst6 armhf 2:1.2.3-1.1 [26.2 kB] Get: 169 http://deb.debian.org/debian trixie/main armhf openjdk-17-jre armhf 17.0.10+7-1 [163 kB] Get: 170 http://deb.debian.org/debian trixie/main armhf default-jre armhf 2:1.17-75 [1056 B] Get: 171 http://deb.debian.org/debian trixie/main armhf openjdk-17-jdk-headless armhf 17.0.10+7-1 [67.4 MB] Get: 172 http://deb.debian.org/debian trixie/main armhf default-jdk-headless armhf 2:1.17-75 [1108 B] Get: 173 http://deb.debian.org/debian trixie/main armhf openjdk-17-jdk armhf 17.0.10+7-1 [2361 kB] Get: 174 http://deb.debian.org/debian trixie/main armhf default-jdk armhf 2:1.17-75 [1068 B] Get: 175 http://deb.debian.org/debian trixie/main armhf libassuan0 armhf 2.5.6-1 [43.3 kB] Get: 176 http://deb.debian.org/debian trixie/main armhf gpgconf armhf 2.2.40-1.1+b1 [547 kB] Get: 177 http://deb.debian.org/debian trixie/main armhf libksba8 armhf 1.6.6-1 [112 kB] Get: 178 http://deb.debian.org/debian trixie/main armhf libsasl2-modules-db armhf 2.1.28+dfsg1-4+b1 [18.2 kB] Get: 179 http://deb.debian.org/debian trixie/main armhf libsasl2-2 armhf 2.1.28+dfsg1-4+b1 [50.1 kB] Get: 180 http://deb.debian.org/debian trixie/main armhf libldap-2.5-0 armhf 2.5.13+dfsg-5+b3 [158 kB] Get: 181 http://deb.debian.org/debian trixie/main armhf libnpth0 armhf 1.6-3+b1 [16.9 kB] Get: 182 http://deb.debian.org/debian trixie/main armhf dirmngr armhf 2.2.40-1.1+b1 [750 kB] Get: 183 http://deb.debian.org/debian trixie/main armhf gnupg-l10n all 2.2.40-1.1 [1093 kB] Get: 184 http://deb.debian.org/debian trixie/main armhf gnupg-utils armhf 2.2.40-1.1+b1 [853 kB] Get: 185 http://deb.debian.org/debian trixie/main armhf gpg armhf 2.2.40-1.1+b1 [886 kB] Get: 186 http://deb.debian.org/debian trixie/main armhf pinentry-curses armhf 1.2.1-3 [73.8 kB] Get: 187 http://deb.debian.org/debian trixie/main armhf gpg-agent armhf 2.2.40-1.1+b1 [653 kB] Get: 188 http://deb.debian.org/debian trixie/main armhf gpg-wks-client armhf 2.2.40-1.1+b1 [525 kB] Get: 189 http://deb.debian.org/debian trixie/main armhf gpg-wks-server armhf 2.2.40-1.1+b1 [518 kB] Get: 190 http://deb.debian.org/debian trixie/main armhf gpgsm armhf 2.2.40-1.1+b1 [638 kB] Get: 191 http://deb.debian.org/debian trixie/main armhf gnupg all 2.2.40-1.1 [846 kB] Get: 192 http://deb.debian.org/debian trixie/main armhf libfile-dirlist-perl all 0.05-3 [7600 B] Get: 193 http://deb.debian.org/debian trixie/main armhf libfile-which-perl all 1.27-2 [15.1 kB] Get: 194 http://deb.debian.org/debian trixie/main armhf libfile-homedir-perl all 1.006-2 [42.4 kB] Get: 195 http://deb.debian.org/debian trixie/main armhf libfile-touch-perl all 0.12-2 [8816 B] Get: 196 http://deb.debian.org/debian trixie/main armhf libio-pty-perl armhf 1:1.20-1 [33.7 kB] Get: 197 http://deb.debian.org/debian trixie/main armhf libipc-run-perl all 20231003.0-1 [102 kB] Get: 198 http://deb.debian.org/debian trixie/main armhf libclass-method-modifiers-perl all 2.15-1 [18.0 kB] Get: 199 http://deb.debian.org/debian trixie/main armhf libclass-xsaccessor-perl armhf 1.19-4+b2 [35.3 kB] Get: 200 http://deb.debian.org/debian trixie/main armhf libb-hooks-op-check-perl armhf 0.22-2+b2 [10.3 kB] Get: 201 http://deb.debian.org/debian trixie/main armhf libdynaloader-functions-perl all 0.003-3 [12.7 kB] Get: 202 http://deb.debian.org/debian trixie/main armhf libdevel-callchecker-perl armhf 0.008-2+b1 [14.9 kB] Get: 203 http://deb.debian.org/debian trixie/main armhf libparams-classify-perl armhf 0.015-2+b2 [21.3 kB] Get: 204 http://deb.debian.org/debian trixie/main armhf libmodule-runtime-perl all 0.016-2 [19.6 kB] Get: 205 http://deb.debian.org/debian trixie/main armhf libimport-into-perl all 1.002005-2 [11.3 kB] Get: 206 http://deb.debian.org/debian trixie/main armhf librole-tiny-perl all 2.002004-1 [21.4 kB] Get: 207 http://deb.debian.org/debian trixie/main armhf libsub-quote-perl all 2.006008-1 [21.8 kB] Get: 208 http://deb.debian.org/debian trixie/main armhf libmoo-perl all 2.005005-1 [58.0 kB] Get: 209 http://deb.debian.org/debian trixie/main armhf libencode-locale-perl all 1.05-3 [12.9 kB] Get: 210 http://deb.debian.org/debian trixie/main armhf libtimedate-perl all 2.3300-2 [39.3 kB] Get: 211 http://deb.debian.org/debian trixie/main armhf libhttp-date-perl all 6.06-1 [10.7 kB] Get: 212 http://deb.debian.org/debian trixie/main armhf libfile-listing-perl all 6.16-1 [12.4 kB] Get: 213 http://deb.debian.org/debian trixie/main armhf libhtml-tagset-perl all 3.24-1 [14.7 kB] Get: 214 http://deb.debian.org/debian trixie/main armhf liburi-perl all 5.27-1 [98.4 kB] Get: 215 http://deb.debian.org/debian trixie/main armhf libhtml-parser-perl armhf 3.81-1+b1 [95.8 kB] Get: 216 http://deb.debian.org/debian trixie/main armhf libhtml-tree-perl all 5.07-3 [211 kB] Get: 217 http://deb.debian.org/debian trixie/main armhf libclone-perl armhf 0.46-1+b1 [13.2 kB] Get: 218 http://deb.debian.org/debian trixie/main armhf libio-html-perl all 1.004-3 [16.2 kB] Get: 219 http://deb.debian.org/debian trixie/main armhf liblwp-mediatypes-perl all 6.04-2 [20.2 kB] Get: 220 http://deb.debian.org/debian trixie/main armhf libhttp-message-perl all 6.45-1 [82.0 kB] Get: 221 http://deb.debian.org/debian trixie/main armhf libhttp-cookies-perl all 6.11-1 [19.1 kB] Get: 222 http://deb.debian.org/debian trixie/main armhf libhttp-negotiate-perl all 6.01-2 [13.1 kB] Get: 223 http://deb.debian.org/debian trixie/main armhf perl-openssl-defaults armhf 7+b1 [7916 B] Get: 224 http://deb.debian.org/debian trixie/main armhf libnet-ssleay-perl armhf 1.94-1 [318 kB] Get: 225 http://deb.debian.org/debian trixie/main armhf libio-socket-ssl-perl all 2.085-1 [218 kB] Get: 226 http://deb.debian.org/debian trixie/main armhf libnet-http-perl all 6.23-1 [23.9 kB] Get: 227 http://deb.debian.org/debian trixie/main armhf liblwp-protocol-https-perl all 6.14-1 [10.8 kB] Get: 228 http://deb.debian.org/debian trixie/main armhf libtry-tiny-perl all 0.31-2 [22.6 kB] Get: 229 http://deb.debian.org/debian trixie/main armhf libwww-robotrules-perl all 6.02-1 [12.9 kB] Get: 230 http://deb.debian.org/debian trixie/main armhf libwww-perl all 6.77-1 [183 kB] Get: 231 http://deb.debian.org/debian trixie/main armhf patchutils armhf 0.4.2-1 [72.5 kB] Get: 232 http://deb.debian.org/debian trixie/main armhf wdiff armhf 1.2.2-6 [118 kB] Get: 233 http://deb.debian.org/debian trixie/main armhf devscripts all 2.23.7 [1068 kB] Get: 234 http://deb.debian.org/debian trixie/main armhf fastjar armhf 2:0.98-7 [43.9 kB] Get: 235 http://deb.debian.org/debian trixie/main armhf ivy all 2.5.2-1 [1295 kB] Get: 236 http://deb.debian.org/debian trixie/main armhf libasm-java all 9.5-1 [387 kB] Get: 237 http://deb.debian.org/debian trixie/main armhf libbsf-java all 1:2.4.0-8 [76.3 kB] Get: 238 http://deb.debian.org/debian trixie/main armhf libcommons-cli-java all 1.6.0-1 [60.4 kB] Get: 239 http://deb.debian.org/debian trixie/main armhf libapache-pom-java all 29-2 [5276 B] Get: 240 http://deb.debian.org/debian trixie/main armhf libcommons-parent-java all 56-1 [10.8 kB] Get: 241 http://deb.debian.org/debian trixie/main armhf libcommons-logging-java all 1.3.0-1 [68.6 kB] Get: 242 http://deb.debian.org/debian trixie/main armhf libjansi-java all 2.4.1-2 [100 kB] Get: 243 http://deb.debian.org/debian trixie/main armhf libjsp-api-java all 2.3.4-3 [53.7 kB] Get: 244 http://deb.debian.org/debian trixie/main armhf libqdox-java all 1.12.1-3 [172 kB] Get: 245 http://deb.debian.org/debian trixie/main armhf libservlet-api-java all 4.0.1-2 [81.0 kB] Get: 246 http://deb.debian.org/debian trixie/main armhf libxpp3-java all 1.1.4c-3 [292 kB] Get: 247 http://deb.debian.org/debian trixie/main armhf libxstream-java all 1.4.20-1 [565 kB] Get: 248 http://deb.debian.org/debian trixie/main armhf groovy all 2.4.21-10 [12.8 MB] Get: 249 http://deb.debian.org/debian trixie/main armhf libatinject-jsr330-api-java all 1.0+ds1-5 [5312 B] Get: 250 http://deb.debian.org/debian trixie/main armhf libcommons-collections3-java all 3.2.2-3 [530 kB] Get: 251 http://deb.debian.org/debian trixie/main armhf libcommons-compress-java all 1.25.0-1 [635 kB] Get: 252 http://deb.debian.org/debian trixie/main armhf libcommons-io-java all 2.11.0-2 [319 kB] Get: 253 http://deb.debian.org/debian trixie/main armhf libcommons-lang-java all 2.6-10 [273 kB] Get: 254 http://deb.debian.org/debian trixie/main armhf liberror-prone-java all 2.18.0-1 [22.5 kB] Get: 255 http://deb.debian.org/debian trixie/main armhf libjsr305-java all 0.1~+svn49-11 [26.9 kB] Get: 256 http://deb.debian.org/debian trixie/main armhf libguava-java all 32.0.1-1 [2708 kB] Get: 257 http://deb.debian.org/debian trixie/main armhf libcommons-codec-java all 1.16.0-1 [297 kB] Get: 258 http://deb.debian.org/debian trixie/main armhf libhttpcore-java all 4.4.16-1 [636 kB] Get: 259 http://deb.debian.org/debian trixie/main armhf libhttpclient-java all 4.5.14-1 [1247 kB] Get: 260 http://deb.debian.org/debian trixie/main armhf libjarjar-java all 1.4+svn142-12 [205 kB] Get: 261 http://deb.debian.org/debian trixie/main armhf libjcip-annotations-java all 20060626-6 [11.8 kB] Get: 262 http://deb.debian.org/debian trixie/main armhf libjna-jni armhf 5.14.0-1 [60.1 kB] Get: 263 http://deb.debian.org/debian trixie/main armhf libjna-java all 5.14.0-1 [237 kB] Get: 264 http://deb.debian.org/debian trixie/main armhf libjzlib-java all 1.1.3-3 [79.4 kB] Get: 265 http://deb.debian.org/debian trixie/main armhf libjsch-java all 0.1.55-1 [298 kB] Get: 266 http://deb.debian.org/debian trixie/main armhf libminlog-java all 1.3.0-1.1 [7928 B] Get: 267 http://deb.debian.org/debian trixie/main armhf libobjenesis-java all 3.3-3 [41.3 kB] Get: 268 http://deb.debian.org/debian trixie/main armhf libreflectasm-java all 1.11.9+dfsg-4 [25.0 kB] Get: 269 http://deb.debian.org/debian trixie/main armhf libkryo-java all 2.20-7 [158 kB] Get: 270 http://deb.debian.org/debian trixie/main armhf liblogback-java all 1:1.2.11-5 [701 kB] Get: 271 http://deb.debian.org/debian trixie/main armhf libnative-platform-jni armhf 0.14-6 [10.2 kB] Get: 272 http://deb.debian.org/debian trixie/main armhf libnative-platform-java all 0.14-6 [69.8 kB] Get: 273 http://deb.debian.org/debian trixie/main armhf libxml-commons-external-java all 1.4.01-6 [240 kB] Get: 274 http://deb.debian.org/debian trixie/main armhf libxml-commons-resolver1.1-java all 1.2-11 [98.3 kB] Get: 275 http://deb.debian.org/debian trixie/main armhf libxerces2-java all 2.12.2-1 [1440 kB] Get: 276 http://deb.debian.org/debian trixie/main armhf libnekohtml-java all 1.9.22.noko2-0.1 [125 kB] Get: 277 http://deb.debian.org/debian trixie/main armhf libxbean-reflect-java all 4.5-8 [133 kB] Get: 278 http://deb.debian.org/debian trixie/main armhf libgradle-core-java all 4.4.1-20 [4293 kB] Get: 279 http://deb.debian.org/debian trixie/main armhf libbcprov-java all 1.77-1 [5300 kB] Get: 280 http://deb.debian.org/debian trixie/main armhf libbcpg-java all 1.77-1 [428 kB] Get: 281 http://deb.debian.org/debian trixie/main armhf libbsh-java all 2.0b4-20 [291 kB] Get: 282 http://deb.debian.org/debian trixie/main armhf libdd-plist-java all 1.20-1.1 [72.6 kB] Get: 283 http://deb.debian.org/debian trixie/main armhf libjaxen-java all 1.1.6-4 [214 kB] Get: 284 http://deb.debian.org/debian trixie/main armhf libdom4j-java all 2.1.4-1 [312 kB] Get: 285 http://deb.debian.org/debian trixie/main armhf libbcel-java all 6.5.0-2 [634 kB] Get: 286 http://deb.debian.org/debian trixie/main armhf libjformatstring-java all 0.10~20131207-2.1 [34.5 kB] Get: 287 http://deb.debian.org/debian trixie/main armhf libfindbugs-java all 3.1.0~preview2-3 [3502 kB] Get: 288 http://deb.debian.org/debian trixie/main armhf libgoogle-gson-java all 2.10.1-1 [262 kB] Get: 289 http://deb.debian.org/debian trixie/main armhf libaopalliance-java all 20070526-7 [8572 B] Get: 290 http://deb.debian.org/debian trixie/main armhf libguice-java all 4.2.3-2 [1435 kB] Get: 291 http://deb.debian.org/debian trixie/main armhf libjatl-java all 0.2.3-1.1 [29.0 kB] Get: 292 http://deb.debian.org/debian trixie/main armhf libjcifs-java all 1.3.19-2 [394 kB] Get: 293 http://deb.debian.org/debian trixie/main armhf libeclipse-jdt-annotation-java all 2.2.700+eclipse4.26-2 [25.3 kB] Get: 294 http://deb.debian.org/debian trixie/main armhf libjavaewah-java all 1.2.3-1 [159 kB] Get: 295 http://deb.debian.org/debian trixie/main armhf libel-api-java all 3.0.0-3 [64.9 kB] Get: 296 http://deb.debian.org/debian trixie/main armhf libwebsocket-api-java all 1.1-2 [40.1 kB] Get: 297 http://deb.debian.org/debian trixie/main armhf libjetty9-java all 9.4.53-1 [2982 kB] Get: 298 http://deb.debian.org/debian trixie/main armhf libjgit-java all 4.11.9-2 [2534 kB] Get: 299 http://deb.debian.org/debian trixie/main armhf libjs-jquery all 3.6.1+dfsg+~3.5.14-1 [326 kB] Get: 300 http://deb.debian.org/debian trixie/main armhf libcommons-lang3-java all 3.14.0-1 [621 kB] Get: 301 http://deb.debian.org/debian trixie/main armhf libplexus-utils2-java all 3.4.2-1 [258 kB] Get: 302 http://deb.debian.org/debian trixie/main armhf libwagon-provider-api-java all 3.5.3-1 [48.2 kB] Get: 303 http://deb.debian.org/debian trixie/main armhf libmaven-resolver-java all 1.6.3-1 [548 kB] Get: 304 http://deb.debian.org/debian trixie/main armhf libgeronimo-annotation-1.3-spec-java all 1.3-1 [11.1 kB] Get: 305 http://deb.debian.org/debian trixie/main armhf libmaven-parent-java all 35-1 [6140 B] Get: 306 http://deb.debian.org/debian trixie/main armhf libmaven-shared-utils-java all 3.3.4-1 [138 kB] Get: 307 http://deb.debian.org/debian trixie/main armhf libplexus-cipher-java all 2.0-1 [14.9 kB] Get: 308 http://deb.debian.org/debian trixie/main armhf libplexus-classworlds-java all 2.7.0-1 [50.6 kB] Get: 309 http://deb.debian.org/debian trixie/main armhf libplexus-component-annotations-java all 2.1.1-1 [7660 B] Get: 310 http://deb.debian.org/debian trixie/main armhf libplexus-interpolation-java all 1.26-1 [76.8 kB] Get: 311 http://deb.debian.org/debian trixie/main armhf libplexus-sec-dispatcher-java all 2.0-3 [28.3 kB] Get: 312 http://deb.debian.org/debian trixie/main armhf libgeronimo-interceptor-3.0-spec-java all 1.0.1-4 [8484 B] Get: 313 http://deb.debian.org/debian trixie/main armhf libcdi-api-java all 1.2-3 [54.3 kB] Get: 314 http://deb.debian.org/debian trixie/main armhf libsisu-inject-java all 0.3.4-2 [347 kB] Get: 315 http://deb.debian.org/debian trixie/main armhf libsisu-plexus-java all 0.3.4-3 [181 kB] Get: 316 http://deb.debian.org/debian trixie/main armhf libmaven3-core-java all 3.8.7-2 [1573 kB] Get: 317 http://deb.debian.org/debian trixie/main armhf libplexus-container-default-java all 2.1.1-1 [193 kB] Get: 318 http://deb.debian.org/debian trixie/main armhf libpolyglot-maven-java all 0.8~tobrien+git20120905-10 [74.9 kB] Get: 319 http://deb.debian.org/debian trixie/main armhf librhino-java all 1.7.14-2.1 [1357 kB] Get: 320 http://deb.debian.org/debian trixie/main armhf libsimple-http-java all 4.1.21-1.1 [211 kB] Get: 321 http://deb.debian.org/debian trixie/main armhf libwagon-file-java all 3.5.3-1 [8388 B] Get: 322 http://deb.debian.org/debian trixie/main armhf libjsoup-java all 1.15.3-1 [431 kB] Get: 323 http://deb.debian.org/debian trixie/main armhf libwagon-http-java all 3.5.3-1 [49.5 kB] Get: 324 http://deb.debian.org/debian trixie/main armhf libjcommander-java all 1.71-4 [73.0 kB] Get: 325 http://deb.debian.org/debian trixie/main armhf testng all 6.9.12-4 [795 kB] Get: 326 http://deb.debian.org/debian trixie/main armhf libgradle-plugins-java all 4.4.1-20 [5206 kB] Get: 327 http://deb.debian.org/debian trixie/main armhf gradle all 4.4.1-20 [398 kB] Get: 328 http://deb.debian.org/debian trixie/main armhf maven-repo-helper all 1.11 [142 kB] Get: 329 http://deb.debian.org/debian trixie/main armhf gradle-debian-helper all 2.4 [24.5 kB] Get: 330 http://deb.debian.org/debian trixie/main armhf jarwrapper all 0.79 [10.1 kB] Get: 331 http://deb.debian.org/debian trixie/main armhf javahelper all 0.79 [84.6 kB] Get: 332 http://deb.debian.org/debian trixie/main armhf libbyte-buddy-java all 1.12.23-1 [4471 kB] Get: 333 http://deb.debian.org/debian trixie/main armhf libcommons-math3-java all 3.6.1-3 [2018 kB] Get: 334 http://deb.debian.org/debian trixie/main armhf libjackson2-annotations-java all 2.14.0-1 [68.8 kB] Get: 335 http://deb.debian.org/debian trixie/main armhf libjackson2-core-java all 2.14.1-1 [447 kB] Get: 336 http://deb.debian.org/debian trixie/main armhf libjackson2-databind-java all 2.14.0-1 [1584 kB] Get: 337 http://deb.debian.org/debian trixie/main armhf liblz4-jni armhf 1.8.0-4 [9672 B] Get: 338 http://deb.debian.org/debian trixie/main armhf liblz4-java all 1.8.0-4 [116 kB] Get: 339 http://deb.debian.org/debian trixie/main armhf libmockito-java all 2.23.0-2 [479 kB] Get: 340 http://deb.debian.org/debian trixie/main armhf libredberry-pipe-java all 1.0.0~alpha0-3 [62.7 kB] Get: 341 http://deb.debian.org/debian trixie/main armhf libtrove3-java all 3.0.3-5 [2146 kB] Fetched 291 MB in 10s (29.4 MB/s) debconf: delaying package configuration, since apt-utils is not installed Selecting previously unselected package libpipeline1:armhf. (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 19577 files and directories currently installed.) Preparing to unpack .../libpipeline1_1.5.7-1+b2_armhf.deb ... Unpacking libpipeline1:armhf (1.5.7-1+b2) ... Selecting previously unselected package binfmt-support. Preparing to unpack .../binfmt-support_2.2.2-6_armhf.deb ... Unpacking binfmt-support (2.2.2-6) ... Selecting previously unselected package libpython3.11-minimal:armhf. Preparing to unpack .../libpython3.11-minimal_3.11.8-1_armhf.deb ... Unpacking libpython3.11-minimal:armhf (3.11.8-1) ... Selecting previously unselected package libexpat1:armhf. Preparing to unpack .../libexpat1_2.5.0-2+b2_armhf.deb ... Unpacking libexpat1:armhf (2.5.0-2+b2) ... Selecting previously unselected package python3.11-minimal. Preparing to unpack .../python3.11-minimal_3.11.8-1_armhf.deb ... Unpacking python3.11-minimal (3.11.8-1) ... Setting up libpython3.11-minimal:armhf (3.11.8-1) ... Setting up libexpat1:armhf (2.5.0-2+b2) ... Setting up python3.11-minimal (3.11.8-1) ... Selecting previously unselected package python3-minimal. (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 19918 files and directories currently installed.) Preparing to unpack .../0-python3-minimal_3.11.6-1_armhf.deb ... Unpacking python3-minimal (3.11.6-1) ... Selecting previously unselected package media-types. Preparing to unpack .../1-media-types_10.1.0_all.deb ... Unpacking media-types (10.1.0) ... Selecting previously unselected package netbase. Preparing to unpack .../2-netbase_6.4_all.deb ... Unpacking netbase (6.4) ... Selecting previously unselected package tzdata. Preparing to unpack .../3-tzdata_2024a-1_all.deb ... Unpacking tzdata (2024a-1) ... Selecting previously unselected package readline-common. Preparing to unpack .../4-readline-common_8.2-3_all.deb ... Unpacking readline-common (8.2-3) ... Selecting previously unselected package libreadline8:armhf. Preparing to unpack .../5-libreadline8_8.2-3+b1_armhf.deb ... Unpacking libreadline8:armhf (8.2-3+b1) ... Selecting previously unselected package libpython3.11-stdlib:armhf. Preparing to unpack .../6-libpython3.11-stdlib_3.11.8-1_armhf.deb ... Unpacking libpython3.11-stdlib:armhf (3.11.8-1) ... Selecting previously unselected package python3.11. Preparing to unpack .../7-python3.11_3.11.8-1_armhf.deb ... Unpacking python3.11 (3.11.8-1) ... Selecting previously unselected package libpython3-stdlib:armhf. Preparing to unpack .../8-libpython3-stdlib_3.11.6-1_armhf.deb ... Unpacking libpython3-stdlib:armhf (3.11.6-1) ... Setting up python3-minimal (3.11.6-1) ... Selecting previously unselected package python3. (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 20906 files and directories currently installed.) Preparing to unpack .../000-python3_3.11.6-1_armhf.deb ... Unpacking python3 (3.11.6-1) ... Selecting previously unselected package sensible-utils. Preparing to unpack .../001-sensible-utils_0.0.22_all.deb ... Unpacking sensible-utils (0.0.22) ... Selecting previously unselected package openssl. Preparing to unpack .../002-openssl_3.1.5-1_armhf.deb ... Unpacking openssl (3.1.5-1) ... Selecting previously unselected package ca-certificates. Preparing to unpack .../003-ca-certificates_20240203_all.deb ... Unpacking ca-certificates (20240203) ... Selecting previously unselected package libmagic-mgc. Preparing to unpack .../004-libmagic-mgc_1%3a5.45-2+b1_armhf.deb ... Unpacking libmagic-mgc (1:5.45-2+b1) ... Selecting previously unselected package libmagic1:armhf. Preparing to unpack .../005-libmagic1_1%3a5.45-2+b1_armhf.deb ... Unpacking libmagic1:armhf (1:5.45-2+b1) ... Selecting previously unselected package file. Preparing to unpack .../006-file_1%3a5.45-2+b1_armhf.deb ... Unpacking file (1:5.45-2+b1) ... Selecting previously unselected package gettext-base. Preparing to unpack .../007-gettext-base_0.21-14+b1_armhf.deb ... Unpacking gettext-base (0.21-14+b1) ... Selecting previously unselected package libuchardet0:armhf. Preparing to unpack .../008-libuchardet0_0.0.8-1+b1_armhf.deb ... Unpacking libuchardet0:armhf (0.0.8-1+b1) ... Selecting previously unselected package groff-base. Preparing to unpack .../009-groff-base_1.23.0-3_armhf.deb ... Unpacking groff-base (1.23.0-3) ... Selecting previously unselected package bsdextrautils. Preparing to unpack .../010-bsdextrautils_2.39.3-6_armhf.deb ... Unpacking bsdextrautils (2.39.3-6) ... Selecting previously unselected package man-db. Preparing to unpack .../011-man-db_2.12.0-3_armhf.deb ... Unpacking man-db (2.12.0-3) ... Selecting previously unselected package libgdk-pixbuf2.0-common. Preparing to unpack .../012-libgdk-pixbuf2.0-common_2.42.10+dfsg-3_all.deb ... Unpacking libgdk-pixbuf2.0-common (2.42.10+dfsg-3) ... Selecting previously unselected package libglib2.0-0:armhf. Preparing to unpack .../013-libglib2.0-0_2.78.4-1_armhf.deb ... Unpacking libglib2.0-0:armhf (2.78.4-1) ... Selecting previously unselected package libicu72:armhf. Preparing to unpack .../014-libicu72_72.1-4+b1_armhf.deb ... Unpacking libicu72:armhf (72.1-4+b1) ... Selecting previously unselected package libxml2:armhf. Preparing to unpack .../015-libxml2_2.9.14+dfsg-1.3+b2_armhf.deb ... Unpacking libxml2:armhf (2.9.14+dfsg-1.3+b2) ... Selecting previously unselected package shared-mime-info. Preparing to unpack .../016-shared-mime-info_2.4-1_armhf.deb ... Unpacking shared-mime-info (2.4-1) ... Selecting previously unselected package libjpeg62-turbo:armhf. Preparing to unpack .../017-libjpeg62-turbo_1%3a2.1.5-2+b2_armhf.deb ... Unpacking libjpeg62-turbo:armhf (1:2.1.5-2+b2) ... Selecting previously unselected package libpng16-16:armhf. Preparing to unpack .../018-libpng16-16_1.6.43-1_armhf.deb ... Unpacking libpng16-16:armhf (1.6.43-1) ... Selecting previously unselected package libdeflate0:armhf. Preparing to unpack .../019-libdeflate0_1.19-1_armhf.deb ... Unpacking libdeflate0:armhf (1.19-1) ... Selecting previously unselected package libjbig0:armhf. Preparing to unpack .../020-libjbig0_2.1-6.1+b1_armhf.deb ... Unpacking libjbig0:armhf (2.1-6.1+b1) ... Selecting previously unselected package liblerc4:armhf. Preparing to unpack .../021-liblerc4_4.0.0+ds-4+b1_armhf.deb ... Unpacking liblerc4:armhf (4.0.0+ds-4+b1) ... Selecting previously unselected package libsharpyuv0:armhf. Preparing to unpack .../022-libsharpyuv0_1.3.2-0.4_armhf.deb ... Unpacking libsharpyuv0:armhf (1.3.2-0.4) ... Selecting previously unselected package libwebp7:armhf. Preparing to unpack .../023-libwebp7_1.3.2-0.4_armhf.deb ... Unpacking libwebp7:armhf (1.3.2-0.4) ... Selecting previously unselected package libtiff6:armhf. Preparing to unpack .../024-libtiff6_4.5.1+git230720-4_armhf.deb ... Unpacking libtiff6:armhf (4.5.1+git230720-4) ... Selecting previously unselected package libgdk-pixbuf-2.0-0:armhf. Preparing to unpack .../025-libgdk-pixbuf-2.0-0_2.42.10+dfsg-3+b1_armhf.deb ... Unpacking libgdk-pixbuf-2.0-0:armhf (2.42.10+dfsg-3+b1) ... Selecting previously unselected package gtk-update-icon-cache. Preparing to unpack .../026-gtk-update-icon-cache_3.24.41-1_armhf.deb ... Unpacking gtk-update-icon-cache (3.24.41-1) ... Selecting previously unselected package hicolor-icon-theme. Preparing to unpack .../027-hicolor-icon-theme_0.17-2_all.deb ... Unpacking hicolor-icon-theme (0.17-2) ... Selecting previously unselected package adwaita-icon-theme. Preparing to unpack .../028-adwaita-icon-theme_46.0-1_all.deb ... Unpacking adwaita-icon-theme (46.0-1) ... Selecting previously unselected package ca-certificates-java. Preparing to unpack .../029-ca-certificates-java_20240118_all.deb ... Unpacking ca-certificates-java (20240118) ... Selecting previously unselected package java-common. Preparing to unpack .../030-java-common_0.75_all.deb ... Unpacking java-common (0.75) ... Selecting previously unselected package libavahi-common-data:armhf. Preparing to unpack .../031-libavahi-common-data_0.8-13+b1_armhf.deb ... Unpacking libavahi-common-data:armhf (0.8-13+b1) ... Selecting previously unselected package libavahi-common3:armhf. Preparing to unpack .../032-libavahi-common3_0.8-13+b1_armhf.deb ... Unpacking libavahi-common3:armhf (0.8-13+b1) ... Selecting previously unselected package libdbus-1-3:armhf. Preparing to unpack .../033-libdbus-1-3_1.14.10-4_armhf.deb ... Unpacking libdbus-1-3:armhf (1.14.10-4) ... Selecting previously unselected package libavahi-client3:armhf. Preparing to unpack .../034-libavahi-client3_0.8-13+b1_armhf.deb ... Unpacking libavahi-client3:armhf (0.8-13+b1) ... Selecting previously unselected package libcups2:armhf. Preparing to unpack .../035-libcups2_2.4.7-1+b1_armhf.deb ... Unpacking libcups2:armhf (2.4.7-1+b1) ... Selecting previously unselected package liblcms2-2:armhf. Preparing to unpack .../036-liblcms2-2_2.14-2+b1_armhf.deb ... Unpacking liblcms2-2:armhf (2.14-2+b1) ... Selecting previously unselected package libbrotli1:armhf. Preparing to unpack .../037-libbrotli1_1.1.0-2+b3_armhf.deb ... Unpacking libbrotli1:armhf (1.1.0-2+b3) ... Selecting previously unselected package libfreetype6:armhf. Preparing to unpack .../038-libfreetype6_2.13.2+dfsg-1+b1_armhf.deb ... Unpacking libfreetype6:armhf (2.13.2+dfsg-1+b1) ... Selecting previously unselected package fonts-dejavu-mono. Preparing to unpack .../039-fonts-dejavu-mono_2.37-8_all.deb ... Unpacking fonts-dejavu-mono (2.37-8) ... Selecting previously unselected package fonts-dejavu-core. Preparing to unpack .../040-fonts-dejavu-core_2.37-8_all.deb ... Unpacking fonts-dejavu-core (2.37-8) ... Selecting previously unselected package fontconfig-config. Preparing to unpack .../041-fontconfig-config_2.15.0-1.1_armhf.deb ... Unpacking fontconfig-config (2.15.0-1.1) ... Selecting previously unselected package libfontconfig1:armhf. Preparing to unpack .../042-libfontconfig1_2.15.0-1.1_armhf.deb ... Unpacking libfontconfig1:armhf (2.15.0-1.1) ... Selecting previously unselected package libnspr4:armhf. Preparing to unpack .../043-libnspr4_2%3a4.35-1.1+b1_armhf.deb ... Unpacking libnspr4:armhf (2:4.35-1.1+b1) ... Selecting previously unselected package libnss3:armhf. Preparing to unpack .../044-libnss3_2%3a3.99-1_armhf.deb ... Unpacking libnss3:armhf (2:3.99-1) ... Selecting previously unselected package libasound2-data. Preparing to unpack .../045-libasound2-data_1.2.10-3_all.deb ... Unpacking libasound2-data (1.2.10-3) ... Selecting previously unselected package libasound2:armhf. Preparing to unpack .../046-libasound2_1.2.10-3_armhf.deb ... Unpacking libasound2:armhf (1.2.10-3) ... Selecting previously unselected package libgraphite2-3:armhf. Preparing to unpack .../047-libgraphite2-3_1.3.14-2_armhf.deb ... Unpacking libgraphite2-3:armhf (1.3.14-2) ... Selecting previously unselected package libharfbuzz0b:armhf. Preparing to unpack .../048-libharfbuzz0b_8.3.0-2_armhf.deb ... Unpacking libharfbuzz0b:armhf (8.3.0-2) ... Selecting previously unselected package libpcsclite1:armhf. Preparing to unpack .../049-libpcsclite1_2.0.1-1+b1_armhf.deb ... Unpacking libpcsclite1:armhf (2.0.1-1+b1) ... Selecting previously unselected package openjdk-17-jre-headless:armhf. Preparing to unpack .../050-openjdk-17-jre-headless_17.0.10+7-1_armhf.deb ... Unpacking openjdk-17-jre-headless:armhf (17.0.10+7-1) ... Selecting previously unselected package default-jre-headless. Preparing to unpack .../051-default-jre-headless_2%3a1.17-75_armhf.deb ... Unpacking default-jre-headless (2:1.17-75) ... Selecting previously unselected package ant. Preparing to unpack .../052-ant_1.10.14-1_all.deb ... Unpacking ant (1.10.14-1) ... Selecting previously unselected package ant-optional. Preparing to unpack .../053-ant-optional_1.10.14-1_all.deb ... Unpacking ant-optional (1.10.14-1) ... Selecting previously unselected package libantlr-java. Preparing to unpack .../054-libantlr-java_2.7.7+dfsg-13_all.deb ... Unpacking libantlr-java (2.7.7+dfsg-13) ... Selecting previously unselected package antlr. Preparing to unpack .../055-antlr_2.7.7+dfsg-13_all.deb ... Unpacking antlr (2.7.7+dfsg-13) ... Selecting previously unselected package at-spi2-common. Preparing to unpack .../056-at-spi2-common_2.50.0-1_all.deb ... Unpacking at-spi2-common (2.50.0-1) ... Selecting previously unselected package m4. Preparing to unpack .../057-m4_1.4.19-4_armhf.deb ... Unpacking m4 (1.4.19-4) ... Selecting previously unselected package autoconf. Preparing to unpack .../058-autoconf_2.71-3_all.deb ... Unpacking autoconf (2.71-3) ... Selecting previously unselected package autotools-dev. Preparing to unpack .../059-autotools-dev_20220109.1_all.deb ... Unpacking autotools-dev (20220109.1) ... Selecting previously unselected package automake. Preparing to unpack .../060-automake_1%3a1.16.5-1.3_all.deb ... Unpacking automake (1:1.16.5-1.3) ... Selecting previously unselected package autopoint. Preparing to unpack .../061-autopoint_0.21-14_all.deb ... Unpacking autopoint (0.21-14) ... Selecting previously unselected package unzip. Preparing to unpack .../062-unzip_6.0-28_armhf.deb ... Unpacking unzip (6.0-28) ... Selecting previously unselected package java-wrappers. Preparing to unpack .../063-java-wrappers_0.4_all.deb ... Unpacking java-wrappers (0.4) ... Selecting previously unselected package libhamcrest-java. Preparing to unpack .../064-libhamcrest-java_2.2-2_all.deb ... Unpacking libhamcrest-java (2.2-2) ... Selecting previously unselected package junit4. Preparing to unpack .../065-junit4_4.13.2-4_all.deb ... Unpacking junit4 (4.13.2-4) ... Selecting previously unselected package libfelix-framework-java. Preparing to unpack .../066-libfelix-framework-java_4.6.1-2.1_all.deb ... Unpacking libfelix-framework-java (4.6.1-2.1) ... Selecting previously unselected package libfelix-gogo-runtime-java. Preparing to unpack .../067-libfelix-gogo-runtime-java_0.16.2-1.1_all.deb ... Unpacking libfelix-gogo-runtime-java (0.16.2-1.1) ... Selecting previously unselected package libosgi-annotation-java. Preparing to unpack .../068-libosgi-annotation-java_8.1.0-1_all.deb ... Unpacking libosgi-annotation-java (8.1.0-1) ... Selecting previously unselected package libosgi-core-java. Preparing to unpack .../069-libosgi-core-java_8.0.0-2_all.deb ... Unpacking libosgi-core-java (8.0.0-2) ... Selecting previously unselected package libfelix-resolver-java. Preparing to unpack .../070-libfelix-resolver-java_1.16.0-1_all.deb ... Unpacking libfelix-resolver-java (1.16.0-1) ... Selecting previously unselected package libhawtjni-runtime-java. Preparing to unpack .../071-libhawtjni-runtime-java_1.18-1_all.deb ... Unpacking libhawtjni-runtime-java (1.18-1) ... Selecting previously unselected package libjansi-native-java. Preparing to unpack .../072-libjansi-native-java_1.8-2_all.deb ... Unpacking libjansi-native-java (1.8-2) ... Selecting previously unselected package libjansi1-java. Preparing to unpack .../073-libjansi1-java_1.18-3_all.deb ... Unpacking libjansi1-java (1.18-3) ... Selecting previously unselected package libjline2-java. Preparing to unpack .../074-libjline2-java_2.14.6-5_all.deb ... Unpacking libjline2-java (2.14.6-5) ... Selecting previously unselected package libosgi-compendium-java. Preparing to unpack .../075-libosgi-compendium-java_7.0.0-1_all.deb ... Unpacking libosgi-compendium-java (7.0.0-1) ... Selecting previously unselected package libslf4j-java. Preparing to unpack .../076-libslf4j-java_1.7.32-1_all.deb ... Unpacking libslf4j-java (1.7.32-1) ... Selecting previously unselected package libxz-java. Preparing to unpack .../077-libxz-java_1.9-1_all.deb ... Unpacking libxz-java (1.9-1) ... Selecting previously unselected package libyaml-snake-java. Preparing to unpack .../078-libyaml-snake-java_1.33-2_all.deb ... Unpacking libyaml-snake-java (1.33-2) ... Selecting previously unselected package bnd. Preparing to unpack .../079-bnd_5.0.1-5_all.deb ... Unpacking bnd (5.0.1-5) ... Selecting previously unselected package dctrl-tools. Preparing to unpack .../080-dctrl-tools_2.24-3_armhf.deb ... Unpacking dctrl-tools (2.24-3) ... Selecting previously unselected package libdebhelper-perl. Preparing to unpack .../081-libdebhelper-perl_13.14.1_all.deb ... Unpacking libdebhelper-perl (13.14.1) ... Selecting previously unselected package libtool. Preparing to unpack .../082-libtool_2.4.7-7_all.deb ... Unpacking libtool (2.4.7-7) ... Selecting previously unselected package dh-autoreconf. Preparing to unpack .../083-dh-autoreconf_20_all.deb ... Unpacking dh-autoreconf (20) ... Selecting previously unselected package libarchive-zip-perl. Preparing to unpack .../084-libarchive-zip-perl_1.68-1_all.deb ... Unpacking libarchive-zip-perl (1.68-1) ... Selecting previously unselected package libsub-override-perl. Preparing to unpack .../085-libsub-override-perl_0.10-1_all.deb ... Unpacking libsub-override-perl (0.10-1) ... Selecting previously unselected package libfile-stripnondeterminism-perl. Preparing to unpack .../086-libfile-stripnondeterminism-perl_1.13.1-1_all.deb ... Unpacking libfile-stripnondeterminism-perl (1.13.1-1) ... Selecting previously unselected package dh-strip-nondeterminism. Preparing to unpack .../087-dh-strip-nondeterminism_1.13.1-1_all.deb ... Unpacking dh-strip-nondeterminism (1.13.1-1) ... Selecting previously unselected package libelf1:armhf. Preparing to unpack .../088-libelf1_0.190-1+b1_armhf.deb ... Unpacking libelf1:armhf (0.190-1+b1) ... Selecting previously unselected package dwz. Preparing to unpack .../089-dwz_0.15-1_armhf.deb ... Unpacking dwz (0.15-1) ... Selecting previously unselected package gettext. Preparing to unpack .../090-gettext_0.21-14+b1_armhf.deb ... Unpacking gettext (0.21-14+b1) ... Selecting previously unselected package intltool-debian. Preparing to unpack .../091-intltool-debian_0.35.0+20060710.6_all.deb ... Unpacking intltool-debian (0.35.0+20060710.6) ... Selecting previously unselected package po-debconf. Preparing to unpack .../092-po-debconf_1.0.21+nmu1_all.deb ... Unpacking po-debconf (1.0.21+nmu1) ... Selecting previously unselected package debhelper. Preparing to unpack .../093-debhelper_13.14.1_all.deb ... Unpacking debhelper (13.14.1) ... Selecting previously unselected package libgtk2.0-common. Preparing to unpack .../094-libgtk2.0-common_2.24.33-3_all.deb ... Unpacking libgtk2.0-common (2.24.33-3) ... Selecting previously unselected package libatk1.0-0:armhf. Preparing to unpack .../095-libatk1.0-0_2.50.0-1+b1_armhf.deb ... Unpacking libatk1.0-0:armhf (2.50.0-1+b1) ... Selecting previously unselected package libpixman-1-0:armhf. Preparing to unpack .../096-libpixman-1-0_0.42.2-1+b1_armhf.deb ... Unpacking libpixman-1-0:armhf (0.42.2-1+b1) ... Selecting previously unselected package libxau6:armhf. Preparing to unpack .../097-libxau6_1%3a1.0.9-1_armhf.deb ... Unpacking libxau6:armhf (1:1.0.9-1) ... Selecting previously unselected package libbsd0:armhf. Preparing to unpack .../098-libbsd0_0.12.2-1_armhf.deb ... Unpacking libbsd0:armhf (0.12.2-1) ... Selecting previously unselected package libxdmcp6:armhf. Preparing to unpack .../099-libxdmcp6_1%3a1.1.2-3_armhf.deb ... Unpacking libxdmcp6:armhf (1:1.1.2-3) ... Selecting previously unselected package libxcb1:armhf. Preparing to unpack .../100-libxcb1_1.15-1_armhf.deb ... Unpacking libxcb1:armhf (1.15-1) ... Selecting previously unselected package libx11-data. Preparing to unpack .../101-libx11-data_2%3a1.8.7-1_all.deb ... Unpacking libx11-data (2:1.8.7-1) ... Selecting previously unselected package libx11-6:armhf. Preparing to unpack .../102-libx11-6_2%3a1.8.7-1_armhf.deb ... Unpacking libx11-6:armhf (2:1.8.7-1) ... Selecting previously unselected package libxcb-render0:armhf. Preparing to unpack .../103-libxcb-render0_1.15-1_armhf.deb ... Unpacking libxcb-render0:armhf (1.15-1) ... Selecting previously unselected package libxcb-shm0:armhf. Preparing to unpack .../104-libxcb-shm0_1.15-1_armhf.deb ... Unpacking libxcb-shm0:armhf (1.15-1) ... Selecting previously unselected package libxext6:armhf. Preparing to unpack .../105-libxext6_2%3a1.3.4-1+b1_armhf.deb ... Unpacking libxext6:armhf (2:1.3.4-1+b1) ... Selecting previously unselected package libxrender1:armhf. Preparing to unpack .../106-libxrender1_1%3a0.9.10-1.1_armhf.deb ... Unpacking libxrender1:armhf (1:0.9.10-1.1) ... Selecting previously unselected package libcairo2:armhf. Preparing to unpack .../107-libcairo2_1.18.0-1+b1_armhf.deb ... Unpacking libcairo2:armhf (1.18.0-1+b1) ... Selecting previously unselected package fontconfig. Preparing to unpack .../108-fontconfig_2.15.0-1.1_armhf.deb ... Unpacking fontconfig (2.15.0-1.1) ... Selecting previously unselected package libfribidi0:armhf. Preparing to unpack .../109-libfribidi0_1.0.13-3+b1_armhf.deb ... Unpacking libfribidi0:armhf (1.0.13-3+b1) ... Selecting previously unselected package libthai-data. Preparing to unpack .../110-libthai-data_0.1.29-2_all.deb ... Unpacking libthai-data (0.1.29-2) ... Selecting previously unselected package libdatrie1:armhf. Preparing to unpack .../111-libdatrie1_0.2.13-3_armhf.deb ... Unpacking libdatrie1:armhf (0.2.13-3) ... Selecting previously unselected package libthai0:armhf. Preparing to unpack .../112-libthai0_0.1.29-2_armhf.deb ... Unpacking libthai0:armhf (0.1.29-2) ... Selecting previously unselected package libpango-1.0-0:armhf. Preparing to unpack .../113-libpango-1.0-0_1.52.0+ds-1_armhf.deb ... Unpacking libpango-1.0-0:armhf (1.52.0+ds-1) ... Selecting previously unselected package libpangoft2-1.0-0:armhf. Preparing to unpack .../114-libpangoft2-1.0-0_1.52.0+ds-1_armhf.deb ... Unpacking libpangoft2-1.0-0:armhf (1.52.0+ds-1) ... Selecting previously unselected package libpangocairo-1.0-0:armhf. Preparing to unpack .../115-libpangocairo-1.0-0_1.52.0+ds-1_armhf.deb ... Unpacking libpangocairo-1.0-0:armhf (1.52.0+ds-1) ... Selecting previously unselected package libxcomposite1:armhf. Preparing to unpack .../116-libxcomposite1_1%3a0.4.5-1_armhf.deb ... Unpacking libxcomposite1:armhf (1:0.4.5-1) ... Selecting previously unselected package libxfixes3:armhf. Preparing to unpack .../117-libxfixes3_1%3a6.0.0-2_armhf.deb ... Unpacking libxfixes3:armhf (1:6.0.0-2) ... Selecting previously unselected package libxcursor1:armhf. Preparing to unpack .../118-libxcursor1_1%3a1.2.1-1_armhf.deb ... Unpacking libxcursor1:armhf (1:1.2.1-1) ... Selecting previously unselected package libxdamage1:armhf. Preparing to unpack .../119-libxdamage1_1%3a1.1.6-1_armhf.deb ... Unpacking libxdamage1:armhf (1:1.1.6-1) ... Selecting previously unselected package libxi6:armhf. Preparing to unpack .../120-libxi6_2%3a1.8.1-1_armhf.deb ... Unpacking libxi6:armhf (2:1.8.1-1) ... Selecting previously unselected package libxinerama1:armhf. Preparing to unpack .../121-libxinerama1_2%3a1.1.4-3_armhf.deb ... Unpacking libxinerama1:armhf (2:1.1.4-3) ... Selecting previously unselected package libxrandr2:armhf. Preparing to unpack .../122-libxrandr2_2%3a1.5.4-1_armhf.deb ... Unpacking libxrandr2:armhf (2:1.5.4-1) ... Selecting previously unselected package libgtk2.0-0:armhf. Preparing to unpack .../123-libgtk2.0-0_2.24.33-3_armhf.deb ... Unpacking libgtk2.0-0:armhf (2.24.33-3) ... Selecting previously unselected package libglvnd0:armhf. Preparing to unpack .../124-libglvnd0_1.7.0-1_armhf.deb ... Unpacking libglvnd0:armhf (1.7.0-1) ... Selecting previously unselected package libdrm-common. Preparing to unpack .../125-libdrm-common_2.4.120-2_all.deb ... Unpacking libdrm-common (2.4.120-2) ... Selecting previously unselected package libdrm2:armhf. Preparing to unpack .../126-libdrm2_2.4.120-2_armhf.deb ... Unpacking libdrm2:armhf (2.4.120-2) ... Selecting previously unselected package libglapi-mesa:armhf. Preparing to unpack .../127-libglapi-mesa_23.3.5-1_armhf.deb ... Unpacking libglapi-mesa:armhf (23.3.5-1) ... Selecting previously unselected package libx11-xcb1:armhf. Preparing to unpack .../128-libx11-xcb1_2%3a1.8.7-1_armhf.deb ... Unpacking libx11-xcb1:armhf (2:1.8.7-1) ... Selecting previously unselected package libxcb-dri2-0:armhf. Preparing to unpack .../129-libxcb-dri2-0_1.15-1_armhf.deb ... Unpacking libxcb-dri2-0:armhf (1.15-1) ... Selecting previously unselected package libxcb-dri3-0:armhf. Preparing to unpack .../130-libxcb-dri3-0_1.15-1_armhf.deb ... Unpacking libxcb-dri3-0:armhf (1.15-1) ... Selecting previously unselected package libxcb-glx0:armhf. Preparing to unpack .../131-libxcb-glx0_1.15-1_armhf.deb ... Unpacking libxcb-glx0:armhf (1.15-1) ... Selecting previously unselected package libxcb-present0:armhf. Preparing to unpack .../132-libxcb-present0_1.15-1_armhf.deb ... Unpacking libxcb-present0:armhf (1.15-1) ... Selecting previously unselected package libxcb-randr0:armhf. Preparing to unpack .../133-libxcb-randr0_1.15-1_armhf.deb ... Unpacking libxcb-randr0:armhf (1.15-1) ... Selecting previously unselected package libxcb-sync1:armhf. Preparing to unpack .../134-libxcb-sync1_1.15-1_armhf.deb ... Unpacking libxcb-sync1:armhf (1.15-1) ... Selecting previously unselected package libxcb-xfixes0:armhf. Preparing to unpack .../135-libxcb-xfixes0_1.15-1_armhf.deb ... Unpacking libxcb-xfixes0:armhf (1.15-1) ... Selecting previously unselected package libxshmfence1:armhf. Preparing to unpack .../136-libxshmfence1_1.3-1_armhf.deb ... Unpacking libxshmfence1:armhf (1.3-1) ... Selecting previously unselected package libxxf86vm1:armhf. Preparing to unpack .../137-libxxf86vm1_1%3a1.1.4-1+b2_armhf.deb ... Unpacking libxxf86vm1:armhf (1:1.1.4-1+b2) ... Selecting previously unselected package libvulkan1:armhf. Preparing to unpack .../138-libvulkan1_1.3.275.0-1_armhf.deb ... Unpacking libvulkan1:armhf (1.3.275.0-1) ... Selecting previously unselected package libdrm-amdgpu1:armhf. Preparing to unpack .../139-libdrm-amdgpu1_2.4.120-2_armhf.deb ... Unpacking libdrm-amdgpu1:armhf (2.4.120-2) ... Selecting previously unselected package libdrm-nouveau2:armhf. Preparing to unpack .../140-libdrm-nouveau2_2.4.120-2_armhf.deb ... Unpacking libdrm-nouveau2:armhf (2.4.120-2) ... Selecting previously unselected package libdrm-radeon1:armhf. Preparing to unpack .../141-libdrm-radeon1_2.4.120-2_armhf.deb ... Unpacking libdrm-radeon1:armhf (2.4.120-2) ... Selecting previously unselected package libedit2:armhf. Preparing to unpack .../142-libedit2_3.1-20230828-1_armhf.deb ... Unpacking libedit2:armhf (3.1-20230828-1) ... Selecting previously unselected package libz3-4:armhf. Preparing to unpack .../143-libz3-4_4.8.12-3.1+b2_armhf.deb ... Unpacking libz3-4:armhf (4.8.12-3.1+b2) ... Selecting previously unselected package libllvm17:armhf. Preparing to unpack .../144-libllvm17_1%3a17.0.6-5_armhf.deb ... Unpacking libllvm17:armhf (1:17.0.6-5) ... Selecting previously unselected package libsensors-config. Preparing to unpack .../145-libsensors-config_1%3a3.6.0-9_all.deb ... Unpacking libsensors-config (1:3.6.0-9) ... Selecting previously unselected package libsensors5:armhf. Preparing to unpack .../146-libsensors5_1%3a3.6.0-9_armhf.deb ... Unpacking libsensors5:armhf (1:3.6.0-9) ... Selecting previously unselected package libgl1-mesa-dri:armhf. Preparing to unpack .../147-libgl1-mesa-dri_23.3.5-1_armhf.deb ... Unpacking libgl1-mesa-dri:armhf (23.3.5-1) ... Selecting previously unselected package libglx-mesa0:armhf. Preparing to unpack .../148-libglx-mesa0_23.3.5-1_armhf.deb ... Unpacking libglx-mesa0:armhf (23.3.5-1) ... Selecting previously unselected package libglx0:armhf. Preparing to unpack .../149-libglx0_1.7.0-1_armhf.deb ... Unpacking libglx0:armhf (1.7.0-1) ... Selecting previously unselected package libgl1:armhf. Preparing to unpack .../150-libgl1_1.7.0-1_armhf.deb ... Unpacking libgl1:armhf (1.7.0-1) ... Selecting previously unselected package libgif7:armhf. Preparing to unpack .../151-libgif7_5.2.2-1_armhf.deb ... Unpacking libgif7:armhf (5.2.2-1) ... Selecting previously unselected package x11-common. Preparing to unpack .../152-x11-common_1%3a7.7+23_all.deb ... Unpacking x11-common (1:7.7+23) ... Selecting previously unselected package libxtst6:armhf. Preparing to unpack .../153-libxtst6_2%3a1.2.3-1.1_armhf.deb ... Unpacking libxtst6:armhf (2:1.2.3-1.1) ... Selecting previously unselected package openjdk-17-jre:armhf. Preparing to unpack .../154-openjdk-17-jre_17.0.10+7-1_armhf.deb ... Unpacking openjdk-17-jre:armhf (17.0.10+7-1) ... Selecting previously unselected package default-jre. Preparing to unpack .../155-default-jre_2%3a1.17-75_armhf.deb ... Unpacking default-jre (2:1.17-75) ... Selecting previously unselected package openjdk-17-jdk-headless:armhf. Preparing to unpack .../156-openjdk-17-jdk-headless_17.0.10+7-1_armhf.deb ... Unpacking openjdk-17-jdk-headless:armhf (17.0.10+7-1) ... Selecting previously unselected package default-jdk-headless. Preparing to unpack .../157-default-jdk-headless_2%3a1.17-75_armhf.deb ... Unpacking default-jdk-headless (2:1.17-75) ... Selecting previously unselected package openjdk-17-jdk:armhf. Preparing to unpack .../158-openjdk-17-jdk_17.0.10+7-1_armhf.deb ... Unpacking openjdk-17-jdk:armhf (17.0.10+7-1) ... Selecting previously unselected package default-jdk. Preparing to unpack .../159-default-jdk_2%3a1.17-75_armhf.deb ... Unpacking default-jdk (2:1.17-75) ... Selecting previously unselected package libassuan0:armhf. Preparing to unpack .../160-libassuan0_2.5.6-1_armhf.deb ... Unpacking libassuan0:armhf (2.5.6-1) ... Selecting previously unselected package gpgconf. Preparing to unpack .../161-gpgconf_2.2.40-1.1+b1_armhf.deb ... Unpacking gpgconf (2.2.40-1.1+b1) ... Selecting previously unselected package libksba8:armhf. Preparing to unpack .../162-libksba8_1.6.6-1_armhf.deb ... Unpacking libksba8:armhf (1.6.6-1) ... Selecting previously unselected package libsasl2-modules-db:armhf. Preparing to unpack .../163-libsasl2-modules-db_2.1.28+dfsg1-4+b1_armhf.deb ... Unpacking libsasl2-modules-db:armhf (2.1.28+dfsg1-4+b1) ... Selecting previously unselected package libsasl2-2:armhf. Preparing to unpack .../164-libsasl2-2_2.1.28+dfsg1-4+b1_armhf.deb ... Unpacking libsasl2-2:armhf (2.1.28+dfsg1-4+b1) ... Selecting previously unselected package libldap-2.5-0:armhf. Preparing to unpack .../165-libldap-2.5-0_2.5.13+dfsg-5+b3_armhf.deb ... Unpacking libldap-2.5-0:armhf (2.5.13+dfsg-5+b3) ... Selecting previously unselected package libnpth0:armhf. Preparing to unpack .../166-libnpth0_1.6-3+b1_armhf.deb ... Unpacking libnpth0:armhf (1.6-3+b1) ... Selecting previously unselected package dirmngr. Preparing to unpack .../167-dirmngr_2.2.40-1.1+b1_armhf.deb ... Unpacking dirmngr (2.2.40-1.1+b1) ... Selecting previously unselected package gnupg-l10n. Preparing to unpack .../168-gnupg-l10n_2.2.40-1.1_all.deb ... Unpacking gnupg-l10n (2.2.40-1.1) ... Selecting previously unselected package gnupg-utils. Preparing to unpack .../169-gnupg-utils_2.2.40-1.1+b1_armhf.deb ... Unpacking gnupg-utils (2.2.40-1.1+b1) ... Selecting previously unselected package gpg. Preparing to unpack .../170-gpg_2.2.40-1.1+b1_armhf.deb ... Unpacking gpg (2.2.40-1.1+b1) ... Selecting previously unselected package pinentry-curses. Preparing to unpack .../171-pinentry-curses_1.2.1-3_armhf.deb ... Unpacking pinentry-curses (1.2.1-3) ... Selecting previously unselected package gpg-agent. Preparing to unpack .../172-gpg-agent_2.2.40-1.1+b1_armhf.deb ... Unpacking gpg-agent (2.2.40-1.1+b1) ... Selecting previously unselected package gpg-wks-client. Preparing to unpack .../173-gpg-wks-client_2.2.40-1.1+b1_armhf.deb ... Unpacking gpg-wks-client (2.2.40-1.1+b1) ... Selecting previously unselected package gpg-wks-server. Preparing to unpack .../174-gpg-wks-server_2.2.40-1.1+b1_armhf.deb ... Unpacking gpg-wks-server (2.2.40-1.1+b1) ... Selecting previously unselected package gpgsm. Preparing to unpack .../175-gpgsm_2.2.40-1.1+b1_armhf.deb ... Unpacking gpgsm (2.2.40-1.1+b1) ... Selecting previously unselected package gnupg. Preparing to unpack .../176-gnupg_2.2.40-1.1_all.deb ... Unpacking gnupg (2.2.40-1.1) ... Selecting previously unselected package libfile-dirlist-perl. Preparing to unpack .../177-libfile-dirlist-perl_0.05-3_all.deb ... Unpacking libfile-dirlist-perl (0.05-3) ... Selecting previously unselected package libfile-which-perl. Preparing to unpack .../178-libfile-which-perl_1.27-2_all.deb ... Unpacking libfile-which-perl (1.27-2) ... Selecting previously unselected package libfile-homedir-perl. Preparing to unpack .../179-libfile-homedir-perl_1.006-2_all.deb ... Unpacking libfile-homedir-perl (1.006-2) ... Selecting previously unselected package libfile-touch-perl. Preparing to unpack .../180-libfile-touch-perl_0.12-2_all.deb ... Unpacking libfile-touch-perl (0.12-2) ... Selecting previously unselected package libio-pty-perl. Preparing to unpack .../181-libio-pty-perl_1%3a1.20-1_armhf.deb ... Unpacking libio-pty-perl (1:1.20-1) ... Selecting previously unselected package libipc-run-perl. Preparing to unpack .../182-libipc-run-perl_20231003.0-1_all.deb ... Unpacking libipc-run-perl (20231003.0-1) ... Selecting previously unselected package libclass-method-modifiers-perl. Preparing to unpack .../183-libclass-method-modifiers-perl_2.15-1_all.deb ... Unpacking libclass-method-modifiers-perl (2.15-1) ... Selecting previously unselected package libclass-xsaccessor-perl. Preparing to unpack .../184-libclass-xsaccessor-perl_1.19-4+b2_armhf.deb ... Unpacking libclass-xsaccessor-perl (1.19-4+b2) ... Selecting previously unselected package libb-hooks-op-check-perl:armhf. Preparing to unpack .../185-libb-hooks-op-check-perl_0.22-2+b2_armhf.deb ... Unpacking libb-hooks-op-check-perl:armhf (0.22-2+b2) ... Selecting previously unselected package libdynaloader-functions-perl. Preparing to unpack .../186-libdynaloader-functions-perl_0.003-3_all.deb ... Unpacking libdynaloader-functions-perl (0.003-3) ... Selecting previously unselected package libdevel-callchecker-perl:armhf. Preparing to unpack .../187-libdevel-callchecker-perl_0.008-2+b1_armhf.deb ... Unpacking libdevel-callchecker-perl:armhf (0.008-2+b1) ... Selecting previously unselected package libparams-classify-perl:armhf. Preparing to unpack .../188-libparams-classify-perl_0.015-2+b2_armhf.deb ... Unpacking libparams-classify-perl:armhf (0.015-2+b2) ... Selecting previously unselected package libmodule-runtime-perl. Preparing to unpack .../189-libmodule-runtime-perl_0.016-2_all.deb ... Unpacking libmodule-runtime-perl (0.016-2) ... Selecting previously unselected package libimport-into-perl. Preparing to unpack .../190-libimport-into-perl_1.002005-2_all.deb ... Unpacking libimport-into-perl (1.002005-2) ... Selecting previously unselected package librole-tiny-perl. Preparing to unpack .../191-librole-tiny-perl_2.002004-1_all.deb ... Unpacking librole-tiny-perl (2.002004-1) ... Selecting previously unselected package libsub-quote-perl. Preparing to unpack .../192-libsub-quote-perl_2.006008-1_all.deb ... Unpacking libsub-quote-perl (2.006008-1) ... Selecting previously unselected package libmoo-perl. Preparing to unpack .../193-libmoo-perl_2.005005-1_all.deb ... Unpacking libmoo-perl (2.005005-1) ... Selecting previously unselected package libencode-locale-perl. Preparing to unpack .../194-libencode-locale-perl_1.05-3_all.deb ... Unpacking libencode-locale-perl (1.05-3) ... Selecting previously unselected package libtimedate-perl. Preparing to unpack .../195-libtimedate-perl_2.3300-2_all.deb ... Unpacking libtimedate-perl (2.3300-2) ... Selecting previously unselected package libhttp-date-perl. Preparing to unpack .../196-libhttp-date-perl_6.06-1_all.deb ... Unpacking libhttp-date-perl (6.06-1) ... Selecting previously unselected package libfile-listing-perl. Preparing to unpack .../197-libfile-listing-perl_6.16-1_all.deb ... Unpacking libfile-listing-perl (6.16-1) ... Selecting previously unselected package libhtml-tagset-perl. Preparing to unpack .../198-libhtml-tagset-perl_3.24-1_all.deb ... Unpacking libhtml-tagset-perl (3.24-1) ... Selecting previously unselected package liburi-perl. Preparing to unpack .../199-liburi-perl_5.27-1_all.deb ... Unpacking liburi-perl (5.27-1) ... Selecting previously unselected package libhtml-parser-perl:armhf. Preparing to unpack .../200-libhtml-parser-perl_3.81-1+b1_armhf.deb ... Unpacking libhtml-parser-perl:armhf (3.81-1+b1) ... Selecting previously unselected package libhtml-tree-perl. Preparing to unpack .../201-libhtml-tree-perl_5.07-3_all.deb ... Unpacking libhtml-tree-perl (5.07-3) ... Selecting previously unselected package libclone-perl:armhf. Preparing to unpack .../202-libclone-perl_0.46-1+b1_armhf.deb ... Unpacking libclone-perl:armhf (0.46-1+b1) ... Selecting previously unselected package libio-html-perl. Preparing to unpack .../203-libio-html-perl_1.004-3_all.deb ... Unpacking libio-html-perl (1.004-3) ... Selecting previously unselected package liblwp-mediatypes-perl. Preparing to unpack .../204-liblwp-mediatypes-perl_6.04-2_all.deb ... Unpacking liblwp-mediatypes-perl (6.04-2) ... Selecting previously unselected package libhttp-message-perl. Preparing to unpack .../205-libhttp-message-perl_6.45-1_all.deb ... Unpacking libhttp-message-perl (6.45-1) ... Selecting previously unselected package libhttp-cookies-perl. Preparing to unpack .../206-libhttp-cookies-perl_6.11-1_all.deb ... Unpacking libhttp-cookies-perl (6.11-1) ... Selecting previously unselected package libhttp-negotiate-perl. Preparing to unpack .../207-libhttp-negotiate-perl_6.01-2_all.deb ... Unpacking libhttp-negotiate-perl (6.01-2) ... Selecting previously unselected package perl-openssl-defaults:armhf. Preparing to unpack .../208-perl-openssl-defaults_7+b1_armhf.deb ... Unpacking perl-openssl-defaults:armhf (7+b1) ... Selecting previously unselected package libnet-ssleay-perl:armhf. Preparing to unpack .../209-libnet-ssleay-perl_1.94-1_armhf.deb ... Unpacking libnet-ssleay-perl:armhf (1.94-1) ... Selecting previously unselected package libio-socket-ssl-perl. Preparing to unpack .../210-libio-socket-ssl-perl_2.085-1_all.deb ... Unpacking libio-socket-ssl-perl (2.085-1) ... Selecting previously unselected package libnet-http-perl. Preparing to unpack .../211-libnet-http-perl_6.23-1_all.deb ... Unpacking libnet-http-perl (6.23-1) ... Selecting previously unselected package liblwp-protocol-https-perl. Preparing to unpack .../212-liblwp-protocol-https-perl_6.14-1_all.deb ... Unpacking liblwp-protocol-https-perl (6.14-1) ... Selecting previously unselected package libtry-tiny-perl. Preparing to unpack .../213-libtry-tiny-perl_0.31-2_all.deb ... Unpacking libtry-tiny-perl (0.31-2) ... Selecting previously unselected package libwww-robotrules-perl. Preparing to unpack .../214-libwww-robotrules-perl_6.02-1_all.deb ... Unpacking libwww-robotrules-perl (6.02-1) ... Selecting previously unselected package libwww-perl. Preparing to unpack .../215-libwww-perl_6.77-1_all.deb ... Unpacking libwww-perl (6.77-1) ... Selecting previously unselected package patchutils. Preparing to unpack .../216-patchutils_0.4.2-1_armhf.deb ... Unpacking patchutils (0.4.2-1) ... Selecting previously unselected package wdiff. Preparing to unpack .../217-wdiff_1.2.2-6_armhf.deb ... Unpacking wdiff (1.2.2-6) ... Selecting previously unselected package devscripts. Preparing to unpack .../218-devscripts_2.23.7_all.deb ... Unpacking devscripts (2.23.7) ... Selecting previously unselected package fastjar. Preparing to unpack .../219-fastjar_2%3a0.98-7_armhf.deb ... Unpacking fastjar (2:0.98-7) ... Selecting previously unselected package ivy. Preparing to unpack .../220-ivy_2.5.2-1_all.deb ... Unpacking ivy (2.5.2-1) ... Selecting previously unselected package libasm-java. Preparing to unpack .../221-libasm-java_9.5-1_all.deb ... Unpacking libasm-java (9.5-1) ... Selecting previously unselected package libbsf-java. Preparing to unpack .../222-libbsf-java_1%3a2.4.0-8_all.deb ... Unpacking libbsf-java (1:2.4.0-8) ... Selecting previously unselected package libcommons-cli-java. Preparing to unpack .../223-libcommons-cli-java_1.6.0-1_all.deb ... Unpacking libcommons-cli-java (1.6.0-1) ... Selecting previously unselected package libapache-pom-java. Preparing to unpack .../224-libapache-pom-java_29-2_all.deb ... Unpacking libapache-pom-java (29-2) ... Selecting previously unselected package libcommons-parent-java. Preparing to unpack .../225-libcommons-parent-java_56-1_all.deb ... Unpacking libcommons-parent-java (56-1) ... Selecting previously unselected package libcommons-logging-java. Preparing to unpack .../226-libcommons-logging-java_1.3.0-1_all.deb ... Unpacking libcommons-logging-java (1.3.0-1) ... Selecting previously unselected package libjansi-java. Preparing to unpack .../227-libjansi-java_2.4.1-2_all.deb ... Unpacking libjansi-java (2.4.1-2) ... Selecting previously unselected package libjsp-api-java. Preparing to unpack .../228-libjsp-api-java_2.3.4-3_all.deb ... Unpacking libjsp-api-java (2.3.4-3) ... Selecting previously unselected package libqdox-java. Preparing to unpack .../229-libqdox-java_1.12.1-3_all.deb ... Unpacking libqdox-java (1.12.1-3) ... Selecting previously unselected package libservlet-api-java. Preparing to unpack .../230-libservlet-api-java_4.0.1-2_all.deb ... Unpacking libservlet-api-java (4.0.1-2) ... Selecting previously unselected package libxpp3-java. Preparing to unpack .../231-libxpp3-java_1.1.4c-3_all.deb ... Unpacking libxpp3-java (1.1.4c-3) ... Selecting previously unselected package libxstream-java. Preparing to unpack .../232-libxstream-java_1.4.20-1_all.deb ... Unpacking libxstream-java (1.4.20-1) ... Selecting previously unselected package groovy. Preparing to unpack .../233-groovy_2.4.21-10_all.deb ... Unpacking groovy (2.4.21-10) ... Selecting previously unselected package libatinject-jsr330-api-java. Preparing to unpack .../234-libatinject-jsr330-api-java_1.0+ds1-5_all.deb ... Unpacking libatinject-jsr330-api-java (1.0+ds1-5) ... Selecting previously unselected package libcommons-collections3-java. Preparing to unpack .../235-libcommons-collections3-java_3.2.2-3_all.deb ... Unpacking libcommons-collections3-java (3.2.2-3) ... Selecting previously unselected package libcommons-compress-java. Preparing to unpack .../236-libcommons-compress-java_1.25.0-1_all.deb ... Unpacking libcommons-compress-java (1.25.0-1) ... Selecting previously unselected package libcommons-io-java. Preparing to unpack .../237-libcommons-io-java_2.11.0-2_all.deb ... Unpacking libcommons-io-java (2.11.0-2) ... Selecting previously unselected package libcommons-lang-java. Preparing to unpack .../238-libcommons-lang-java_2.6-10_all.deb ... Unpacking libcommons-lang-java (2.6-10) ... Selecting previously unselected package liberror-prone-java. Preparing to unpack .../239-liberror-prone-java_2.18.0-1_all.deb ... Unpacking liberror-prone-java (2.18.0-1) ... Selecting previously unselected package libjsr305-java. Preparing to unpack .../240-libjsr305-java_0.1~+svn49-11_all.deb ... Unpacking libjsr305-java (0.1~+svn49-11) ... Selecting previously unselected package libguava-java. Preparing to unpack .../241-libguava-java_32.0.1-1_all.deb ... Unpacking libguava-java (32.0.1-1) ... Selecting previously unselected package libcommons-codec-java. Preparing to unpack .../242-libcommons-codec-java_1.16.0-1_all.deb ... Unpacking libcommons-codec-java (1.16.0-1) ... Selecting previously unselected package libhttpcore-java. Preparing to unpack .../243-libhttpcore-java_4.4.16-1_all.deb ... Unpacking libhttpcore-java (4.4.16-1) ... Selecting previously unselected package libhttpclient-java. Preparing to unpack .../244-libhttpclient-java_4.5.14-1_all.deb ... Unpacking libhttpclient-java (4.5.14-1) ... Selecting previously unselected package libjarjar-java. Preparing to unpack .../245-libjarjar-java_1.4+svn142-12_all.deb ... Unpacking libjarjar-java (1.4+svn142-12) ... Selecting previously unselected package libjcip-annotations-java. Preparing to unpack .../246-libjcip-annotations-java_20060626-6_all.deb ... Unpacking libjcip-annotations-java (20060626-6) ... Selecting previously unselected package libjna-jni. Preparing to unpack .../247-libjna-jni_5.14.0-1_armhf.deb ... Unpacking libjna-jni (5.14.0-1) ... Selecting previously unselected package libjna-java. Preparing to unpack .../248-libjna-java_5.14.0-1_all.deb ... Unpacking libjna-java (5.14.0-1) ... Selecting previously unselected package libjzlib-java. Preparing to unpack .../249-libjzlib-java_1.1.3-3_all.deb ... Unpacking libjzlib-java (1.1.3-3) ... Selecting previously unselected package libjsch-java. Preparing to unpack .../250-libjsch-java_0.1.55-1_all.deb ... Unpacking libjsch-java (0.1.55-1) ... Selecting previously unselected package libminlog-java. Preparing to unpack .../251-libminlog-java_1.3.0-1.1_all.deb ... Unpacking libminlog-java (1.3.0-1.1) ... Selecting previously unselected package libobjenesis-java. Preparing to unpack .../252-libobjenesis-java_3.3-3_all.deb ... Unpacking libobjenesis-java (3.3-3) ... Selecting previously unselected package libreflectasm-java. Preparing to unpack .../253-libreflectasm-java_1.11.9+dfsg-4_all.deb ... Unpacking libreflectasm-java (1.11.9+dfsg-4) ... Selecting previously unselected package libkryo-java. Preparing to unpack .../254-libkryo-java_2.20-7_all.deb ... Unpacking libkryo-java (2.20-7) ... Selecting previously unselected package liblogback-java. Preparing to unpack .../255-liblogback-java_1%3a1.2.11-5_all.deb ... Unpacking liblogback-java (1:1.2.11-5) ... Selecting previously unselected package libnative-platform-jni. Preparing to unpack .../256-libnative-platform-jni_0.14-6_armhf.deb ... Unpacking libnative-platform-jni (0.14-6) ... Selecting previously unselected package libnative-platform-java. Preparing to unpack .../257-libnative-platform-java_0.14-6_all.deb ... Unpacking libnative-platform-java (0.14-6) ... Selecting previously unselected package libxml-commons-external-java. Preparing to unpack .../258-libxml-commons-external-java_1.4.01-6_all.deb ... Unpacking libxml-commons-external-java (1.4.01-6) ... Selecting previously unselected package libxml-commons-resolver1.1-java. Preparing to unpack .../259-libxml-commons-resolver1.1-java_1.2-11_all.deb ... Unpacking libxml-commons-resolver1.1-java (1.2-11) ... Selecting previously unselected package libxerces2-java. Preparing to unpack .../260-libxerces2-java_2.12.2-1_all.deb ... Unpacking libxerces2-java (2.12.2-1) ... Selecting previously unselected package libnekohtml-java. Preparing to unpack .../261-libnekohtml-java_1.9.22.noko2-0.1_all.deb ... Unpacking libnekohtml-java (1.9.22.noko2-0.1) ... Selecting previously unselected package libxbean-reflect-java. Preparing to unpack .../262-libxbean-reflect-java_4.5-8_all.deb ... Unpacking libxbean-reflect-java (4.5-8) ... Selecting previously unselected package libgradle-core-java. Preparing to unpack .../263-libgradle-core-java_4.4.1-20_all.deb ... Unpacking libgradle-core-java (4.4.1-20) ... Selecting previously unselected package libbcprov-java. Preparing to unpack .../264-libbcprov-java_1.77-1_all.deb ... Unpacking libbcprov-java (1.77-1) ... Selecting previously unselected package libbcpg-java. Preparing to unpack .../265-libbcpg-java_1.77-1_all.deb ... Unpacking libbcpg-java (1.77-1) ... Selecting previously unselected package libbsh-java. Preparing to unpack .../266-libbsh-java_2.0b4-20_all.deb ... Unpacking libbsh-java (2.0b4-20) ... Selecting previously unselected package libdd-plist-java. Preparing to unpack .../267-libdd-plist-java_1.20-1.1_all.deb ... Unpacking libdd-plist-java (1.20-1.1) ... Selecting previously unselected package libjaxen-java. Preparing to unpack .../268-libjaxen-java_1.1.6-4_all.deb ... Unpacking libjaxen-java (1.1.6-4) ... Selecting previously unselected package libdom4j-java. Preparing to unpack .../269-libdom4j-java_2.1.4-1_all.deb ... Unpacking libdom4j-java (2.1.4-1) ... Selecting previously unselected package libbcel-java. Preparing to unpack .../270-libbcel-java_6.5.0-2_all.deb ... Unpacking libbcel-java (6.5.0-2) ... Selecting previously unselected package libjformatstring-java. Preparing to unpack .../271-libjformatstring-java_0.10~20131207-2.1_all.deb ... Unpacking libjformatstring-java (0.10~20131207-2.1) ... Selecting previously unselected package libfindbugs-java. Preparing to unpack .../272-libfindbugs-java_3.1.0~preview2-3_all.deb ... Unpacking libfindbugs-java (3.1.0~preview2-3) ... Selecting previously unselected package libgoogle-gson-java. Preparing to unpack .../273-libgoogle-gson-java_2.10.1-1_all.deb ... Unpacking libgoogle-gson-java (2.10.1-1) ... Selecting previously unselected package libaopalliance-java. Preparing to unpack .../274-libaopalliance-java_20070526-7_all.deb ... Unpacking libaopalliance-java (20070526-7) ... Selecting previously unselected package libguice-java. Preparing to unpack .../275-libguice-java_4.2.3-2_all.deb ... Unpacking libguice-java (4.2.3-2) ... Selecting previously unselected package libjatl-java. Preparing to unpack .../276-libjatl-java_0.2.3-1.1_all.deb ... Unpacking libjatl-java (0.2.3-1.1) ... Selecting previously unselected package libjcifs-java. Preparing to unpack .../277-libjcifs-java_1.3.19-2_all.deb ... Unpacking libjcifs-java (1.3.19-2) ... Selecting previously unselected package libeclipse-jdt-annotation-java. Preparing to unpack .../278-libeclipse-jdt-annotation-java_2.2.700+eclipse4.26-2_all.deb ... Unpacking libeclipse-jdt-annotation-java (2.2.700+eclipse4.26-2) ... Selecting previously unselected package libjavaewah-java. Preparing to unpack .../279-libjavaewah-java_1.2.3-1_all.deb ... Unpacking libjavaewah-java (1.2.3-1) ... Selecting previously unselected package libel-api-java. Preparing to unpack .../280-libel-api-java_3.0.0-3_all.deb ... Unpacking libel-api-java (3.0.0-3) ... Selecting previously unselected package libwebsocket-api-java. Preparing to unpack .../281-libwebsocket-api-java_1.1-2_all.deb ... Unpacking libwebsocket-api-java (1.1-2) ... Selecting previously unselected package libjetty9-java. Preparing to unpack .../282-libjetty9-java_9.4.53-1_all.deb ... Unpacking libjetty9-java (9.4.53-1) ... Selecting previously unselected package libjgit-java. Preparing to unpack .../283-libjgit-java_4.11.9-2_all.deb ... Unpacking libjgit-java (4.11.9-2) ... Selecting previously unselected package libjs-jquery. Preparing to unpack .../284-libjs-jquery_3.6.1+dfsg+~3.5.14-1_all.deb ... Unpacking libjs-jquery (3.6.1+dfsg+~3.5.14-1) ... Selecting previously unselected package libcommons-lang3-java. Preparing to unpack .../285-libcommons-lang3-java_3.14.0-1_all.deb ... Unpacking libcommons-lang3-java (3.14.0-1) ... Selecting previously unselected package libplexus-utils2-java. Preparing to unpack .../286-libplexus-utils2-java_3.4.2-1_all.deb ... Unpacking libplexus-utils2-java (3.4.2-1) ... Selecting previously unselected package libwagon-provider-api-java. Preparing to unpack .../287-libwagon-provider-api-java_3.5.3-1_all.deb ... Unpacking libwagon-provider-api-java (3.5.3-1) ... Selecting previously unselected package libmaven-resolver-java. Preparing to unpack .../288-libmaven-resolver-java_1.6.3-1_all.deb ... Unpacking libmaven-resolver-java (1.6.3-1) ... Selecting previously unselected package libgeronimo-annotation-1.3-spec-java. Preparing to unpack .../289-libgeronimo-annotation-1.3-spec-java_1.3-1_all.deb ... Unpacking libgeronimo-annotation-1.3-spec-java (1.3-1) ... Selecting previously unselected package libmaven-parent-java. Preparing to unpack .../290-libmaven-parent-java_35-1_all.deb ... Unpacking libmaven-parent-java (35-1) ... Selecting previously unselected package libmaven-shared-utils-java. Preparing to unpack .../291-libmaven-shared-utils-java_3.3.4-1_all.deb ... Unpacking libmaven-shared-utils-java (3.3.4-1) ... Selecting previously unselected package libplexus-cipher-java. Preparing to unpack .../292-libplexus-cipher-java_2.0-1_all.deb ... Unpacking libplexus-cipher-java (2.0-1) ... Selecting previously unselected package libplexus-classworlds-java. Preparing to unpack .../293-libplexus-classworlds-java_2.7.0-1_all.deb ... Unpacking libplexus-classworlds-java (2.7.0-1) ... Selecting previously unselected package libplexus-component-annotations-java. Preparing to unpack .../294-libplexus-component-annotations-java_2.1.1-1_all.deb ... Unpacking libplexus-component-annotations-java (2.1.1-1) ... Selecting previously unselected package libplexus-interpolation-java. Preparing to unpack .../295-libplexus-interpolation-java_1.26-1_all.deb ... Unpacking libplexus-interpolation-java (1.26-1) ... Selecting previously unselected package libplexus-sec-dispatcher-java. Preparing to unpack .../296-libplexus-sec-dispatcher-java_2.0-3_all.deb ... Unpacking libplexus-sec-dispatcher-java (2.0-3) ... Selecting previously unselected package libgeronimo-interceptor-3.0-spec-java. Preparing to unpack .../297-libgeronimo-interceptor-3.0-spec-java_1.0.1-4_all.deb ... Unpacking libgeronimo-interceptor-3.0-spec-java (1.0.1-4) ... Selecting previously unselected package libcdi-api-java. Preparing to unpack .../298-libcdi-api-java_1.2-3_all.deb ... Unpacking libcdi-api-java (1.2-3) ... Selecting previously unselected package libsisu-inject-java. Preparing to unpack .../299-libsisu-inject-java_0.3.4-2_all.deb ... Unpacking libsisu-inject-java (0.3.4-2) ... Selecting previously unselected package libsisu-plexus-java. Preparing to unpack .../300-libsisu-plexus-java_0.3.4-3_all.deb ... Unpacking libsisu-plexus-java (0.3.4-3) ... Selecting previously unselected package libmaven3-core-java. Preparing to unpack .../301-libmaven3-core-java_3.8.7-2_all.deb ... Unpacking libmaven3-core-java (3.8.7-2) ... Selecting previously unselected package libplexus-container-default-java. Preparing to unpack .../302-libplexus-container-default-java_2.1.1-1_all.deb ... Unpacking libplexus-container-default-java (2.1.1-1) ... Selecting previously unselected package libpolyglot-maven-java. Preparing to unpack .../303-libpolyglot-maven-java_0.8~tobrien+git20120905-10_all.deb ... Unpacking libpolyglot-maven-java (0.8~tobrien+git20120905-10) ... Selecting previously unselected package librhino-java. Preparing to unpack .../304-librhino-java_1.7.14-2.1_all.deb ... Unpacking librhino-java (1.7.14-2.1) ... Selecting previously unselected package libsimple-http-java. Preparing to unpack .../305-libsimple-http-java_4.1.21-1.1_all.deb ... Unpacking libsimple-http-java (4.1.21-1.1) ... Selecting previously unselected package libwagon-file-java. Preparing to unpack .../306-libwagon-file-java_3.5.3-1_all.deb ... Unpacking libwagon-file-java (3.5.3-1) ... Selecting previously unselected package libjsoup-java. Preparing to unpack .../307-libjsoup-java_1.15.3-1_all.deb ... Unpacking libjsoup-java (1.15.3-1) ... Selecting previously unselected package libwagon-http-java. Preparing to unpack .../308-libwagon-http-java_3.5.3-1_all.deb ... Unpacking libwagon-http-java (3.5.3-1) ... Selecting previously unselected package libjcommander-java. Preparing to unpack .../309-libjcommander-java_1.71-4_all.deb ... Unpacking libjcommander-java (1.71-4) ... Selecting previously unselected package testng. Preparing to unpack .../310-testng_6.9.12-4_all.deb ... Unpacking testng (6.9.12-4) ... Selecting previously unselected package libgradle-plugins-java. Preparing to unpack .../311-libgradle-plugins-java_4.4.1-20_all.deb ... Unpacking libgradle-plugins-java (4.4.1-20) ... Selecting previously unselected package gradle. Preparing to unpack .../312-gradle_4.4.1-20_all.deb ... Unpacking gradle (4.4.1-20) ... Selecting previously unselected package maven-repo-helper. Preparing to unpack .../313-maven-repo-helper_1.11_all.deb ... Unpacking maven-repo-helper (1.11) ... Selecting previously unselected package gradle-debian-helper. Preparing to unpack .../314-gradle-debian-helper_2.4_all.deb ... Unpacking gradle-debian-helper (2.4) ... Selecting previously unselected package jarwrapper. Preparing to unpack .../315-jarwrapper_0.79_all.deb ... Unpacking jarwrapper (0.79) ... Selecting previously unselected package javahelper. Preparing to unpack .../316-javahelper_0.79_all.deb ... Unpacking javahelper (0.79) ... Selecting previously unselected package libbyte-buddy-java. Preparing to unpack .../317-libbyte-buddy-java_1.12.23-1_all.deb ... Unpacking libbyte-buddy-java (1.12.23-1) ... Selecting previously unselected package libcommons-math3-java. Preparing to unpack .../318-libcommons-math3-java_3.6.1-3_all.deb ... Unpacking libcommons-math3-java (3.6.1-3) ... Selecting previously unselected package libjackson2-annotations-java. Preparing to unpack .../319-libjackson2-annotations-java_2.14.0-1_all.deb ... Unpacking libjackson2-annotations-java (2.14.0-1) ... Selecting previously unselected package libjackson2-core-java. Preparing to unpack .../320-libjackson2-core-java_2.14.1-1_all.deb ... Unpacking libjackson2-core-java (2.14.1-1) ... Selecting previously unselected package libjackson2-databind-java. Preparing to unpack .../321-libjackson2-databind-java_2.14.0-1_all.deb ... Unpacking libjackson2-databind-java (2.14.0-1) ... Selecting previously unselected package liblz4-jni. Preparing to unpack .../322-liblz4-jni_1.8.0-4_armhf.deb ... Unpacking liblz4-jni (1.8.0-4) ... Selecting previously unselected package liblz4-java. Preparing to unpack .../323-liblz4-java_1.8.0-4_all.deb ... Unpacking liblz4-java (1.8.0-4) ... Selecting previously unselected package libmockito-java. Preparing to unpack .../324-libmockito-java_2.23.0-2_all.deb ... Unpacking libmockito-java (2.23.0-2) ... Selecting previously unselected package libredberry-pipe-java. Preparing to unpack .../325-libredberry-pipe-java_1.0.0~alpha0-3_all.deb ... Unpacking libredberry-pipe-java (1.0.0~alpha0-3) ... Selecting previously unselected package libtrove3-java. Preparing to unpack .../326-libtrove3-java_3.0.3-5_all.deb ... Unpacking libtrove3-java (3.0.3-5) ... Setting up libjcifs-java (1.3.19-2) ... Setting up libbcprov-java (1.77-1) ... Setting up libksba8:armhf (1.6.6-1) ... Setting up media-types (10.1.0) ... Setting up libpipeline1:armhf (1.5.7-1+b2) ... Setting up fastjar (2:0.98-7) ... Setting up libgraphite2-3:armhf (1.3.14-2) ... Setting up liblcms2-2:armhf (2.14-2+b1) ... Setting up libpixman-1-0:armhf (0.42.2-1+b1) ... Setting up libjcommander-java (1.71-4) ... Setting up libjackson2-annotations-java (2.14.0-1) ... Setting up wdiff (1.2.2-6) ... Setting up libsharpyuv0:armhf (1.3.2-0.4) ... Setting up libslf4j-java (1.7.32-1) ... Setting up libfile-which-perl (1.27-2) ... Setting up libxau6:armhf (1:1.0.9-1) ... Setting up libplexus-utils2-java (3.4.2-1) ... Setting up libredberry-pipe-java (1.0.0~alpha0-3) ... Setting up libplexus-classworlds-java (2.7.0-1) ... Setting up libqdox-java (1.12.1-3) ... Setting up libicu72:armhf (72.1-4+b1) ... Setting up liblerc4:armhf (4.0.0+ds-4+b1) ... Setting up libjsr305-java (0.1~+svn49-11) ... Setting up libsimple-http-java (4.1.21-1.1) ... Setting up bsdextrautils (2.39.3-6) ... Setting up hicolor-icon-theme (0.17-2) ... Setting up java-common (0.75) ... Setting up libdynaloader-functions-perl (0.003-3) ... Setting up libdatrie1:armhf (0.2.13-3) ... Setting up libjcip-annotations-java (20060626-6) ... Setting up libobjenesis-java (3.3-3) ... Setting up libclass-method-modifiers-perl (2.15-1) ... Setting up libaopalliance-java (20070526-7) ... Setting up libcommons-cli-java (1.6.0-1) ... Setting up libio-pty-perl (1:1.20-1) ... Setting up libmagic-mgc (1:5.45-2+b1) ... Setting up liblogback-java (1:1.2.11-5) ... Setting up libclone-perl:armhf (0.46-1+b1) ... Setting up libminlog-java (1.3.0-1.1) ... Setting up libarchive-zip-perl (1.68-1) ... Setting up libglib2.0-0:armhf (2.78.4-1) ... No schema files found: doing nothing. Setting up libglvnd0:armhf (1.7.0-1) ... Setting up libgoogle-gson-java (2.10.1-1) ... Setting up libhtml-tagset-perl (3.24-1) ... Setting up unzip (6.0-28) ... Setting up libdebhelper-perl (13.14.1) ... Setting up libbrotli1:armhf (1.1.0-2+b3) ... Setting up liblwp-mediatypes-perl (6.04-2) ... Setting up libgdk-pixbuf2.0-common (2.42.10+dfsg-3) ... Setting up libasm-java (9.5-1) ... Setting up x11-common (1:7.7+23) ... invoke-rc.d: could not determine current runlevel Setting up X socket directories... /tmp/.X11-unix /tmp/.ICE-unix. Setting up libtry-tiny-perl (0.31-2) ... Setting up libsensors-config (1:3.6.0-9) ... Setting up libmagic1:armhf (1:5.45-2+b1) ... Setting up libdeflate0:armhf (1.19-1) ... Setting up perl-openssl-defaults:armhf (7+b1) ... Setting up libdd-plist-java (1.20-1.1) ... Setting up gettext-base (0.21-14+b1) ... Setting up m4 (1.4.19-4) ... Setting up libel-api-java (3.0.0-3) ... Setting up libencode-locale-perl (1.05-3) ... Setting up libplexus-component-annotations-java (2.1.1-1) ... Setting up libnpth0:armhf (1.6-3+b1) ... Setting up file (1:5.45-2+b1) ... Setting up libpolyglot-maven-java (0.8~tobrien+git20120905-10) ... Setting up libfelix-gogo-runtime-java (0.16.2-1.1) ... Setting up libassuan0:armhf (2.5.6-1) ... Setting up libjzlib-java (1.1.3-3) ... Setting up libjbig0:armhf (2.1-6.1+b1) ... Setting up libsasl2-modules-db:armhf (2.1.28+dfsg1-4+b1) ... Setting up tzdata (2024a-1) ... Current default time zone: 'Etc/UTC' Local time is now: Mon Mar 25 16:46:15 UTC 2024. Universal Time is now: Mon Mar 25 16:46:15 UTC 2024. Run 'dpkg-reconfigure tzdata' if you wish to change it. Setting up libgeronimo-annotation-1.3-spec-java (1.3-1) ... Setting up libgeronimo-interceptor-3.0-spec-java (1.0.1-4) ... Setting up libcommons-collections3-java (3.2.2-3) ... Setting up libasound2-data (1.2.10-3) ... Setting up libjsch-java (0.1.55-1) ... Setting up libreflectasm-java (1.11.9+dfsg-4) ... Setting up librhino-java (1.7.14-2.1) ... Setting up autotools-dev (20220109.1) ... Setting up libz3-4:armhf (4.8.12-3.1+b2) ... Setting up libbsf-java (1:2.4.0-8) ... Setting up libosgi-annotation-java (8.1.0-1) ... Setting up libjformatstring-java (0.10~20131207-2.1) ... Setting up libjavaewah-java (1.2.3-1) ... Setting up libjpeg62-turbo:armhf (1:2.1.5-2+b2) ... Setting up libjaxen-java (1.1.6-4) ... Setting up libx11-data (2:1.8.7-1) ... Setting up libnspr4:armhf (2:4.35-1.1+b1) ... Setting up gnupg-l10n (2.2.40-1.1) ... Setting up libeclipse-jdt-annotation-java (2.2.700+eclipse4.26-2) ... Setting up libjansi-java (2.4.1-2) ... Setting up libapache-pom-java (29-2) ... Setting up libavahi-common-data:armhf (0.8-13+b1) ... Setting up libxpp3-java (1.1.4c-3) ... Setting up libatinject-jsr330-api-java (1.0+ds1-5) ... Setting up libdbus-1-3:armhf (1.14.10-4) ... Setting up libwebsocket-api-java (1.1-2) ... Setting up libfribidi0:armhf (1.0.13-3+b1) ... Setting up libplexus-interpolation-java (1.26-1) ... Setting up fonts-dejavu-mono (2.37-8) ... Setting up libpng16-16:armhf (1.6.43-1) ... Setting up libxml-commons-resolver1.1-java (1.2-11) ... Setting up libkryo-java (2.20-7) ... Setting up libxz-java (1.9-1) ... Setting up libio-html-perl (1.004-3) ... Setting up libjna-jni (5.14.0-1) ... Setting up autopoint (0.21-14) ... Setting up binfmt-support (2.2.2-6) ... invoke-rc.d: could not determine current runlevel invoke-rc.d: policy-rc.d denied execution of start. Setting up libb-hooks-op-check-perl:armhf (0.22-2+b2) ... Setting up fonts-dejavu-core (2.37-8) ... Setting up libfelix-framework-java (4.6.1-2.1) ... Setting up libipc-run-perl (20231003.0-1) ... Setting up libpcsclite1:armhf (2.0.1-1+b1) ... Setting up libsensors5:armhf (1:3.6.0-9) ... Setting up libhamcrest-java (2.2-2) ... Setting up libglapi-mesa:armhf (23.3.5-1) ... Setting up libbsh-java (2.0b4-20) ... Setting up libjsp-api-java (2.3.4-3) ... Setting up libsasl2-2:armhf (2.1.28+dfsg1-4+b1) ... Setting up libvulkan1:armhf (1.3.275.0-1) ... Setting up autoconf (2.71-3) ... Setting up libwebp7:armhf (1.3.2-0.4) ... Setting up libtimedate-perl (2.3300-2) ... Setting up libgif7:armhf (5.2.2-1) ... Setting up libjarjar-java (1.4+svn142-12) ... Setting up libtrove3-java (3.0.3-5) ... Setting up sensible-utils (0.0.22) ... Setting up libxshmfence1:armhf (1.3-1) ... Setting up libjsoup-java (1.15.3-1) ... Setting up at-spi2-common (2.50.0-1) ... Setting up libtiff6:armhf (4.5.1+git230720-4) ... Setting up libuchardet0:armhf (0.0.8-1+b1) ... Setting up libxml-commons-external-java (1.4.01-6) ... Setting up libjna-java (5.14.0-1) ... Setting up libxbean-reflect-java (4.5-8) ... Setting up libasound2:armhf (1.2.10-3) ... Setting up libservlet-api-java (4.0.1-2) ... Setting up librole-tiny-perl (2.002004-1) ... Setting up libjackson2-core-java (2.14.1-1) ... Setting up libsub-override-perl (0.10-1) ... Setting up libthai-data (0.1.29-2) ... Setting up netbase (6.4) ... Setting up libcommons-math3-java (3.6.1-3) ... Setting up libsub-quote-perl (2.006008-1) ... Setting up libnative-platform-jni (0.14-6) ... Setting up libclass-xsaccessor-perl (1.19-4+b2) ... Setting up libgtk2.0-common (2.24.33-3) ... Setting up libatk1.0-0:armhf (2.50.0-1+b1) ... Setting up liblz4-jni (1.8.0-4) ... Setting up libhttpcore-java (4.4.16-1) ... Setting up libbcpg-java (1.77-1) ... Setting up libjs-jquery (3.6.1+dfsg+~3.5.14-1) ... Setting up libxerces2-java (2.12.2-1) ... Setting up libfile-dirlist-perl (0.05-3) ... Setting up libfile-homedir-perl (1.006-2) ... Setting up libantlr-java (2.7.7+dfsg-13) ... Setting up libyaml-snake-java (1.33-2) ... Setting up openssl (3.1.5-1) ... Setting up libbsd0:armhf (0.12.2-1) ... Setting up libdrm-common (2.4.120-2) ... Setting up libcdi-api-java (1.2-3) ... Setting up libelf1:armhf (0.190-1+b1) ... Setting up readline-common (8.2-3) ... Setting up libhawtjni-runtime-java (1.18-1) ... Setting up libxml2:armhf (2.9.14+dfsg-1.3+b2) ... Setting up liburi-perl (5.27-1) ... Setting up libfile-touch-perl (0.12-2) ... Setting up dctrl-tools (2.24-3) ... Setting up libjatl-java (0.2.3-1.1) ... Setting up libnet-ssleay-perl:armhf (1.94-1) ... Setting up automake (1:1.16.5-1.3) ... update-alternatives: using /usr/bin/automake-1.16 to provide /usr/bin/automake (automake) in auto mode Setting up pinentry-curses (1.2.1-3) ... Setting up libdom4j-java (2.1.4-1) ... Setting up libfile-stripnondeterminism-perl (1.13.1-1) ... Setting up libwagon-provider-api-java (3.5.3-1) ... Setting up libnative-platform-java (0.14-6) ... Setting up libosgi-core-java (8.0.0-2) ... Setting up libhttp-date-perl (6.06-1) ... Setting up libxstream-java (1.4.20-1) ... Setting up libnekohtml-java (1.9.22.noko2-0.1) ... Setting up libxdmcp6:armhf (1:1.1.2-3) ... Setting up liblz4-java (1.8.0-4) ... Setting up libxcb1:armhf (1.15-1) ... Setting up gettext (0.21-14+b1) ... Setting up libjetty9-java (9.4.53-1) ... Setting up libxcb-xfixes0:armhf (1.15-1) ... Setting up java-wrappers (0.4) ... Setting up libfile-listing-perl (6.16-1) ... Setting up libosgi-compendium-java (7.0.0-1) ... Setting up jarwrapper (0.79) ... Setting up libtool (2.4.7-7) ... Setting up libxcb-render0:armhf (1.15-1) ... Setting up fontconfig-config (2.15.0-1.1) ... Setting up libxcb-glx0:armhf (1.15-1) ... Setting up libmaven-parent-java (35-1) ... Setting up libedit2:armhf (3.1-20230828-1) ... Setting up libreadline8:armhf (8.2-3+b1) ... Setting up libcommons-parent-java (56-1) ... Setting up libavahi-common3:armhf (0.8-13+b1) ... Setting up libcommons-logging-java (1.3.0-1) ... Setting up libnet-http-perl (6.23-1) ... Setting up libsisu-inject-java (0.3.4-2) ... Setting up libnss3:armhf (2:3.99-1) ... Setting up libxcb-shm0:armhf (1.15-1) ... Setting up libdevel-callchecker-perl:armhf (0.008-2+b1) ... Setting up libcommons-lang-java (2.6-10) ... Setting up libldap-2.5-0:armhf (2.5.13+dfsg-5+b3) ... Setting up libjackson2-databind-java (2.14.0-1) ... Setting up libplexus-cipher-java (2.0-1) ... Setting up intltool-debian (0.35.0+20060710.6) ... Setting up libxcb-present0:armhf (1.15-1) ... Setting up dh-autoreconf (20) ... Setting up patchutils (0.4.2-1) ... Setting up libthai0:armhf (0.1.29-2) ... Setting up ca-certificates (20240203) ... Updating certificates in /etc/ssl/certs... 146 added, 0 removed; done. Setting up libsisu-plexus-java (0.3.4-3) ... Setting up libbcel-java (6.5.0-2) ... Setting up libfreetype6:armhf (2.13.2+dfsg-1+b1) ... Setting up libxcb-sync1:armhf (1.15-1) ... Setting up testng (6.9.12-4) ... Setting up shared-mime-info (2.4-1) ... Setting up libcommons-lang3-java (3.14.0-1) ... Setting up libxcb-dri2-0:armhf (1.15-1) ... Setting up dh-strip-nondeterminism (1.13.1-1) ... Setting up libwww-robotrules-perl (6.02-1) ... Setting up libfelix-resolver-java (1.16.0-1) ... Setting up libdrm2:armhf (2.4.120-2) ... Setting up dwz (0.15-1) ... Setting up libjansi-native-java (1.8-2) ... Setting up groff-base (1.23.0-3) ... Setting up libxcb-randr0:armhf (1.15-1) ... Setting up libhtml-parser-perl:armhf (3.81-1+b1) ... Setting up gpgconf (2.2.40-1.1+b1) ... Setting up libjansi1-java (1.18-3) ... Setting up libplexus-sec-dispatcher-java (2.0-3) ... Setting up libx11-6:armhf (2:1.8.7-1) ... Setting up libharfbuzz0b:armhf (8.3.0-2) ... Setting up libgdk-pixbuf-2.0-0:armhf (2.42.10+dfsg-3+b1) ... Setting up libfontconfig1:armhf (2.15.0-1.1) ... Setting up ca-certificates-java (20240118) ... No JRE found. Skipping Java certificates setup. Setting up libwagon-file-java (3.5.3-1) ... Setting up libcommons-codec-java (1.16.0-1) ... Setting up libjline2-java (2.14.6-5) ... Setting up libllvm17:armhf (1:17.0.6-5) ... Setting up libxcomposite1:armhf (1:0.4.5-1) ... Setting up libavahi-client3:armhf (0.8-13+b1) ... Setting up libio-socket-ssl-perl (2.085-1) ... Setting up gpg (2.2.40-1.1+b1) ... Setting up gnupg-utils (2.2.40-1.1+b1) ... Setting up libhttp-message-perl (6.45-1) ... Setting up libdrm-amdgpu1:armhf (2.4.120-2) ... Setting up libxcb-dri3-0:armhf (1.15-1) ... Setting up gtk-update-icon-cache (3.24.41-1) ... Setting up libx11-xcb1:armhf (2:1.8.7-1) ... Setting up libhttp-negotiate-perl (6.01-2) ... Setting up fontconfig (2.15.0-1.1) ... Regenerating fonts cache... done. Setting up libdrm-nouveau2:armhf (2.4.120-2) ... Setting up libfindbugs-java (3.1.0~preview2-3) ... Setting up libxdamage1:armhf (1:1.1.6-1) ... Setting up gpg-agent (2.2.40-1.1+b1) ... Setting up libxrender1:armhf (1:0.9.10-1.1) ... Setting up libcommons-compress-java (1.25.0-1) ... Setting up libhttp-cookies-perl (6.11-1) ... Setting up libcommons-io-java (2.11.0-2) ... Setting up libdrm-radeon1:armhf (2.4.120-2) ... Setting up po-debconf (1.0.21+nmu1) ... Setting up libhtml-tree-perl (5.07-3) ... Setting up libpython3.11-stdlib:armhf (3.11.8-1) ... Setting up libparams-classify-perl:armhf (0.015-2+b2) ... Setting up gpgsm (2.2.40-1.1+b1) ... Setting up libpango-1.0-0:armhf (1.52.0+ds-1) ... Setting up libgl1-mesa-dri:armhf (23.3.5-1) ... Setting up libxext6:armhf (2:1.3.4-1+b1) ... Setting up man-db (2.12.0-3) ... Not building database; man-db/auto-update is not 'true'. Setting up libcairo2:armhf (1.18.0-1+b1) ... Setting up libxxf86vm1:armhf (1:1.1.4-1+b2) ... Setting up dirmngr (2.2.40-1.1+b1) ... Setting up libmaven-resolver-java (1.6.3-1) ... Setting up adwaita-icon-theme (46.0-1) ... update-alternatives: using /usr/share/icons/Adwaita/cursor.theme to provide /usr/share/icons/default/index.theme (x-cursor-theme) in auto mode Setting up libmodule-runtime-perl (0.016-2) ... Setting up libxfixes3:armhf (1:6.0.0-2) ... Setting up libxinerama1:armhf (2:1.1.4-3) ... Setting up libxrandr2:armhf (2:1.5.4-1) ... Setting up gpg-wks-server (2.2.40-1.1+b1) ... Setting up libcups2:armhf (2.4.7-1+b1) ... Setting up libhttpclient-java (4.5.14-1) ... Setting up libwagon-http-java (3.5.3-1) ... Setting up libmaven-shared-utils-java (3.3.4-1) ... Setting up libpangoft2-1.0-0:armhf (1.52.0+ds-1) ... Setting up libpangocairo-1.0-0:armhf (1.52.0+ds-1) ... Setting up libpython3-stdlib:armhf (3.11.6-1) ... Setting up python3.11 (3.11.8-1) ... Setting up libjgit-java (4.11.9-2) ... Setting up libglx-mesa0:armhf (23.3.5-1) ... Setting up libxi6:armhf (2:1.8.1-1) ... Setting up gpg-wks-client (2.2.40-1.1+b1) ... Setting up libglx0:armhf (1.7.0-1) ... Setting up libimport-into-perl (1.002005-2) ... Setting up libxtst6:armhf (2:1.2.3-1.1) ... Setting up libmoo-perl (2.005005-1) ... Setting up libxcursor1:armhf (1:1.2.1-1) ... Setting up debhelper (13.14.1) ... Setting up python3 (3.11.6-1) ... Setting up libgl1:armhf (1.7.0-1) ... Setting up openjdk-17-jre-headless:armhf (17.0.10+7-1) ... update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/java to provide /usr/bin/java (java) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/jpackage to provide /usr/bin/jpackage (jpackage) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/keytool to provide /usr/bin/keytool (keytool) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/rmiregistry to provide /usr/bin/rmiregistry (rmiregistry) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/lib/jexec to provide /usr/bin/jexec (jexec) in auto mode Setting up gnupg (2.2.40-1.1) ... Setting up libgtk2.0-0:armhf (2.24.33-3) ... Setting up liblwp-protocol-https-perl (6.14-1) ... Setting up liberror-prone-java (2.18.0-1) ... Setting up libwww-perl (6.77-1) ... Setting up devscripts (2.23.7) ... Setting up libguava-java (32.0.1-1) ... Setting up javahelper (0.79) ... Setting up libplexus-container-default-java (2.1.1-1) ... Setting up libguice-java (4.2.3-2) ... Setting up libmaven3-core-java (3.8.7-2) ... Setting up libbyte-buddy-java (1.12.23-1) ... Setting up libmockito-java (2.23.0-2) ... Processing triggers for libc-bin (2.37-15) ... Processing triggers for ca-certificates-java (20240118) ... Adding debian:ACCVRAIZ1.pem Adding debian:AC_RAIZ_FNMT-RCM.pem Adding debian:AC_RAIZ_FNMT-RCM_SERVIDORES_SEGUROS.pem Adding debian:ANF_Secure_Server_Root_CA.pem Adding debian:Actalis_Authentication_Root_CA.pem Adding debian:AffirmTrust_Commercial.pem Adding debian:AffirmTrust_Networking.pem Adding debian:AffirmTrust_Premium.pem Adding debian:AffirmTrust_Premium_ECC.pem Adding debian:Amazon_Root_CA_1.pem Adding debian:Amazon_Root_CA_2.pem Adding debian:Amazon_Root_CA_3.pem Adding debian:Amazon_Root_CA_4.pem Adding debian:Atos_TrustedRoot_2011.pem Adding debian:Atos_TrustedRoot_Root_CA_ECC_TLS_2021.pem Adding debian:Atos_TrustedRoot_Root_CA_RSA_TLS_2021.pem Adding debian:Autoridad_de_Certificacion_Firmaprofesional_CIF_A62634068.pem Adding debian:BJCA_Global_Root_CA1.pem Adding debian:BJCA_Global_Root_CA2.pem Adding debian:Baltimore_CyberTrust_Root.pem Adding debian:Buypass_Class_2_Root_CA.pem Adding debian:Buypass_Class_3_Root_CA.pem Adding debian:CA_Disig_Root_R2.pem Adding debian:CFCA_EV_ROOT.pem Adding debian:COMODO_Certification_Authority.pem Adding debian:COMODO_ECC_Certification_Authority.pem Adding debian:COMODO_RSA_Certification_Authority.pem Adding debian:Certainly_Root_E1.pem Adding debian:Certainly_Root_R1.pem Adding debian:Certigna.pem Adding debian:Certigna_Root_CA.pem Adding debian:Certum_EC-384_CA.pem Adding debian:Certum_Trusted_Network_CA.pem Adding debian:Certum_Trusted_Network_CA_2.pem Adding debian:Certum_Trusted_Root_CA.pem Adding debian:CommScope_Public_Trust_ECC_Root-01.pem Adding debian:CommScope_Public_Trust_ECC_Root-02.pem Adding debian:CommScope_Public_Trust_RSA_Root-01.pem Adding debian:CommScope_Public_Trust_RSA_Root-02.pem Adding debian:Comodo_AAA_Services_root.pem Adding debian:D-TRUST_BR_Root_CA_1_2020.pem Adding debian:D-TRUST_EV_Root_CA_1_2020.pem Adding debian:D-TRUST_Root_Class_3_CA_2_2009.pem Adding debian:D-TRUST_Root_Class_3_CA_2_EV_2009.pem Adding debian:DigiCert_Assured_ID_Root_CA.pem Adding debian:DigiCert_Assured_ID_Root_G2.pem Adding debian:DigiCert_Assured_ID_Root_G3.pem Adding debian:DigiCert_Global_Root_CA.pem Adding debian:DigiCert_Global_Root_G2.pem Adding debian:DigiCert_Global_Root_G3.pem Adding debian:DigiCert_High_Assurance_EV_Root_CA.pem Adding debian:DigiCert_TLS_ECC_P384_Root_G5.pem Adding debian:DigiCert_TLS_RSA4096_Root_G5.pem Adding debian:DigiCert_Trusted_Root_G4.pem Adding debian:Entrust.net_Premium_2048_Secure_Server_CA.pem Adding debian:Entrust_Root_Certification_Authority.pem Adding debian:Entrust_Root_Certification_Authority_-_EC1.pem Adding debian:Entrust_Root_Certification_Authority_-_G2.pem Adding debian:Entrust_Root_Certification_Authority_-_G4.pem Adding debian:GDCA_TrustAUTH_R5_ROOT.pem Adding debian:GLOBALTRUST_2020.pem Adding debian:GTS_Root_R1.pem Adding debian:GTS_Root_R2.pem Adding debian:GTS_Root_R3.pem Adding debian:GTS_Root_R4.pem Adding debian:GlobalSign_ECC_Root_CA_-_R4.pem Adding debian:GlobalSign_ECC_Root_CA_-_R5.pem Adding debian:GlobalSign_Root_CA.pem Adding debian:GlobalSign_Root_CA_-_R3.pem Adding debian:GlobalSign_Root_CA_-_R6.pem Adding debian:GlobalSign_Root_E46.pem Adding debian:GlobalSign_Root_R46.pem Adding debian:Go_Daddy_Class_2_CA.pem Adding debian:Go_Daddy_Root_Certificate_Authority_-_G2.pem Adding debian:HARICA_TLS_ECC_Root_CA_2021.pem Adding debian:HARICA_TLS_RSA_Root_CA_2021.pem Adding debian:Hellenic_Academic_and_Research_Institutions_ECC_RootCA_2015.pem Adding debian:Hellenic_Academic_and_Research_Institutions_RootCA_2015.pem Adding debian:HiPKI_Root_CA_-_G1.pem Adding debian:Hongkong_Post_Root_CA_3.pem Adding debian:ISRG_Root_X1.pem Adding debian:ISRG_Root_X2.pem Adding debian:IdenTrust_Commercial_Root_CA_1.pem Adding debian:IdenTrust_Public_Sector_Root_CA_1.pem Adding debian:Izenpe.com.pem Adding debian:Microsec_e-Szigno_Root_CA_2009.pem Adding debian:Microsoft_ECC_Root_Certificate_Authority_2017.pem Adding debian:Microsoft_RSA_Root_Certificate_Authority_2017.pem Adding debian:NAVER_Global_Root_Certification_Authority.pem Adding debian:NetLock_Arany_=Class_Gold=_Főtanúsítvány.pem Adding debian:OISTE_WISeKey_Global_Root_GB_CA.pem Adding debian:OISTE_WISeKey_Global_Root_GC_CA.pem Adding debian:QuoVadis_Root_CA_1_G3.pem Adding debian:QuoVadis_Root_CA_2.pem Adding debian:QuoVadis_Root_CA_2_G3.pem Adding debian:QuoVadis_Root_CA_3.pem Adding debian:QuoVadis_Root_CA_3_G3.pem Adding debian:SSL.com_EV_Root_Certification_Authority_ECC.pem Adding debian:SSL.com_EV_Root_Certification_Authority_RSA_R2.pem Adding debian:SSL.com_Root_Certification_Authority_ECC.pem Adding debian:SSL.com_Root_Certification_Authority_RSA.pem Adding debian:SSL.com_TLS_ECC_Root_CA_2022.pem Adding debian:SSL.com_TLS_RSA_Root_CA_2022.pem Adding debian:SZAFIR_ROOT_CA2.pem Adding debian:Sectigo_Public_Server_Authentication_Root_E46.pem Adding debian:Sectigo_Public_Server_Authentication_Root_R46.pem Adding debian:SecureSign_RootCA11.pem Adding debian:SecureTrust_CA.pem Adding debian:Secure_Global_CA.pem Adding debian:Security_Communication_ECC_RootCA1.pem Adding debian:Security_Communication_RootCA2.pem Adding debian:Security_Communication_RootCA3.pem Adding debian:Security_Communication_Root_CA.pem Adding debian:Starfield_Class_2_CA.pem Adding debian:Starfield_Root_Certificate_Authority_-_G2.pem Adding debian:Starfield_Services_Root_Certificate_Authority_-_G2.pem Adding debian:SwissSign_Gold_CA_-_G2.pem Adding debian:SwissSign_Silver_CA_-_G2.pem Adding debian:T-TeleSec_GlobalRoot_Class_2.pem Adding debian:T-TeleSec_GlobalRoot_Class_3.pem Adding debian:TUBITAK_Kamu_SM_SSL_Kok_Sertifikasi_-_Surum_1.pem Adding debian:TWCA_Global_Root_CA.pem Adding debian:TWCA_Root_Certification_Authority.pem Adding debian:TeliaSonera_Root_CA_v1.pem Adding debian:Telia_Root_CA_v2.pem Adding debian:TrustAsia_Global_Root_CA_G3.pem Adding debian:TrustAsia_Global_Root_CA_G4.pem Adding debian:Trustwave_Global_Certification_Authority.pem Adding debian:Trustwave_Global_ECC_P256_Certification_Authority.pem Adding debian:Trustwave_Global_ECC_P384_Certification_Authority.pem Adding debian:TunTrust_Root_CA.pem Adding debian:UCA_Extended_Validation_Root.pem Adding debian:UCA_Global_G2_Root.pem Adding debian:USERTrust_ECC_Certification_Authority.pem Adding debian:USERTrust_RSA_Certification_Authority.pem Adding debian:XRamp_Global_CA_Root.pem Adding debian:certSIGN_ROOT_CA.pem Adding debian:certSIGN_Root_CA_G2.pem Adding debian:e-Szigno_Root_CA_2017.pem Adding debian:ePKI_Root_Certification_Authority.pem Adding debian:emSign_ECC_Root_CA_-_C3.pem Adding debian:emSign_ECC_Root_CA_-_G3.pem Adding debian:emSign_Root_CA_-_C1.pem Adding debian:emSign_Root_CA_-_G1.pem Adding debian:vTrus_ECC_Root_CA.pem Adding debian:vTrus_Root_CA.pem done. Setting up maven-repo-helper (1.11) ... Setting up antlr (2.7.7+dfsg-13) ... Setting up openjdk-17-jdk-headless:armhf (17.0.10+7-1) ... update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/jar to provide /usr/bin/jar (jar) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/jarsigner to provide /usr/bin/jarsigner (jarsigner) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/javac to provide /usr/bin/javac (javac) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/javadoc to provide /usr/bin/javadoc (javadoc) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/javap to provide /usr/bin/javap (javap) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/jcmd to provide /usr/bin/jcmd (jcmd) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/jdb to provide /usr/bin/jdb (jdb) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/jdeprscan to provide /usr/bin/jdeprscan (jdeprscan) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/jdeps to provide /usr/bin/jdeps (jdeps) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/jfr to provide /usr/bin/jfr (jfr) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/jimage to provide /usr/bin/jimage (jimage) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/jinfo to provide /usr/bin/jinfo (jinfo) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/jlink to provide /usr/bin/jlink (jlink) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/jmap to provide /usr/bin/jmap (jmap) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/jmod to provide /usr/bin/jmod (jmod) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/jps to provide /usr/bin/jps (jps) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/jrunscript to provide /usr/bin/jrunscript (jrunscript) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/jshell to provide /usr/bin/jshell (jshell) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/jstack to provide /usr/bin/jstack (jstack) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/jstat to provide /usr/bin/jstat (jstat) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/jstatd to provide /usr/bin/jstatd (jstatd) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/serialver to provide /usr/bin/serialver (serialver) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/jhsdb to provide /usr/bin/jhsdb (jhsdb) in auto mode Setting up ivy (2.5.2-1) ... Setting up ant (1.10.14-1) ... Setting up junit4 (4.13.2-4) ... Setting up groovy (2.4.21-10) ... update-alternatives: using /usr/share/groovy/bin/groovy to provide /usr/bin/groovy (groovy) in auto mode update-alternatives: using /usr/share/groovy/bin/groovyc to provide /usr/bin/groovyc (groovyc) in auto mode update-alternatives: using /usr/share/groovy/bin/grape to provide /usr/bin/grape (grape) in auto mode update-alternatives: using /usr/share/groovy/bin/startGroovy to provide /usr/bin/startGroovy (startGroovy) in auto mode update-alternatives: using /usr/share/groovy/bin/groovysh to provide /usr/bin/groovysh (groovysh) in auto mode update-alternatives: using /usr/share/groovy/bin/java2groovy to provide /usr/bin/java2groovy (java2groovy) in auto mode update-alternatives: using /usr/share/groovy/bin/groovyConsole to provide /usr/bin/groovyConsole (groovyConsole) in auto mode update-alternatives: using /usr/share/groovy/bin/groovydoc to provide /usr/bin/groovydoc (groovydoc) in auto mode Setting up default-jre-headless (2:1.17-75) ... Setting up openjdk-17-jre:armhf (17.0.10+7-1) ... Setting up default-jre (2:1.17-75) ... Setting up openjdk-17-jdk:armhf (17.0.10+7-1) ... update-alternatives: using /usr/lib/jvm/java-17-openjdk-armhf/bin/jconsole to provide /usr/bin/jconsole (jconsole) in auto mode Setting up ant-optional (1.10.14-1) ... Setting up bnd (5.0.1-5) ... Setting up default-jdk-headless (2:1.17-75) ... Setting up libgradle-core-java (4.4.1-20) ... Setting up libgradle-plugins-java (4.4.1-20) ... Setting up gradle (4.4.1-20) ... Setting up default-jdk (2:1.17-75) ... Setting up gradle-debian-helper (2.4) ... Processing triggers for ca-certificates (20240203) ... Updating certificates in /etc/ssl/certs... 0 added, 0 removed; done. Running hooks in /etc/ca-certificates/update.d... done. Processing triggers for ca-certificates-java (20240118) ... done. Reading package lists... Building dependency tree... Reading state information... Reading extended state information... Initializing package states... Writing extended state information... Building tag database... -> Finished parsing the build-deps I: Building the package I: user script /srv/workspace/pbuilder/1635/tmp/hooks/A99_set_merged_usr starting Not re-configuring usrmerge for trixie I: user script /srv/workspace/pbuilder/1635/tmp/hooks/A99_set_merged_usr finished hostname: Name or service not known I: Running cd /build/reproducible-path/milib-2.2.0+dfsg/ && env PATH="/usr/sbin:/usr/bin:/sbin:/bin:/usr/games:/i/capture/the/path" HOME="/nonexistent/second-build" dpkg-buildpackage -us -uc -b && env PATH="/usr/sbin:/usr/bin:/sbin:/bin:/usr/games:/i/capture/the/path" HOME="/nonexistent/second-build" dpkg-genchanges -S > ../milib_2.2.0+dfsg-1_source.changes dpkg-buildpackage: info: source package milib dpkg-buildpackage: info: source version 2.2.0+dfsg-1 dpkg-buildpackage: info: source distribution unstable dpkg-buildpackage: info: source changed by Pierre Gruet dpkg-source --before-build . dpkg-buildpackage: info: host architecture armhf debian/rules clean dh clean --with javahelper --with maven_repo_helper debian/rules override_dh_auto_clean make[1]: Entering directory '/build/reproducible-path/milib-2.2.0+dfsg' dh_auto_clean # Clearing the build.gradle file we provide rm build.gradle rm: cannot remove 'build.gradle': No such file or directory make[1]: [debian/rules:11: override_dh_auto_clean] Error 1 (ignored) make[1]: Leaving directory '/build/reproducible-path/milib-2.2.0+dfsg' jh_clean dh_clean debian/rules binary dh binary --with javahelper --with maven_repo_helper dh_update_autotools_config dh_autoreconf debian/rules override_dh_auto_configure make[1]: Entering directory '/build/reproducible-path/milib-2.2.0+dfsg' # Adding the upstream version number (without +dfsg) to the build.gradle file # we got by patching build.gradle.kts sed "s/\(^group.*\)/\1\nversion = '2.2.0+dfsg'/ ; s/\+dfsg[[:digit:]]*//" build.gradle.kts > build.gradle dh_auto_configure make[1]: Leaving directory '/build/reproducible-path/milib-2.2.0+dfsg' jh_linkjars dh_auto_build mkdir -p .gradle/init.d cp /usr/share/gradle-debian-helper/init.gradle .gradle/init.d/ gradle --info --console plain --offline --stacktrace --no-daemon --refresh-dependencies --gradle-user-home .gradle -Duser.home=. -Duser.name=debian -Ddebian.package=milib -Dfile.encoding=UTF-8 --parallel --max-workers=4 jar openjdk version "17.0.10" 2024-01-16 OpenJDK Runtime Environment (build 17.0.10+7-Debian-1) OpenJDK Server VM (build 17.0.10+7-Debian-1, mixed mode, sharing) Initialized native services in: /build/reproducible-path/milib-2.2.0+dfsg/.gradle/native To honour the JVM settings for this build a new JVM will be forked. Please consider using the daemon: https://docs.gradle.org/4.4.1/userguide/gradle_daemon.html. Starting process 'Gradle build daemon'. Working directory: /build/reproducible-path/milib-2.2.0+dfsg/.gradle/daemon/4.4.1 Command: /usr/lib/jvm/java-17-openjdk-armhf/bin/java --add-opens java.base/java.lang=ALL-UNNAMED -Xbootclasspath/a:/usr/share/java/gradle-helper-hook.jar:/usr/share/java/maven-repo-helper.jar -Dfile.encoding=UTF-8 -Duser.country=US -Duser.language=en -Duser.variant -cp /usr/share/gradle/lib/gradle-launcher-4.4.1.jar org.gradle.launcher.daemon.bootstrap.GradleDaemon 4.4.1 Successfully started process 'Gradle build daemon' An attempt to start the daemon took 2.966 secs. The client will now receive all logging from the daemon (pid: 15249). The daemon log file: /build/reproducible-path/milib-2.2.0+dfsg/.gradle/daemon/4.4.1/daemon-15249.out.log Daemon will be stopped at the end of the build stopping after processing Closing daemon's stdin at end of input. The daemon will no longer process any standard input. Using 4 worker leases. Creating new cache for fileHashes, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/caches/4.4.1/fileHashes/fileHashes.bin, access org.gradle.cache.internal.DefaultCacheAccess@1d4b4e6 Creating new cache for resourceHashesCache, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/caches/4.4.1/fileHashes/resourceHashesCache.bin, access org.gradle.cache.internal.DefaultCacheAccess@1d4b4e6 Creating new cache for fileHashes, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/4.4.1/fileHashes/fileHashes.bin, access org.gradle.cache.internal.DefaultCacheAccess@5ffc5b Starting Build Compiling initialization script '/build/reproducible-path/milib-2.2.0+dfsg/.gradle/init.d/init.gradle' using SubsetScriptTransformer. Creating new cache for metadata-1.1/results, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/caches/transforms-1/metadata-1.1/results.bin, access org.gradle.cache.internal.DefaultCacheAccess@14b4cf3 Compiling initialization script '/build/reproducible-path/milib-2.2.0+dfsg/.gradle/init.d/init.gradle' using BuildScriptTransformer. Settings evaluated using settings file '/build/reproducible-path/milib-2.2.0+dfsg/settings.gradle'. Settings file not found (/build/reproducible-path/milib-2.2.0+dfsg/settings.gradle) Root project name not defined in settings.gradle, defaulting to 'milib' instead of the name of the root directory 'milib-2.2.0+dfsg' Projects loaded. Root project using build file '/build/reproducible-path/milib-2.2.0+dfsg/build.gradle'. Included projects: [root project 'milib'] Keep-alive timer started Adding Debian repository to project 'milib' Parallel execution is an incubating feature. Evaluating root project 'milib' using build file '/build/reproducible-path/milib-2.2.0+dfsg/build.gradle'. Compiling build file '/build/reproducible-path/milib-2.2.0+dfsg/build.gradle' using SubsetScriptTransformer. Compiling build file '/build/reproducible-path/milib-2.2.0+dfsg/build.gradle' using BuildScriptTransformer. Adding Maven pom generation to project 'milib' Linking the generated javadoc to the system JDK API documentation All projects evaluated. Selected primary task 'jar' from project : Creating new cache for annotation-processors, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/4.4.1/fileContent/annotation-processors.bin, access org.gradle.cache.internal.DefaultCacheAccess@e1761a Tasks to be executed: [task ':compileJava', task ':processResources', task ':classes', task ':debianMavenPom', task ':jar'] Creating new cache for resourceHashesCache, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/4.4.1/fileHashes/resourceHashesCache.bin, access org.gradle.cache.internal.DefaultCacheAccess@5ffc5b Creating new cache for taskHistory, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/4.4.1/taskHistory/taskHistory.bin, access org.gradle.cache.internal.DefaultCacheAccess@352dbe Creating new cache for outputFiles, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/buildOutputCleanup/outputFiles.bin, access org.gradle.cache.internal.DefaultCacheAccess@11ec6d0 :compileJava (Thread[Task worker for ':',5,main]) started. :compileJava Putting task artifact state for task ':compileJava' into context took 0.012 secs. Creating new cache for metadata-2.36/module-metadata, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/caches/modules-2/metadata-2.36/module-metadata.bin, access org.gradle.cache.internal.DefaultCacheAccess@17e0ba9 Loading the Maven rules... Replacing org.apache.commons:commons-math3:jar:3.6.1 -> org.apache.commons:commons-math3:jar:debian Replacing cc.redberry:pipe:jar:1.3.0 -> cc.redberry:pipe:jar:1.0.0-alpha0 Replacing com.fasterxml.jackson:jackson-bom:jar:2.14.0 -> com.fasterxml.jackson:jackson-bom:jar:debian Passing through com.fasterxml.jackson:jackson-parent:jar:debian Passing through com.fasterxml:oss-parent:jar:debian Passing through com.fasterxml.jackson.core:jackson-databind:jar:2.x Passing through com.fasterxml.jackson:jackson-base:jar:debian Passing through com.fasterxml.jackson:jackson-bom:jar:debian Replacing org.apache.commons:commons-compress:jar:1.21 -> org.apache.commons:commons-compress:jar:debian Passing through org.apache.commons:commons-parent:jar:debian Passing through org.apache:apache:jar:debian Replacing commons-io:commons-io:jar:2.11.0 -> commons-io:commons-io:jar:debian Replacing org.lz4:lz4-java:jar:1.8.0 -> org.lz4:lz4-java:jar:debian Replacing com.beust:jcommander:jar:1.72 -> com.beust:jcommander:jar:debian Replacing net.sf.trove4j:trove4j:jar:3.0.3 -> net.sf.trove4j:trove4j:jar:debian Replacing com.google.guava:guava:jar:31.1-jre -> com.google.guava:guava:jar:debian Passing through com.google.guava:guava-parent:jar:debian Passing through com.fasterxml.jackson.core:jackson-annotations:jar:2.x Passing through com.fasterxml.jackson.core:jackson-core:jar:2.x Passing through org.jsr-305:jsr305:jar:0.x Passing through com.google.errorprone:error_prone_annotations:jar:debian Passing through com.google.errorprone:error_prone_parent:jar:debian Malformed jar [jackson-databind-2.x.jar] found on classpath. Gradle 5.0 will no longer allow malformed jars on a classpath. at org.gradle.api.internal.changedetection.state.AbstractClasspathSnapshotBuilder$JarHasher.hashMalformedZip(AbstractClasspathSnapshotBuilder.java:120) at org.gradle.api.internal.changedetection.state.AbstractClasspathSnapshotBuilder$JarHasher.hashJarContents(AbstractClasspathSnapshotBuilder.java:115) at org.gradle.api.internal.changedetection.state.AbstractClasspathSnapshotBuilder$JarHasher.hash(AbstractClasspathSnapshotBuilder.java:93) at org.gradle.api.internal.changedetection.state.ResourceSnapshotterCacheService.hashFile(ResourceSnapshotterCacheService.java:44) at org.gradle.api.internal.changedetection.state.AbstractClasspathSnapshotBuilder.visitJar(AbstractClasspathSnapshotBuilder.java:83) at org.gradle.api.internal.changedetection.state.AbstractClasspathSnapshotBuilder.visitFileSnapshot(AbstractClasspathSnapshotBuilder.java:76) at org.gradle.api.internal.changedetection.state.AbstractFileCollectionSnapshotter$FileCollectionVisitorImpl.visitCollection(AbstractFileCollectionSnapshotter.java:77) at org.gradle.api.internal.file.AbstractFileCollection.visitRootElements(AbstractFileCollection.java:234) at org.gradle.api.internal.file.CompositeFileCollection.visitRootElements(CompositeFileCollection.java:185) at org.gradle.api.internal.changedetection.state.AbstractFileCollectionSnapshotter.snapshot(AbstractFileCollectionSnapshotter.java:53) at org.gradle.api.internal.changedetection.state.DefaultCompileClasspathSnapshotter.snapshot(DefaultCompileClasspathSnapshotter.java:38) at org.gradle.api.internal.changedetection.state.CacheBackedTaskHistoryRepository.snapshotTaskFiles(CacheBackedTaskHistoryRepository.java:331) at org.gradle.api.internal.changedetection.state.CacheBackedTaskHistoryRepository.createExecution(CacheBackedTaskHistoryRepository.java:154) at org.gradle.api.internal.changedetection.state.CacheBackedTaskHistoryRepository.access$100(CacheBackedTaskHistoryRepository.java:61) at org.gradle.api.internal.changedetection.state.CacheBackedTaskHistoryRepository$1.getCurrentExecution(CacheBackedTaskHistoryRepository.java:114) at org.gradle.api.internal.changedetection.changes.DefaultTaskArtifactStateRepository$TaskArtifactStateImpl.getStates(DefaultTaskArtifactStateRepository.java:201) at org.gradle.api.internal.changedetection.changes.DefaultTaskArtifactStateRepository$TaskArtifactStateImpl.isUpToDate(DefaultTaskArtifactStateRepository.java:86) at org.gradle.api.internal.tasks.execution.SkipUpToDateTaskExecuter.execute(SkipUpToDateTaskExecuter.java:53) at org.gradle.api.internal.tasks.execution.ResolveTaskOutputCachingStateExecuter.execute(ResolveTaskOutputCachingStateExecuter.java:54) at org.gradle.api.internal.tasks.execution.ValidatingTaskExecuter.execute(ValidatingTaskExecuter.java:60) at org.gradle.api.internal.tasks.execution.SkipEmptySourceFilesTaskExecuter.execute(SkipEmptySourceFilesTaskExecuter.java:97) at org.gradle.api.internal.tasks.execution.CleanupStaleOutputsExecuter.execute(CleanupStaleOutputsExecuter.java:87) at org.gradle.api.internal.tasks.execution.ResolveTaskArtifactStateTaskExecuter.execute(ResolveTaskArtifactStateTaskExecuter.java:52) at org.gradle.api.internal.tasks.execution.SkipTaskWithNoActionsExecuter.execute(SkipTaskWithNoActionsExecuter.java:52) at org.gradle.api.internal.tasks.execution.SkipOnlyIfTaskExecuter.execute(SkipOnlyIfTaskExecuter.java:54) at org.gradle.api.internal.tasks.execution.ExecuteAtMostOnceTaskExecuter.execute(ExecuteAtMostOnceTaskExecuter.java:43) at org.gradle.api.internal.tasks.execution.CatchExceptionTaskExecuter.execute(CatchExceptionTaskExecuter.java:34) at org.gradle.execution.taskgraph.DefaultTaskGraphExecuter$EventFiringTaskWorker$1.run(DefaultTaskGraphExecuter.java:248) at org.gradle.internal.progress.DefaultBuildOperationExecutor$RunnableBuildOperationWorker.execute(DefaultBuildOperationExecutor.java:336) at org.gradle.internal.progress.DefaultBuildOperationExecutor$RunnableBuildOperationWorker.execute(DefaultBuildOperationExecutor.java:328) at org.gradle.internal.progress.DefaultBuildOperationExecutor.execute(DefaultBuildOperationExecutor.java:199) at org.gradle.internal.progress.DefaultBuildOperationExecutor.run(DefaultBuildOperationExecutor.java:110) at org.gradle.execution.taskgraph.DefaultTaskGraphExecuter$EventFiringTaskWorker.execute(DefaultTaskGraphExecuter.java:241) at org.gradle.execution.taskgraph.DefaultTaskGraphExecuter$EventFiringTaskWorker.execute(DefaultTaskGraphExecuter.java:230) at org.gradle.execution.taskgraph.DefaultTaskPlanExecutor$TaskExecutorWorker.processTask(DefaultTaskPlanExecutor.java:123) at org.gradle.execution.taskgraph.DefaultTaskPlanExecutor$TaskExecutorWorker.access$200(DefaultTaskPlanExecutor.java:79) at org.gradle.execution.taskgraph.DefaultTaskPlanExecutor$TaskExecutorWorker$1.execute(DefaultTaskPlanExecutor.java:104) at org.gradle.execution.taskgraph.DefaultTaskPlanExecutor$TaskExecutorWorker$1.execute(DefaultTaskPlanExecutor.java:98) at org.gradle.execution.taskgraph.DefaultTaskExecutionPlan.execute(DefaultTaskExecutionPlan.java:626) at org.gradle.execution.taskgraph.DefaultTaskExecutionPlan.executeWithTask(DefaultTaskExecutionPlan.java:581) at org.gradle.execution.taskgraph.DefaultTaskPlanExecutor$TaskExecutorWorker.run(DefaultTaskPlanExecutor.java:98) at org.gradle.internal.concurrent.ExecutorPolicy$CatchAndRecordFailures.onExecute(ExecutorPolicy.java:63) at org.gradle.internal.concurrent.ManagedExecutorImpl$1.run(ManagedExecutorImpl.java:46) at java.base/java.util.concurrent.ThreadPoolExecutor.runWorker(ThreadPoolExecutor.java:1136) at java.base/java.util.concurrent.ThreadPoolExecutor$Worker.run(ThreadPoolExecutor.java:635) at org.gradle.internal.concurrent.ThreadFactoryImpl$ManagedThreadRunnable.run(ThreadFactoryImpl.java:55) at java.base/java.lang.Thread.run(Thread.java:840) Up-to-date check for task ':compileJava' took 9.01 secs. It is not up-to-date because: No history is available. All input files are considered out-of-date for incremental task ':compileJava'. Compiling with JDK Java compiler API. Note: Some input files use or override a deprecated API. Note: Recompile with -Xlint:deprecation for details. Note: Some input files use unchecked or unsafe operations. Note: Recompile with -Xlint:unchecked for details. :compileJava (Thread[Task worker for ':',5,main]) completed. Took 30.406 secs. :processResources (Thread[Task worker for ':',5,main]) started. :processResources Putting task artifact state for task ':processResources' into context took 0.0 secs. Up-to-date check for task ':processResources' took 0.033 secs. It is not up-to-date because: No history is available. :processResources (Thread[Task worker for ':',5,main]) completed. Took 0.135 secs. :classes (Thread[Task worker for ':',5,main]) started. :classes Skipping task ':classes' as it has no actions. :classes (Thread[Task worker for ':',5,main]) completed. Took 0.002 secs. :debianMavenPom (Thread[Task worker for ':',5,main]) started. :debianMavenPom Putting task artifact state for task ':debianMavenPom' into context took 0.0 secs. Up-to-date check for task ':debianMavenPom' took 0.002 secs. It is not up-to-date because: No history is available. Generating pom file /build/reproducible-path/milib-2.2.0+dfsg/build/debian/milib.pom :debianMavenPom (Thread[Task worker for ':',5,main]) completed. Took 0.236 secs. :jar (Thread[Task worker for ':',5,main]) started. :jar Putting task artifact state for task ':jar' into context took 0.0 secs. Up-to-date check for task ':jar' took 0.174 secs. It is not up-to-date because: No history is available. :jar (Thread[Task worker for ':',5,main]) completed. Took 0.863 secs. BUILD SUCCESSFUL in 48s 4 actionable tasks: 4 executed dh_auto_test mkdir -p .gradle/init.d cp /usr/share/gradle-debian-helper/init.gradle .gradle/init.d/ gradle --info --console plain --offline --stacktrace --no-daemon --refresh-dependencies --gradle-user-home .gradle -Duser.home=. -Duser.name=debian -Ddebian.package=milib -Dfile.encoding=UTF-8 --parallel --max-workers=4 test openjdk version "17.0.10" 2024-01-16 OpenJDK Runtime Environment (build 17.0.10+7-Debian-1) OpenJDK Server VM (build 17.0.10+7-Debian-1, mixed mode, sharing) Initialized native services in: /build/reproducible-path/milib-2.2.0+dfsg/.gradle/native To honour the JVM settings for this build a new JVM will be forked. Please consider using the daemon: https://docs.gradle.org/4.4.1/userguide/gradle_daemon.html. Starting process 'Gradle build daemon'. Working directory: /build/reproducible-path/milib-2.2.0+dfsg/.gradle/daemon/4.4.1 Command: /usr/lib/jvm/java-17-openjdk-armhf/bin/java --add-opens java.base/java.lang=ALL-UNNAMED -Xbootclasspath/a:/usr/share/java/gradle-helper-hook.jar:/usr/share/java/maven-repo-helper.jar -Dfile.encoding=UTF-8 -Duser.country=US -Duser.language=en -Duser.variant -cp /usr/share/gradle/lib/gradle-launcher-4.4.1.jar org.gradle.launcher.daemon.bootstrap.GradleDaemon 4.4.1 Successfully started process 'Gradle build daemon' An attempt to start the daemon took 2.752 secs. The client will now receive all logging from the daemon (pid: 16067). The daemon log file: /build/reproducible-path/milib-2.2.0+dfsg/.gradle/daemon/4.4.1/daemon-16067.out.log Daemon will be stopped at the end of the build stopping after processing Closing daemon's stdin at end of input. The daemon will no longer process any standard input. Using 4 worker leases. Creating new cache for fileHashes, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/caches/4.4.1/fileHashes/fileHashes.bin, access org.gradle.cache.internal.DefaultCacheAccess@3c69f7 Creating new cache for resourceHashesCache, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/caches/4.4.1/fileHashes/resourceHashesCache.bin, access org.gradle.cache.internal.DefaultCacheAccess@3c69f7 Creating new cache for fileHashes, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/4.4.1/fileHashes/fileHashes.bin, access org.gradle.cache.internal.DefaultCacheAccess@1ca60b5 Starting Build Creating new cache for metadata-1.1/results, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/caches/transforms-1/metadata-1.1/results.bin, access org.gradle.cache.internal.DefaultCacheAccess@84fd57 Settings evaluated using settings file '/build/reproducible-path/milib-2.2.0+dfsg/settings.gradle'. Settings file not found (/build/reproducible-path/milib-2.2.0+dfsg/settings.gradle) Root project name not defined in settings.gradle, defaulting to 'milib' instead of the name of the root directory 'milib-2.2.0+dfsg' Projects loaded. Root project using build file '/build/reproducible-path/milib-2.2.0+dfsg/build.gradle'. Included projects: [root project 'milib'] Keep-alive timer started Adding Debian repository to project 'milib' Parallel execution is an incubating feature. Evaluating root project 'milib' using build file '/build/reproducible-path/milib-2.2.0+dfsg/build.gradle'. Adding Maven pom generation to project 'milib' Linking the generated javadoc to the system JDK API documentation All projects evaluated. Selected primary task 'test' from project : Creating new cache for annotation-processors, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/4.4.1/fileContent/annotation-processors.bin, access org.gradle.cache.internal.DefaultCacheAccess@ef9ea0 Tasks to be executed: [task ':compileJava', task ':processResources', task ':classes', task ':compileTestJava', task ':processTestResources', task ':testClasses', task ':test'] Creating new cache for resourceHashesCache, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/4.4.1/fileHashes/resourceHashesCache.bin, access org.gradle.cache.internal.DefaultCacheAccess@1ca60b5 Creating new cache for taskHistory, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/4.4.1/taskHistory/taskHistory.bin, access org.gradle.cache.internal.DefaultCacheAccess@c1d111 Creating new cache for outputFiles, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/buildOutputCleanup/outputFiles.bin, access org.gradle.cache.internal.DefaultCacheAccess@e01ae9 :compileJava (Thread[Task worker for ':' Thread 2,5,main]) started. :compileJava Putting task artifact state for task ':compileJava' into context took 0.013 secs. Creating new cache for metadata-2.36/module-metadata, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/caches/modules-2/metadata-2.36/module-metadata.bin, access org.gradle.cache.internal.DefaultCacheAccess@1470af0 Loading the Maven rules... Replacing org.apache.commons:commons-math3:jar:3.6.1 -> org.apache.commons:commons-math3:jar:debian Replacing cc.redberry:pipe:jar:1.3.0 -> cc.redberry:pipe:jar:1.0.0-alpha0 Replacing com.fasterxml.jackson:jackson-bom:jar:2.14.0 -> com.fasterxml.jackson:jackson-bom:jar:debian Passing through com.fasterxml.jackson:jackson-parent:jar:debian Passing through com.fasterxml:oss-parent:jar:debian Passing through com.fasterxml.jackson.core:jackson-databind:jar:2.x Passing through com.fasterxml.jackson:jackson-base:jar:debian Passing through com.fasterxml.jackson:jackson-bom:jar:debian Replacing org.apache.commons:commons-compress:jar:1.21 -> org.apache.commons:commons-compress:jar:debian Passing through org.apache.commons:commons-parent:jar:debian Passing through org.apache:apache:jar:debian Replacing commons-io:commons-io:jar:2.11.0 -> commons-io:commons-io:jar:debian Replacing org.lz4:lz4-java:jar:1.8.0 -> org.lz4:lz4-java:jar:debian Replacing com.beust:jcommander:jar:1.72 -> com.beust:jcommander:jar:debian Replacing net.sf.trove4j:trove4j:jar:3.0.3 -> net.sf.trove4j:trove4j:jar:debian Replacing com.google.guava:guava:jar:31.1-jre -> com.google.guava:guava:jar:debian Passing through com.google.guava:guava-parent:jar:debian Passing through com.fasterxml.jackson.core:jackson-annotations:jar:2.x Passing through com.fasterxml.jackson.core:jackson-core:jar:2.x Passing through org.jsr-305:jsr305:jar:0.x Passing through com.google.errorprone:error_prone_annotations:jar:debian Passing through com.google.errorprone:error_prone_parent:jar:debian Skipping task ':compileJava' as it is up-to-date (took 2.417 secs). :compileJava UP-TO-DATE :compileJava (Thread[Task worker for ':' Thread 2,5,main]) completed. Took 2.503 secs. :processResources (Thread[Task worker for ':' Thread 2,5,main]) started. :processResources Putting task artifact state for task ':processResources' into context took 0.0 secs. Skipping task ':processResources' as it is up-to-date (took 0.029 secs). :processResources UP-TO-DATE :processResources (Thread[Task worker for ':' Thread 2,5,main]) completed. Took 0.038 secs. :classes (Thread[Task worker for ':' Thread 3,5,main]) started. :classes Skipping task ':classes' as it has no actions. :classes UP-TO-DATE :classes (Thread[Task worker for ':' Thread 3,5,main]) completed. Took 0.002 secs. :compileTestJava (Thread[Task worker for ':' Thread 3,5,main]) started. :compileTestJava Putting task artifact state for task ':compileTestJava' into context took 0.0 secs. Replacing junit:junit:jar:4.13.2 -> junit:junit:jar:4.x Replacing org.mockito:mockito-all:jar:1.10.19 -> org.mockito:mockito-all:jar:debian org.mockito:mockito-all:debian is relocated to org.mockito:mockito-core:debian. Please update your dependencies. Passing through org.hamcrest:hamcrest:jar:debian Passing through org.mockito:mockito-core:jar:debian Passing through net.bytebuddy:byte-buddy:jar:debian Passing through net.bytebuddy:byte-buddy-parent:jar:debian Passing through net.bytebuddy:byte-buddy-agent:jar:debian Passing through org.objenesis:objenesis:jar:debian Passing through org.objenesis:objenesis-parent:jar:debian Passing through net.bytebuddy:byte-buddy-dep:jar:debian Passing through org.ow2.asm:asm:jar:debian Passing through org.ow2.asm:asm-commons:jar:debian Up-to-date check for task ':compileTestJava' took 6.496 secs. It is not up-to-date because: No history is available. All input files are considered out-of-date for incremental task ':compileTestJava'. Compiling with JDK Java compiler API. Note: Some input files use or override a deprecated API. Note: Recompile with -Xlint:deprecation for details. Note: Some input files use unchecked or unsafe operations. Note: Recompile with -Xlint:unchecked for details. :compileTestJava (Thread[Task worker for ':' Thread 3,5,main]) completed. Took 24.125 secs. :processTestResources (Thread[Task worker for ':' Thread 3,5,main]) started. :processTestResources Putting task artifact state for task ':processTestResources' into context took 0.0 secs. Up-to-date check for task ':processTestResources' took 0.051 secs. It is not up-to-date because: No history is available. :processTestResources (Thread[Task worker for ':' Thread 3,5,main]) completed. Took 0.137 secs. :testClasses (Thread[Task worker for ':' Thread 3,5,main]) started. :testClasses Skipping task ':testClasses' as it has no actions. :testClasses (Thread[Task worker for ':' Thread 3,5,main]) completed. Took 0.002 secs. :test (Thread[Task worker for ':' Thread 3,5,main]) started. :test Putting task artifact state for task ':test' into context took 0.0 secs. Up-to-date check for task ':test' took 2.117 secs. It is not up-to-date because: No history is available. Starting process 'Gradle Test Executor 1'. Working directory: /build/reproducible-path/milib-2.2.0+dfsg Command: /usr/lib/jvm/java-17-openjdk-armhf/bin/java -Dorg.gradle.native=false @/tmp/gradle-worker-classpath478129266545092559txt -Xms1024m -Xmx2048m -Dfile.encoding=UTF-8 -Duser.country=US -Duser.language=en -Duser.variant -ea worker.org.gradle.process.internal.worker.GradleWorkerMain 'Gradle Test Executor 1' Successfully started process 'Gradle Test Executor 1' Gradle Test Executor 1 started executing tests. com.milaboratory.core.motif.BitapPatternTest > ttt STANDARD_OUT 0 ATTWCCGACA 9 ||| |||| 20 ATTT--GACA 27 [S3:W->T,D4:C,D5:C] 24 -26 com.milaboratory.core.mutations.MutationsUtilTest > test1111 STANDARD_OUT S([\QAGCTNRYSWKMBDHV\E])(\d+)([\QAGCTNRYSWKMBDHV\E])|D([\QAGCTNRYSWKMBDHV\E])(\d+)|I(\d+)([\QAGCTNRYSWKMBDHV\E]) S([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E])(\d+)([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E])|D([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E])(\d+)|I(\d+)([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E]) com.milaboratory.core.mutations.MutationsUtilTest > nt2AAWithMappingManual1 STANDARD_OUT [I2C::SM0I, I2G::I1A, I2C::I1A, SG2C:SM0I:I1A] com.milaboratory.core.mutations.MutationsUtilTest > nt2AAWithMappingManual2 STANDARD_OUT [S0:T->N,D13:V,S14:S->Y,S15:P->R,S16:W->P,S17:Y->G,S18:D->T,S19:P->I,S20:G->P,S21:D->A,S22:K->T,S23:A->K,S24:F->R,S25:G->S,S26:P->D,I27:S] [-1, -1, 9, 15] com.milaboratory.core.mutations.MutationsUtilTest > nt2AAWithMappingManual3 STANDARD_OUT 0 CAGGTTCAGCTGGTGCAGTCTGGAGCTGAGGTGAAGAAGCCTGGGGCCTCAGTGAAGGTCTCCTGCAAGGCTTCTGGTTACACCTTTACCAGCTACGGTATCAGCTGGGTGCGACAGGCCCCTGGACAAGGGCTTGAGTGGATGGGATGGATCAGCGCTTACAATGGTAACACAAACTATGCACAGAAGCTCCAGGGCAGAGTCACCATGACCACAGACACATCCACGAGCACAGCCTACATGGAGCTGAGGAGCCTGAGATCTGACGACACGGCCGTGTATTACTGTGCGAGAGA 295 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||| ||||| ||||||||||||||||||||||||||||| ||||||||| ||||||||| ||||||||||||||||||| || ||||| ||| || |||||||||||||| 0 CAGGTTCAGCTGGTGCAGTCTGGAGCTGAGGTGAAGAAGCCTGGGGCCTCAGTGAAGGTCTCCTGCAAGGCTTCTGGTTACACCTTTACCAGCTACGGTATCAGCTGGGTGCGACAGGCCCCTGGACAAGGGCTTGAGTGGATGGGATGGATCAGCGCTTACAATGGTAACACATTCTATGCAGAGAAGTTCCAGGGCAGAGTCACCATGACCACAGACGCATCCACGACCACAGCCTATATGGAGCTGAGGAGCCTGACATTTGACG-----GCCACATACTACTGTGCGAGAGA 290 [S58:N->F,S61:Q->E,S63:L->F,S73:T->A,S76:S->T,S86:R->T,S87:S->F,S89:D->G,D90:T,D91:A,S92:V->H,S93:Y->I,S94:Y->L,S95:C->L,S96:A->C,S97:R->E,S98:_->R] QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYGISWVRQAPGQGLEWMGWISAYNGNTFYAEKFQGRVTMTTDASTTTAYMELRSLTFDGHILLCER QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYGISWVRQAPGQGLEWMGWISAYNGNTFYAEKFQGRVTMTTDASTTTAYMELRSLTFDGHILLCER [S58:N->F,S61:Q->E,S63:L->F,S73:T->A,S76:S->T,S86:R->T,S87:S->F,S89:D->G,D90:T,D91:A,S92:V->H,S93:Y->I,S94:Y->L,S95:C->L,S96:A->C,S97:R->E,S98:_->R] [0, 0, 1, 2, 3, 4, -1, 5, 6, 7, 7, 8, 8, 8, 10, 10, 11, 12] com.milaboratory.core.mutations.MutationsUtilTest > nt2AAWithMappingManual4 STANDARD_OUT [S3:S->M,D4:D,S5:_->I] com.milaboratory.core.mutations.MutationTest > exportRegexps STANDARD_OUT S([\QAGCTNRYSWKMBDHV\E])(\d+)([\QAGCTNRYSWKMBDHV\E])|D([\QAGCTNRYSWKMBDHV\E])(\d+)|I(\d+)([\QAGCTNRYSWKMBDHV\E]) S([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E])(\d+)([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E])|D([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E])(\d+)|I(\d+)([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E]) com.milaboratory.core.mutations.MutationsTest > testCanonical1 STANDARD_OUT TCCGCCATCACAGCAAAGACGTGAGGAAAAACAACCCAGTACATGGTACGAAGATGATCTCGTCTATCAACCCGGGGCGGCTGCTAGCCACGAGATTACGCCGCCCCTAGGTTTTTCCAGATACATTACCCAAGGCCTTGGCATTGAGCACTAATCGATAGTTACTCGTGCCAAGATGTAACGCAAAGAATTTACTCGTTCTCTCGACGCTAACGATGGTCAGGGATAGTGTTGACGTCCCTATGTGGTTACTCTTCCCTACGCCTGGATGCGTTGCGCTATACAGGACAGTTTTTTATTTTGGTGCCCCCGTATCGTTACACATTGAGTTGGCAGCTGAAGATTGCACGCCACCCCCCCGCGGGCTGACGGTTGTAAGCCTACCCCTAGTCTGGCGGACTAATTATTCTCGAGTAAATAAAAGCGTCAAGTGAGACTCGATTCTAATGCACATTGCGGGGTTCTCCATTGTAATATTCCCATAACACTCCTGCAGTAATAGCCGTATCTAATAACGTACCTTCTTCCCCACTGAGACTTACAGTCATTGGGTCGACTGTTTGATGACCAACCGCGGGGCTATAGGGGCAAGCTCACTGGGGGGGAACATGCGGGTGATGGGCGCTAACCGCCCGCAGTGACATGCACATGTCAGTCGGCGACTACAGTCCGGGCGTAATCTATTTTTCATCAGCTCGGCTCGCTTATCTTACCGTTATAAGTGCTTTCAG TCCTCCATCACAGCAAAGACGTGAGGAAAAGACAACCCAGTACATGGTACGAAGATGATCTCGTCTTCAACCCGGGGCGGCTACTAGCCCACGAGATTACGCCGCCCCTGGGTTTTTCCAGATACATTACCCAAGGCCTTGGCATTGAGCACTAACTCGAAGTTTCTCGTGCGAATGTAACGCAAAAGAAATTTCACTCGTTCTCTGACGTAACGAATGGTCAGGGATAGTGTTGACGTCCCCATGTGGTTACTCTCCTACGTCTGGATGACGTTGCGCCTATACAGGCAGTTTTTTATTTTGGTGTCCCCGTATCGTTACACATGAGTTGGCAGCTAAGATTGCACGCCACCCTCCCCGCGGGCTCGGTTGTAAGCTACCCCTAGTCTGGCGGACTAATTATTTCGAGTAAAAATAAGCGCAAGATGAGACTCGATTCTAATGCACATTTCGGGTTCTCCTTGTAATAATCCCATATACACTCCTGCAGTAGTAGCCGTACAATAACGTACCTTCTTCCCCACTAGACTTACAAAGCATTGGGTCGACTATTTGATGACCAACCGCGGGGCTATAGTGCAAGCTCCACTGGGGGGGAACATGGGGTTATGGCGCTACGCCCGCAGTGACATGCTCAGTCAGTCGGCGACTGACAGTCCGGGCGTAATCTATTTTCCATCAGCTCGGCTCGCTTATCTTACCGTTTAAGTGCTTTAG TCCTCCATCACAGCAAGGATGTGAGGAAAGACAACCCAGTACATGGTACGAAGATGATCTCGTCTTCAACCCGGGGTCGGCACTGCGCCCACAATTACGCCGCCCCCGGTTTTTTCCAGATACTTACCCAAGCCTTGGCATTAGCACTAATGAAGTTTCTCGTGCGAATGTAACGCAAAAGAAATTTCATCTCTTCTCTGACGTAACGAATGGTCTTGGAAGGTTGCGCTCCCCATGGGTTATCTCCACGTCTGGTGACGTGTGCGCCTATACAGGCAGTTTTTATTTTGGTGTCCCCGTATGTTACACATGAGTGGCAGCTAAGATTGCACGCCACCCTCCCGCTGGCTCGTTGAACTACCCCTAGTCTAGCTGACCAATTATTCGATAAAAATAAGCCGAAGATGAGACTCGACCTAATGCACATTTCGGGTTCTCCTGTAAGTAATCCCATATACACTCCTACGGTAATAGCCGTACAATAAGTCCTCTTCCCTCTAGACTTACAAAGCATGGTCGACTATTTGATGACCAACGCGCGGGGCTATGTGCAAGCTCCACTGGGAGGAACATGGGGTATGGCTCACGCCCGCGAGTGACACTCAGTCAGTGGCGACTGACAGTCCGGGCGTAATCTATTTTCCATCAGTTCGGCTCGCTTATCATTACCGTTTAAGTGCTTTAG 0 TCCTCCATCACAGCAAGGATGTGAGGAAAGACAACCCAGTACATGGTACGAAGATGATCTCGTCT-TCAACCCGGGGTCGGCACTGC--GCCCAC-A-ATTACGCCGCCCC-CGGTTTTTTCCAGATAC-TTACCCAA-GCCTTGGCATT-AGCACTAAT-GA-AGTTTCTCGTG-CGA-ATGTAACGCAAAAGAAATTTCATCTC-TTCTCT-GACG-TAACGAATGGTCTTGGA-AG-GTTG-CGCTCCCCATG-GGTTA-TC-T-CC-ACGTCTGG-TGACGTGTGCGCCTATACAGG-CAG-TTTTTATTTTGGTGTCCCCGTAT-GTTACACA-TGAG-TGGCAGCT-AAGATTGCACGCCACCCTCCCGCTGGCT--C-GTTG-AA--CTACCCCTAGTCTAGCTGACCAATTA-T-TCGA-TAAA-AATAAGC--CGAAGATGAGACTCGA-CCTAATGCACATTTC-GGGTTCTCC--TGTAAGTAATCCCATATACACTCCTACGGTAATAGCCGTA-C-AATAA-GT-CC-TCTT-CCCTCT-AGACTTACAAAG-CA-T-GGTCGACTATTTGATGACCAACGCGCGGGGCTAT--GTGCAAGCTCCACT-GGGAGGAACATG-GGGT-AT--G-GCTCA-CGCCCGCGAGTGACA--CTCA-GTCAGT-GGCGACTGACAGTCCGGGCGTAATCTATTTTCCATCAGTTCGGCTCGCTTATCATTACCGTT-TAAGTGCTTT-AG 684 ||| |||||||||||| || ||||||||| ||||||||||||||||||||||||||||||||||| ||||||||||| ||| |||| | |||| | ||||||||||||| || ||||||||||||| |||||||| ||||||||||| ||||||||| || |||| |||||| | | ||||||||| |||| ||||| | ||| |||||| |||| ||||| |||||| ||| || |||| || |||| ||| ||||| || | || ||| |||| || ||| |||| ||||||||| ||| |||||||||||||| |||||||| |||||||| |||| |||||||| ||||||||||||||||| ||||| |||| | |||| || ||||||||||||| || ||| ||||| | |||| |||| || |||| | ||| |||||||||| |||||||||||| | ||||||||| ||||| || ||||||| |||||||| | |||||||||||| | ||||| || || |||| ||| || |||||||| || || | |||||||| ||||||||||||| ||||||||||| | ||||||| |||| ||| |||||||| |||| || | ||| | ||||||| ||||||| | || |||||| ||||||| ||||||||||||||||||||||| |||||| |||||||||||||| |||||||| |||||||||| || 0 TCCGCCATCACAGCAAAGACGTGAGGAAAAACAACCCAGTACATGGTACGAAGATGATCTCGTCTATCAACCCGGGG-CGG--CTGCTAG-CCACGAGATTACGCCGCCCCTAGG-TTTTTCCAGATACATTACCCAAGGCCTTGGCATTGAGCACTAATCGATAGTTACTCGTGCCAAGATGTAACGC-AAAG-AATTT-A-CTCGTTCTCTCGACGCTAACG-ATGGTCAGGGATAGTGTTGACG-TCCCTATGTGGTTACTCTTCCCTACGCCTGGATG-CGT-TGCG-CTATACAGGACAGTTTTTTATTTTGGTGCCCCCGTATCGTTACACATTGAGTTGGCAGCTGAAGATTGCACGCCACCCCCCCGCGGGCTGACGGTTGTAAGCCTACCCCTAGTCTGGCGGACTAATTATTCTCGAGTAAATAA-AAGCGTC-AAG-TGAGACTCGATTCTAATGCACATTGCGGGGTTCTCCATTGTAA-TATTCCCATA-ACACTCCTGCAGTAATAGCCGTATCTAATAACGTACCTTCTTCCCCACTGAGACTTAC--AGTCATTGGGTCGACTGTTTGATGACCAAC-CGCGGGGCTATAGGGGCAAGCT-CACTGGGGGGGAACATGCGGGTGATGGGCGCTAACCGCCCGC-AGTGACATGCACATGTCAGTCGGCGACT-ACAGTCCGGGCGTAATCTATTTTTCATCAGCTCGGCTCGCTTATC-TTACCGTTATAAGTGCTTTCAG 730 [D26:A,I30:A,I73:G,D76:G,D80:C,D81:T,D82:G,S85:A->G,I86:C,I86:T,I86:A,I104:C,I106:T,S106:C->A,D107:T,S108:A->G,D110:G,I133:G,D134:G,I221:A,S221:A->G,D222:G,I254:T,S255:T->C,S258:C->T,D259:T,I291:T,D293:T,I324:T,D325:T,I329:T,D330:T,I356:C,D357:C,I367:G,S367:G->A,D368:A,I378:G,S378:G->C,D379:C,I406:T,S407:T->C,D408:C,I425:G,S425:G->T,D426:T,I441:T,D442:T,I467:A,S467:A->T,D468:T,I526:C,S529:C->A,D530:A,I583:A,S583:A->G,D587:G,I598:G,D600:G,I619:G,I619:G,I620:C,D621:G,S623:G->T,S624:C->A,D625:T,S627:A->C,D629:C,I643:T,S643:T->G,D644:G] 0 TCCGCCATCACAGCAAAGACGTGAGGAAAA-ACAACCCAGTACATGGTACGAAGATGATCTCGTCTATCAACCC-GGGGCGGCTGCTA---GCCACGAGATTACGCCGC-CC-CTAGGTTTTTCCAGATACATTACCCAA-GGCCTTGGCATTGAGCACTAATCGATAGTTACTCGTGCCAAGATGTAACGCAAAGAATTTACTCGTTCTCTCGACGCTAACGATGGTC-AGGGATAGTGTTGACGTCCCTATGTGGTTACTC-TTCCCTACGCCTGGATGCGTTGCGCTATACAGGACAG-TTTTTTATTTTGGTGCCCCCGTATCGTTACACA-TTGAG-TTGGCAGCTGAAGATTGCACGCCACCC-CCCCGCGGGCT-GACGGTTGTAA-GCCTACCCCTAGTCTGGCGGACTAATTA-TTCTCGAGTAAATAAAAGC-GTCAAGTGAGACTCGA-TTCTAATGCACATTGCGGGGTTCTCC-ATTGTAATATTCCCATAACACTCCTGCAGTAATAGCCGTATCTAATAACGTACCTTCTT-CCCCACTGAGACTTACAGTCATTGGGTCGACTGTTTGATGACCAACCGCGGGGCTAT-AGGGGCAAGCTCACT-GGGGGGGAACATGCGGGTGAT--G-GGCGCTAACCGCCCGCAGTGACA-TGCACATGTCAGTCGGCGACTACAGTCCGGGCGTAATCTATTTTTCATCAGCTCGGCTCGCTTATCTTACCGTTATAAGTGCTTTCAG 730 |||||||||||||||||||||||||| ||| ||||||||||||||||||||||||||||||||||||||||||| ||| ||| || |||||||||||||||||| || | |||||||||||||||||||||| | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||| | || ||||||||||||||||||||||||||||||| || |||||||||||||||||||||||||||||| | ||| | ||||||||||||||||||||||||| | ||||||||| ||||||||| |||||||||||||||||||||||||| | |||||||||||||||| |||||||||||||| | |||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||| |||||||||||||||||||||||||||||||||||||||||||||||||||| ||| |||||||||| || |||||||||||||||||| | | | | | ||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| 0 TCCGCCATCACAGCAAAGACGTGAGG-AAAAACAACCCAGTACATGGTACGAAGATGATCTCGTCTATCAACCCGGGG-CGG---CTGCTAGCCACGAGATTACGCCGCCCCTA-GG-TTTTTCCAGATACATTACCCAAGG-CCTTGGCATTGAGCACTAATCGATAGTTACTCGTGCCAAGATGTAACGCAAAGAATTTACTCGTTCTCTCGACGCTAACGATGGTCAG-GGATAGTGTTGACGTCCCTATGTGGTTACTCTTCCCT-ACGCCTGGATGCGTTGCGCTATACAGGACAGTTT-TTTATTTTGGTGCCCCCGTATCGTTACACATT-GAGTT-GGCAGCTGAAGATTGCACGCCACCCCC-CCGCGGGCTGA-CGGTTGTAAGC-CTACCCCTAGTCTGGCGGACTAATTATTC-TCGAGTAAATAAAAGCGT-CAAGTGAGACTCGATT-CTAATGCACATTGCGGGGTTCTCCAT-TGTAATATTCCCATAACACTCCTGCAGTAATAGCCGTATCTAATAACGTACCTTCTTCCCCA-CTGAGACTTACAGTCATTGGGTCGACTGTTTGATGACCAACCGCGGGGCTATAGGGG-CAAGCTCACTGGG-GGGGAACATGCGGGTGATGGGCG-CTA-ACC-GCCCGCAGTGACATG-CACATGTCAGTCGGCGACTACAGTCCGGGCGTAATCTATTTTTCATCAGCTCGGCTCGCTTATCTTACCGTTATAAGTGCTTTCAG 730 com.milaboratory.core.merger.MergerParametersTest > test2 STANDARD_OUT { "qualityMergingAlgorithm": "SumSubtraction", "partsLayout": "Collinear", "minimalOverlap": 15, "maxQuality": 50, "minimalIdentity": 0.8, "identityType": "Unweighted" } com.milaboratory.core.RangeTest > test23e14 STANDARD_OUT 1000001 1010100 1000111 1000011 1000010 com.milaboratory.core.tree.PrimerGenerator > generate SKIPPED com.milaboratory.core.tree.SequenceTreeMapTest > testCase9 STANDARD_OUT Hit 1 0 ac-gacTtgactg 11 0 acTgac-tgactg 11 Hit 2 0 ac-gactTgactg 11 0 acTgact-gactg 11 com.milaboratory.core.tree.SequenceTreeMapTest > optimalityAndScopeTest STANDARD_OUT --NW alignments-- CASSLAPGATN-KLFF CASS-APGATNEKLFF CASSLAPGATN-KLFF CASSLAPG-TNEKLFF CASSLAPGATN-KLfF CASSLAPG-TNEKLyF --STM alignments-- CASSLAPGATN-KLFF CASS-APGATNEKLFF CASSLAPGATN-KLFF CASSLAPG-TNEKLFF CASSlAPGATN-KLFF CASSa-PGATNEKLFF CASSLAPGaTN-KLFF CASSLAPGt-NEKLFF CASSlAPGATN-KLFF CA-SsAPGATNEKLFF CASSlAPGATN-KLFF CAS-sAPGATNEKLFF CASSLAPGATNk-LFF CASS-APGATNeKLFF CASSLAPGaTN-KLFF CASSLAP-gTNEKLFF CASSLAPGATNk-LFF CASSLAPG-TNeKLFF CASSLAPGATN-KLfF CASSLAPG-TNEKLyF ------------------ com.milaboratory.core.io.sequence.fasta.RandomAccessFastaReaderTest > test1nt STANDARD_ERROR Indexing milib_f4655911efe6769308d5676d1a1a6665c03a395e17677624757433102313.fasta: 0% Indexing milib_f4655911efe6769308d5676d1a1a6665c03a395e17677624757433102313.fasta: done com.milaboratory.core.io.sequence.fasta.RandomAccessFastaReaderTest > test1 STANDARD_ERROR Indexing milib_f4655911efe6769308d5676d1a1a6665c03a395e17677624757433102313.fasta: 0% Indexing milib_f4655911efe6769308d5676d1a1a6665c03a395e17677624757433102313.fasta: done com.milaboratory.core.io.sequence.fasta.RandomAccessFastaReaderTest > test2 STANDARD_ERROR Indexing milib_b737b4a22d18e6a3f5b3cd68c18a3016f1844e7e13917634565446873680.tmp: 0% Indexing milib_b737b4a22d18e6a3f5b3cd68c18a3016f1844e7e13917634565446873680.tmp: done com.milaboratory.core.io.util.IOUtilTest > test111 STANDARD_OUT 3 3 -2147483648 -9223372036854775808 com.milaboratory.core.sequence.GeneticCodeTest > generateExtendedGeneticCode SKIPPED com.milaboratory.core.sequence.quality.QualityTrimmerTest > testParametersSerialization0 STANDARD_OUT { "averageQualityThreshold": 7.0, "windowSize": 6 } com.milaboratory.core.sequence.quality.QualityAggregatorTest > test1 STANDARD_OUT 48 com.milaboratory.core.sequence.quality.QualityAggregatorTest > test2 STANDARD_OUT 610 com.milaboratory.core.sequence.quality.QualityAggregatorTest > test3 STANDARD_OUT 2509 com.milaboratory.core.sequence.ShortSequenceSetTest > test1 STANDARD_OUT 99953 elements with 366.06KiB in raw nucleotide entropy serialized into 272.85KiB com.milaboratory.core.sequence.AminoAcidAlphabetTest > testCalculateMatches SKIPPED com.milaboratory.core.sequence.AminoAcidSequenceTest > testName STANDARD_OUT 3 com.milaboratory.core.sequence.AminoAcidSequenceTest > testConvertPositionSync1 STANDARD_OUT FromCenter 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 FromLeftWithoutIncompleteCodon 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 FromLeftWithIncompleteCodon 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 FromRightWithoutIncompleteCodon 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 FromRightWithIncompleteCodon 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 com.milaboratory.core.sequence.NucleotideAlphabetTest > testCalculateIntersections SKIPPED com.milaboratory.core.alignment.AlignerTest > testCalculateScore1 STANDARD_OUT 4.45us 4.55us 3.23us com.milaboratory.core.alignment.AlignmentHelperTest > test1 STANDARD_OUT 0 GAGGTGCAGCTGGTGGAGTCTGGGGGAGGC 29 |||||||||||||||||||||||||||||| 0 GAGGTGCAGCTGGTGGAGTCTGGGGGAGGC 29 30 TTGGT-ACAGCCTGGGGGGTCCCTGAGACT 58 |||| | |||||||||||||| |||||| 30 CTGGTCA-AGCCTGGGGGGTCCATGAGACA 58 59 CTCCTGTGCAGCCTCTGGATTCACCTTCAG 88 |||||||||||||||||||||| ||||||| 59 CTCCTGTGCAGCCTCTGGATTCCCCTTCAG 88 89 TAGC-TATAGCATGAACTGGGTCCGCCAGG 117 || | ||||||||||||||||||||||||| 89 TA-CTTATAGCATGAACTGGGTCCGCCAGG 117 118 CTCCAGGGAAGGGGCTGGAGTGGGTTTCAT 147 ||||||||||||||||||||||||| |||| 118 CTCCAGGGAAGGGGCTGGAGTGGGTCTCAT 147 148 ACATTAGTAGTAGTAGTAG-TACCATATAC 176 |||||||||| ||||||| || |||||| 148 CCATTAGTAGTGGTAGTAGTTA-CATATAT 176 177 TACGCAGACTCTGTGAAGGGCCGATTCACC 206 ||||||||||| |||||||||||||||||| 177 TACGCAGACTCCGTGAAGGGCCGATTCACC 206 207 ATCTCCAGAGACAATGCCAAGAACTCACTG 236 |||||||||||||| ||||||||||||||| 207 ATCTCCAGAGACAACGCCAAGAACTCACTG 236 237 TATCTGCAAATGAACAGCCTGAGAGACGAG 266 ||||||||||||||||||||||||| |||| 237 TATCTGCAAATGAACAGCCTGAGAGCCGAG 266 267 GACACGGCTGTGTATTACTGTGC 289 ||||||||||||||||||||||| 267 GACACGGCTGTGTATTACTGTGC 289 com.milaboratory.core.alignment.AlignmentIteratorTest > test1 STANDARD_OUT 0 -ATT-AGACA-- 7 ||| || | 0 AATTGGGA-ATT 10 I0AI3GSA3GDC6I8TI8T com.milaboratory.core.alignment.BandedAffineAlignerTest > test11 STANDARD_OUT 0 --------------------- -1 0 ATAAAAAAAAAAACGAGCTAG 20 0 --------------------- -1 0 ATAAAAAAAAAAACGAGCTAG 20 com.milaboratory.core.alignment.BandedAffineAlignerTest > test23 STANDARD_OUT 0 atgcggggatgc 11 0 atgcggggatgc 11 com.milaboratory.core.alignment.BandedAffineAlignerTest > test1 STANDARD_OUT 0 at-----------cgagctagTTTTTTTTTTT 20 0 atAAAAAAAAAAAcgagctag----------- 20 0 at-----------cgagctagTTTTTTTTTTT 20 0 atAAAAAAAAAAAcgagctag----------- 20 com.milaboratory.core.alignment.BandedAffineAlignerTest > test2 STANDARD_OUT 0 atgcGGGGatgc 11 0 atgcTA--atgc 9 0 atgcGGGGatgc----------- 11 0 atgcTA--atgcTTTTTTTTTTT 20 com.milaboratory.core.alignment.BandedAffineAlignerTest > test3 STANDARD_OUT 0 cgtaGGGGcgta 11 11 cgta--ATcgta 20 0 -----------cgtaGGGGcgta 11 0 TTTTTTTTTTTcgtaAT--cgta 20 com.milaboratory.core.alignment.BandedAffineAlignerTest > test4 STANDARD_OUT 0 atgcggggat-gTTTTT 15 0 atgcggggatAg----- 11 0 atgcggggat-gTTTTTTT 17 0 atgcggggatAg------- 11 com.milaboratory.core.alignment.BandedAffineAlignerTest > test5 STANDARD_OUT 7 g-taggggcgta 17 0 gAtaggggcgta 11 0 TTTTTTTg-taggggcgta 17 0 -------gAtaggggcgta 11 com.milaboratory.core.alignment.BandedAffineAlignerTest > test6 STANDARD_OUT 0 0 0 0 com.milaboratory.core.alignment.BandedAffineAlignerTest > semiGlobalLeft1 STANDARD_OUT 0 gCccTtgtgatgacccagactccagcctccgtgGAGgCaGctgtgggaggcacagtcaccatcaagtgccaggccagtcagagcattagcaacctcttaGCCTGGTATCAGCAGAAACCAGGGCAGCCTCCCAAGCTCCTGATCTATTATGCATCCGATCTGGcatctggggtctcatcaaggttcaaaggcagtggatctgggacagagtAcactctcaccatcagTggcgtgcagtgtgccgatgctgccacttactac 260 1 gAccCtgtgatgacccagactccagcctccgtgTCTgAaCctgtgggaggcacagtcaccatcaagtgccaggccagtcagagcattagcaacctctta-------------------------------------------------------------NNNcatctggggtctcatcaaggttcaaaggcagtggatctgggacagagtTcactctcaccatcagCggcgtgcagtgtgccgatgctgccacttactac 200 com.milaboratory.core.alignment.kaligner2.OffsetPacksAccumulatorTest > testScoreCorrection2 SKIPPED com.milaboratory.core.alignment.kaligner2.KAligner2Test > testBoundaries STANDARD_OUT 4957 com.milaboratory.core.alignment.kaligner2.KAligner2Test > caseJ1 STANDARD_OUT 52 0 TGATGCTTTTGATATCTGGGGCCAAGGGACAATGGTCACCGTCTCTTCAGGA 51 ||||||||||||||||||||||||||||||||||||||||||||||||||| 55 TGATGCTTTTGATATCTGGGGCCAAGGGACAATGGTCACCGTCTCTTCAGGG 106 [S51:A->G] (0->52) (55->107) com.milaboratory.core.alignment.kaligner2.KAligner2Test > testCase0 SKIPPED com.milaboratory.core.alignment.kaligner2.KAligner2Test > testSimpleRandomTest STANDARD_OUT Time per query: 1.92ms Processed queries: 23 Bad percent: 0.0 False positive percent: 0.7040876197926853 Scoring error percent: 0.0 com.milaboratory.core.alignment.kaligner2.KMapper2Test > test11112 STANDARD_OUT ID: 0 Score: 1620 Cluster 0: Q 27 -> T 15 - -12 Q 30 -> T 18 - -12 Q 39 -> T 28 - -11 Q 42 -> T 31 - -11 Q 45 -> T 34 - -11 Q 48 -> T 37 - -11 Q 51 -> T 40 - -11 Cluster 1: Q 84 -> T 50 - -34 Q 87 -> T 53 - -34 Q 90 -> T 56 - -34 Q 93 -> T 59 - -34 Q 96 -> T 62 - -34 Q 99 -> T 65 - -34 Q 111 -> T 79 - -32 Q 114 -> T 82 - -32 Cluster 2: Q 150 -> T 92 - -58 Q 153 -> T 95 - -58 Q 156 -> T 98 - -58 Q 159 -> T 101 - -58 Cluster 3: Q 201 -> T 123 - -78 Q 204 -> T 126 - -78 Q 207 -> T 129 - -78 Q 216 -> T 139 - -77 Q 219 -> T 142 - -77 Q 222 -> T 145 - -77 Q 234 -> T 156 - -78 Q 237 -> T 159 - -78 Cluster 4: Q 246 -> T 178 - -68 Q 249 -> T 181 - -68 Q 252 -> T 184 - -68 Q 255 -> T 187 - -68 Q 258 -> T 190 - -68 Q 261 -> T 193 - -68 Q 262 -> T 194 - -68 com.milaboratory.core.alignment.kaligner2.KMapper2Test > test1111 STANDARD_OUT ID: 0 Score: 1260 Cluster 0: Q 9 -> T 15 - 6 Q 12 -> T 18 - 6 Q 15 -> T 21 - 6 Q 18 -> T 24 - 6 Q 21 -> T 27 - 6 Q 24 -> T 30 - 6 Q 27 -> T 33 - 6 Q 30 -> T 36 - 6 Cluster 1: Q 57 -> T 48 - -9 Q 60 -> T 51 - -9 Q 69 -> T 61 - -8 Q 78 -> T 69 - -9 Q 81 -> T 72 - -9 Q 84 -> T 75 - -9 Cluster 2: Q 123 -> T 89 - -34 Q 126 -> T 92 - -34 Q 129 -> T 95 - -34 Q 132 -> T 98 - -34 Q 135 -> T 101 - -34 Q 150 -> T 116 - -34 Q 168 -> T 132 - -36 Q 171 -> T 135 - -36 Q 174 -> T 138 - -36 Q 177 -> T 141 - -36 Q 180 -> T 144 - -36 Q 183 -> T 147 - -36 Q 185 -> T 149 - -36 com.milaboratory.core.alignment.kaligner2.KMapper2Test > testRandom1 STANDARD_OUT noHits: 269 noHits2: 0 noHits3: 0 wrongTopHit: 36 wrongTopHitS: 25 noCorrectHitInList: 14 Timings: DescriptiveStatistics: n: 100000 min: 12979.0 max: 4.26172795E8 mean: 222583.6180099821 std dev: 3426431.4372672574 median: 173124.0 skewness: 98.47286053934224 kurtosis: 9950.251640753775 Clusters basicSize DescriptiveStatistics: n: 99695 min: 1.0 max: 6.0 mean: 2.8425798685992345 std dev: 1.1014567162109217 median: 3.0 skewness: 0.32469019242645786 kurtosis: -0.6613133739096413 Top Delta DescriptiveStatistics: n: 99717 min: -29.0 max: 0.0 mean: -0.0016145692309233084 std dev: 0.17167148412922448 median: 0.0 skewness: -121.51883851462306 kurtosis: 16244.013595552413 com.milaboratory.core.alignment.AlignmentTrimmerTest > testRandom1 STANDARD_OUT lTrimmed = 1716 rTrimmed = 1711 lTrimmed = 2881 rTrimmed = 2806 com.milaboratory.core.alignment.blast.BlastAlignerTest > test1 SKIPPED com.milaboratory.core.alignment.blast.BlastAlignerTest > simpleRandomTestT1 SKIPPED com.milaboratory.core.alignment.blast.BlastAlignerTest > simpleRandomTestT2 SKIPPED com.milaboratory.core.alignment.blast.BlastAlignerTest > simpleRandomTestT3 SKIPPED com.milaboratory.core.alignment.blast.BlastDBBuilderTest > test1 SKIPPED com.milaboratory.core.alignment.blast.BlastAlignerExtTest > test16SMicrobial1 SKIPPED com.milaboratory.core.alignment.blast.BlastAlignerExtTest > test1 SKIPPED com.milaboratory.core.alignment.kaligner1.KMapperTest > testBestOffset2 STANDARD_OUT -205 com.milaboratory.core.alignment.kaligner1.KAlignerTest > testRandomCorrectness STANDARD_OUT C=1182;I=0;M=0;ScE=0;R=0.0 AlignmentTime = 1.47ms C=1642;I=1;M=0;ScE=0;R=0.0 AlignmentTime = 499.95us C=2048;I=0;M=0;ScE=0;R=0.0 AlignmentTime = 274.26us C=2142;I=0;M=0;ScE=0;R=8.333333333333333E-7 AlignmentTime = 270.83us com.milaboratory.core.alignment.kaligner1.KAlignerTest > testRandom1 STANDARD_OUT ##teamcity[buildStatisticValue key='kmFound' value='0.9449'] ##teamcity[buildStatisticValue key='kmWrong' value='1.0E-4'] ##teamcity[buildStatisticValue key='kmFalse' value='0.0058'] com.milaboratory.core.alignment.kaligner1.KAlignerTest > testRandomCorrectnessConcurrent STANDARD_OUT C=3000;I=0;M=0;ScE=1;R=0.0 AlignmentTime = 3.14ms C=2998;I=0;M=1;ScE=2;R=0.0 AlignmentTime = 2.79ms C=2999;I=0;M=0;ScE=0;R=0.0 AlignmentTime = 325.50us C=2998;I=0;M=0;ScE=0;R=0.0 AlignmentTime = 308.56us com.milaboratory.core.alignment.MultiAlignmentHelperTest > test1 STANDARD_OUT 8 AGACACAGATACA 20 ||||||| ||||| 0 AGACACATATACA 12 0 GATACATTAGACACAGATACA--- 20 ||||||| ||||| 0 --------AGACACATATACACAG 15 0 GATACATTAGA---CACAGATACA 20 ||||||||||| |||||||||| 5 GATACATTAGAGACCACAGATACA 28 0 GATAC-----ATTAGA---CACAGATACA 20 ||||| |||||| |||||||||| 0 GATACGATACATTAGAGACCACAGATACA 28 Quality 78778 878777 7778887878 Subject 0 GATAC-----ATTAGA---CACAGATACA--- 20 Query0 0 aga---cacaTataca 12 Query1 0 -------------aga---cacaTatacaCAG 15 Query2 5 gatac-----attagaGACcacagataca 28 Query3 0 gatacGATACattagaGACcacagataca 28 Quality 78778 Subject 0 GATAC 4 Query1 0 ----- 0 Query2 5 gatac 9 Query3 0 gatac 4 Quality Subject 5 ----- 5 Query1 0 ----- 0 Query2 10 ----- 10 Query3 5 GATAC 9 Quality 87877 Subject 5 ATTAG 9 Query0 0 ag 1 Query1 0 ---ag 1 Query2 10 attag 14 Query3 10 attag 14 Quality 7 7 Subject 10 A---C 11 Query0 2 a---c 3 Query1 2 a---c 3 Query2 15 aGACc 19 Query3 15 aGACc 19 Quality 77888 Subject 12 ACAGA 16 Query0 4 acaTa 8 Query1 4 acaTa 8 Query2 20 acaga 24 Query3 20 acaga 24 Quality 7878 Subject 17 TACA- 20 Query0 9 taca 12 Query1 9 tacaC 13 Query2 25 taca 28 Query3 25 taca 28 Quality Subject 21 -- 21 Query1 14 AG 15 0 GATAC-----ATTAGA---CACAGATACA--- 20 0 ...---....T..... 12 0 -------------...---....T.....CAG 15 5 .....-----......GAC.......... 28 0 .....GATAC......GAC.......... 28 787788787777778887878 0 GATACATTAGACACAGATACA 20 com.milaboratory.core.alignment.MultiAlignmentHelperTest > test2 STANDARD_OUT 15 TATAGGGAGAACTCCGATCGACATCG 40 ||||||||| ||||||||||||||| 0 TATAGGGAG--CTCCGATCGACATCG 23 56 CGATCC--CGGTGACAAAGCGTTCGGACC 82 |||||| ||||||||||||||||||||| 0 CGATCCTTCGGTGACAAAGCGTTCGGACC 28 36 CATCGGGTATCGCCCTGGTACG 57 |||| ||||||||||||||||| 0 CATCAGGTATCGCCCTGGTACG 21 0 AACGATGGGCGCAAATATAGGGAGAACTCCGATCGACATCGGGTATCGCCCTGGTACGATCC--CGGTGACAAAGCGTTCGGACCTGTCTGGACGCTAGAACGC 101 0 tatagggag--ctccgatcgacatcg 23 0 cgatccTTcggtgacaaagcgttcggacc 28 0 catcAggtatcgccctggtacg 21 com.milaboratory.core.alignment.AlignerCustomTest > testSemiLocal0 STANDARD_OUT 29.0 2 c----cccTTgaa---tgTtaGTa-----taacta--tct 27 0 cAGTTccc--gaaACCtgCta--aGCTCTtaactaCTtct 35 29.0 2 c----cccTTgaa---tgTtaGTa-----taacta--tct 27 0 cAGTTccc--gaaACCtgCta--aGCTCTtaactaCTtct 35 com.milaboratory.core.alignment.BandedLinearAlignerTest > testCase1 STANDARD_OUT GCGTGAAGACTGCAGGCATTGAGTACGTTACTAGTCCAGTGGGGCCCAACCGTAACATTGCGTGTGACTGGTTGCTTAGCGGGTGACGGCGTTTCAGGTTACGCCCTCTGTGCATCACCGATAGCGTTGTTTGAGCTTTCTAACGTCTCAAACCTGCTTGCGCCCTACGGTTTCTCTATATATACACGAAAGGGGCTGGTCGCAACCTCGCAATTCTATCCCTCCAACCTCCCTCGAATTTTT AAAGCGTGAAGACTTGCAGGCATTGGTACGTTATTAGTCCAGTGGGGCCACAACCGTAACATTGCGTGTGACTGGTGCTTAGCGGGTGACGGCGTTCAGGTTACGCCCTCTGTGCATCACCGATTAGCGTTGTCTGAGCTTTCTAACGTCTCAAACCTGCTTGCGCCCTACGGTTTCTCTATAGTATCACGAAAGGGTCTGGTCGCAACCTCGCAATTCTATCCCTCCAACCTCCCTTGAATTTTTCTA com.milaboratory.core.alignment.BandedLinearAlignerTest > testGlobal1 STANDARD_OUT 1 AATTGACA 8 |||||| 0 TATTGACT 7 com.milaboratory.core.alignment.BandedLinearAlignerTest > testGlobal2 STANDARD_OUT 1 AATTGACAG 9 |||||| | 0 TATTGAC-G 7 com.milaboratory.core.alignment.BandedLinearAlignerTest > testGlobal3 STANDARD_OUT 0 TATTGACT 7 |||||| 1 AATTGACA 8 com.milaboratory.core.alignment.BandedLinearAlignerTest > testGlobal4 STANDARD_OUT 0 TATTGAC-G 7 |||||| | 1 AATTGACAG 9 com.milaboratory.core.alignment.AlignmentTest > testInvert STANDARD_OUT 8 AGACACAGATACA 20 ||||||| ||||| 0 AGACACATATACA 12 0 AGACACATATACA 12 ||||||| ||||| 8 AGACACAGATACA 20 0 GATACATTAGACACAGATACA--- 20 ||||||| ||||| 0 --------AGACACATATACACAG 15 0 --------AGACACATATACACAG 15 ||||||| ||||| 0 GATACATTAGACACAGATACA--- 20 0 GATACATTAGA---CACAGATACA 20 ||||||||||| |||||||||| 5 GATACATTAGAGACCACAGATACA 28 5 GATACATTAGAGACCACAGATACA 28 ||||||||||| |||||||||| 0 GATACATTAGA---CACAGATACA 20 0 GATAC-----ATTAGA---CACAGATACA 20 ||||| |||||| |||||||||| 0 GATACGATACATTAGAGACCACAGATACA 28 0 GATACGATACATTAGAGACCACAGATACA 28 ||||| |||||| |||||||||| 0 GATAC-----ATTAGA---CACAGATACA 20 com.milaboratory.core.alignment.batch.SimpleBatchAlignerTest > test1 STANDARD_OUT 4 hits. com.milaboratory.primitivio.blocks.PrimitivOBlocksTest > benchmark1 SKIPPED com.milaboratory.primitivio.blocks.PrimitivOBlocksTest > test1 STANDARD_OUT ================== High compression: false Concurrency: 4 File size: 6799510 Write time: 655.77ms O. Stats: Wall clock time: 658.45ms Total CPU time: 1.15s User wait time: 511.32ms Serialization time: 609.66ms (52.82%) Checksum calculation time: 399.68ms (34.63%) Compression time: 137.34ms (11.9%) Total IO delay: 177.59ms Concurrency overhead: 152.68ms Uncompressed size: 18.44MiB (~2.08KiB per object) Output size: 6.48MiB (~748B per object; compression = 35.17%) IO speed: 36.64MiB/s Concurrency adjusted uncompressed speed: 38.01MiB/s Actual uncompressed speed: 28.02MiB/s Actual speed: 9.85MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 748B Blocks: 62 (~107.1KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 1: Wall clock time: 437.31ms Total CPU time: 499.77ms Serialization time: 373.07ms (74.65%) Checksum calculation time: 47.91ms (9.59%) Compression time: 71.07ms (14.22%) Total IO delay: 171.17ms Input size: 6.48MiB Decompressed size: 18.44MiB (compression = 35.17%) IO speed: 37.92MiB/s Concurrency adjusted uncompressed speed: 110.4MiB/s Actual uncompressed speed: 42.19MiB/s Actual speed: 14.84MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 748B Blocks: 62 (~107.1KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 2: Wall clock time: 811.3ms Total CPU time: 740.1ms Serialization time: 485.37ms (65.58%) Checksum calculation time: 95.78ms (12.94%) Compression time: 142.41ms (19.24%) Total IO delay: 352ms Input size: 12.97MiB Decompressed size: 36.87MiB (compression = 35.17%) IO speed: 36.84MiB/s Concurrency adjusted uncompressed speed: 135.07MiB/s Actual uncompressed speed: 45.47MiB/s Actual speed: 15.99MiB/s Objects: 18158 Average object size uncompressed: 2.08KiB Average object size compressed: 748B Blocks: 124 (~107.1KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 ================== High compression: false Concurrency: 4 File size: 6791878 Write time: 217.72ms O. Stats: Wall clock time: 219.34ms Total CPU time: 263.14ms User wait time: 171.65ms Serialization time: 106.97ms (40.65%) Checksum calculation time: 59ms (22.42%) Compression time: 92.67ms (35.22%) Total IO delay: 65.15ms Concurrency overhead: 10.4ms Uncompressed size: 18.44MiB (~2.08KiB per object) Output size: 6.48MiB (~748B per object; compression = 35.13%) IO speed: 99.65MiB/s Concurrency adjusted uncompressed speed: 200.4MiB/s Actual uncompressed speed: 84.19MiB/s Actual speed: 29.58MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 748B Blocks: 20 (~331.63KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 1: Wall clock time: 258.5ms Total CPU time: 256.8ms Serialization time: 106.71ms (41.55%) Checksum calculation time: 59.03ms (22.99%) Compression time: 89.22ms (34.74%) Total IO delay: 67.87ms Input size: 6.48MiB Decompressed size: 18.44MiB (compression = 35.13%) IO speed: 96.68MiB/s Concurrency adjusted uncompressed speed: 227.62MiB/s Actual uncompressed speed: 71.46MiB/s Actual speed: 25.11MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 748B Blocks: 20 (~331.63KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 2: Wall clock time: 530.43ms Total CPU time: 485.31ms Serialization time: 182.6ms (37.62%) Checksum calculation time: 120.8ms (24.89%) Compression time: 179.04ms (36.89%) Total IO delay: 115.81ms Input size: 12.95MiB Decompressed size: 36.87MiB (compression = 35.13%) IO speed: 112.65MiB/s Concurrency adjusted uncompressed speed: 245.83MiB/s Actual uncompressed speed: 69.57MiB/s Actual speed: 24.44MiB/s Objects: 18158 Average object size uncompressed: 2.08KiB Average object size compressed: 748B Blocks: 40 (~331.63KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 ================== High compression: false Concurrency: 1 File size: 6799510 Write time: 338.17ms O. Stats: Wall clock time: 339.92ms Total CPU time: 217.9ms User wait time: 303.45ms Serialization time: 98.66ms (45.28%) Checksum calculation time: 47.92ms (21.99%) Compression time: 63.25ms (29.03%) Total IO delay: 58.22ms Concurrency overhead: 26.01ms Uncompressed size: 18.44MiB (~2.08KiB per object) Output size: 6.48MiB (~748B per object; compression = 35.17%) IO speed: 111.8MiB/s Concurrency adjusted uncompressed speed: 61.05MiB/s Actual uncompressed speed: 54.39MiB/s Actual speed: 19.13MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 748B Blocks: 62 (~107.1KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Checksum ok! I. Stats 1: Wall clock time: 240.68ms Total CPU time: 238.76ms Serialization time: 96.88ms (40.57%) Checksum calculation time: 54.63ms (22.88%) Compression time: 82.82ms (34.69%) Total IO delay: 102.48ms Input size: 6.48MiB Decompressed size: 18.44MiB (compression = 35.17%) IO speed: 63.57MiB/s Concurrency adjusted uncompressed speed: 54.07MiB/s Actual uncompressed speed: 76.82MiB/s Actual speed: 27.02MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 748B Blocks: 62 (~107.1KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 2: Wall clock time: 590.7ms Total CPU time: 506.29ms Serialization time: 194ms (38.32%) Checksum calculation time: 136.83ms (27.03%) Compression time: 157.14ms (31.04%) Total IO delay: 294.04ms Input size: 12.97MiB Decompressed size: 36.87MiB (compression = 35.17%) IO speed: 44.11MiB/s Concurrency adjusted uncompressed speed: 46.09MiB/s Actual uncompressed speed: 62.5MiB/s Actual speed: 21.98MiB/s Objects: 18158 Average object size uncompressed: 2.08KiB Average object size compressed: 748B Blocks: 124 (~107.1KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 ================== High compression: false Concurrency: 1 File size: 6791878 Write time: 270.28ms O. Stats: Wall clock time: 272.93ms Total CPU time: 202.89ms User wait time: 241.05ms Serialization time: 81.59ms (40.21%) Checksum calculation time: 46.77ms (23.05%) Compression time: 70.65ms (34.82%) Total IO delay: 36.12ms Concurrency overhead: 2.49ms Uncompressed size: 18.44MiB (~2.08KiB per object) Output size: 6.48MiB (~748B per object; compression = 35.13%) IO speed: 179.92MiB/s Concurrency adjusted uncompressed speed: 76.5MiB/s Actual uncompressed speed: 67.78MiB/s Actual speed: 23.81MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 748B Blocks: 20 (~331.63KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Checksum ok! I. Stats 1: Wall clock time: 207.15ms Total CPU time: 201.64ms Serialization time: 54.26ms (26.91%) Checksum calculation time: 63.42ms (31.45%) Compression time: 82.69ms (41.01%) Total IO delay: 57.45ms Input size: 6.48MiB Decompressed size: 18.44MiB (compression = 35.13%) IO speed: 113.64MiB/s Concurrency adjusted uncompressed speed: 71.18MiB/s Actual uncompressed speed: 89.07MiB/s Actual speed: 31.29MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 748B Blocks: 20 (~331.63KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 2: Wall clock time: 482.19ms Total CPU time: 416.42ms Serialization time: 128.11ms (30.76%) Checksum calculation time: 128.95ms (30.97%) Compression time: 157.11ms (37.73%) Total IO delay: 107.4ms Input size: 12.95MiB Decompressed size: 36.87MiB (compression = 35.13%) IO speed: 121.07MiB/s Concurrency adjusted uncompressed speed: 70.5MiB/s Actual uncompressed speed: 76.5MiB/s Actual speed: 26.88MiB/s Objects: 18158 Average object size uncompressed: 2.08KiB Average object size compressed: 748B Blocks: 40 (~331.63KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Pending / IO / Serde: 3 / 1 / 0 Pending / IO / Serde: 2 / 0 / 2 ================== High compression: true Concurrency: 4 File size: 4156299 Write time: 4.26s O. Stats: Wall clock time: 4.26s Total CPU time: 11.29s User wait time: 4.03s Serialization time: 100.32ms (0.89%) Checksum calculation time: 54.13ms (0.48%) Compression time: 11.12s (98.56%) Total IO delay: 115.42ms Concurrency overhead: 63.97ms Uncompressed size: 18.44MiB (~2.08KiB per object) Output size: 3.96MiB (~457B per object; compression = 21.5%) IO speed: 34.47MiB/s Concurrency adjusted uncompressed speed: 6.33MiB/s Actual uncompressed speed: 4.32MiB/s Actual speed: 952.12KiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 457B Blocks: 62 (~65.47KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 1: Wall clock time: 173.59ms Total CPU time: 181.26ms Serialization time: 71.23ms (39.29%) Checksum calculation time: 47.04ms (25.95%) Compression time: 58.33ms (32.18%) Total IO delay: 83.34ms Input size: 3.96MiB Decompressed size: 18.44MiB (compression = 21.5%) IO speed: 47.76MiB/s Concurrency adjusted uncompressed speed: 279.35MiB/s Actual uncompressed speed: 106.57MiB/s Actual speed: 22.91MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 457B Blocks: 62 (~65.47KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 2: Wall clock time: 380.34ms Total CPU time: 368.46ms Serialization time: 147.7ms (40.09%) Checksum calculation time: 95.65ms (25.96%) Compression time: 116.56ms (31.63%) Total IO delay: 158.94ms Input size: 7.93MiB Decompressed size: 36.87MiB (compression = 21.5%) IO speed: 50.17MiB/s Concurrency adjusted uncompressed speed: 281.48MiB/s Actual uncompressed speed: 97.04MiB/s Actual speed: 20.86MiB/s Objects: 18158 Average object size uncompressed: 2.08KiB Average object size compressed: 457B Blocks: 124 (~65.47KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Pending / IO / Serde: 2 / 0 / 2 Pending / IO / Serde: 2 / 0 / 2 Pending / IO / Serde: 1 / 0 / 1 ================== High compression: true Concurrency: 4 File size: 4098671 Write time: 6.29s O. Stats: Wall clock time: 6.29s Total CPU time: 10.43s User wait time: 5.71s Serialization time: 78.28ms (0.75%) Checksum calculation time: 46.83ms (0.45%) Compression time: 10.3s (98.76%) Total IO delay: 30.33ms Concurrency overhead: 4.19ms Uncompressed size: 18.44MiB (~2.08KiB per object) Output size: 3.91MiB (~451B per object; compression = 21.2%) IO speed: 130.29MiB/s Concurrency adjusted uncompressed speed: 7.04MiB/s Actual uncompressed speed: 2.93MiB/s Actual speed: 636.24KiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 451B Blocks: 20 (~200.13KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 1: Wall clock time: 158.87ms Total CPU time: 161.73ms Serialization time: 48.47ms (29.97%) Checksum calculation time: 50.63ms (31.31%) Compression time: 61.96ms (38.31%) Total IO delay: 16.79ms Input size: 3.91MiB Decompressed size: 18.44MiB (compression = 21.2%) IO speed: 244.3MiB/s Concurrency adjusted uncompressed speed: 419.02MiB/s Actual uncompressed speed: 116.69MiB/s Actual speed: 24.74MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 451B Blocks: 20 (~200.13KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 2: Wall clock time: 362.05ms Total CPU time: 319.47ms Serialization time: 96.74ms (30.28%) Checksum calculation time: 97.3ms (30.46%) Compression time: 124.21ms (38.88%) Total IO delay: 42.27ms Input size: 7.82MiB Decompressed size: 36.87MiB (compression = 21.2%) IO speed: 186.13MiB/s Concurrency adjusted uncompressed speed: 409.71MiB/s Actual uncompressed speed: 101.86MiB/s Actual speed: 21.6MiB/s Objects: 18158 Average object size uncompressed: 2.08KiB Average object size compressed: 451B Blocks: 40 (~200.13KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 ================== High compression: true Concurrency: 1 File size: 4156299 Write time: 9.51s O. Stats: Wall clock time: 9.51s Total CPU time: 9.42s User wait time: 9.48s Serialization time: 89.83ms (0.95%) Checksum calculation time: 47.66ms (0.51%) Compression time: 9.28s (98.45%) Total IO delay: 42.88ms Concurrency overhead: 8.17ms Uncompressed size: 18.44MiB (~2.08KiB per object) Output size: 3.96MiB (~457B per object; compression = 21.5%) IO speed: 94.38MiB/s Concurrency adjusted uncompressed speed: 1.95MiB/s Actual uncompressed speed: 1.94MiB/s Actual speed: 426.8KiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 457B Blocks: 62 (~65.47KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Checksum ok! I. Stats 1: Wall clock time: 148.66ms Total CPU time: 167.42ms Serialization time: 56.86ms (33.97%) Checksum calculation time: 48.15ms (28.76%) Compression time: 59.99ms (35.84%) Total IO delay: 40.46ms Input size: 3.96MiB Decompressed size: 18.44MiB (compression = 21.5%) IO speed: 99.09MiB/s Concurrency adjusted uncompressed speed: 89.07MiB/s Actual uncompressed speed: 124.57MiB/s Actual speed: 26.78MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 457B Blocks: 62 (~65.47KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 2: Wall clock time: 326.33ms Total CPU time: 333.38ms Serialization time: 111.54ms (33.46%) Checksum calculation time: 95.79ms (28.73%) Compression time: 119.89ms (35.96%) Total IO delay: 77.64ms Input size: 7.93MiB Decompressed size: 36.87MiB (compression = 21.5%) IO speed: 102.95MiB/s Concurrency adjusted uncompressed speed: 89.72MiB/s Actual uncompressed speed: 113.11MiB/s Actual speed: 24.32MiB/s Objects: 18158 Average object size uncompressed: 2.08KiB Average object size compressed: 457B Blocks: 124 (~65.47KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 ================== High compression: true Concurrency: 1 File size: 4098671 Write time: 10.04s O. Stats: Wall clock time: 10.04s Total CPU time: 9.98s User wait time: 10.01s Serialization time: 78.6ms (0.79%) Checksum calculation time: 47ms (0.47%) Compression time: 9.85s (98.64%) Total IO delay: 26.38ms Concurrency overhead: 2.04ms Uncompressed size: 18.44MiB (~2.08KiB per object) Output size: 3.91MiB (~451B per object; compression = 21.2%) IO speed: 150.34MiB/s Concurrency adjusted uncompressed speed: 1.84MiB/s Actual uncompressed speed: 1.84MiB/s Actual speed: 398.79KiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 451B Blocks: 20 (~200.13KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Checksum ok! I. Stats 1: Wall clock time: 152.77ms Total CPU time: 151.16ms Serialization time: 47.39ms (31.35%) Checksum calculation time: 46.84ms (30.99%) Compression time: 56.21ms (37.19%) Total IO delay: 19.27ms Input size: 3.91MiB Decompressed size: 18.44MiB (compression = 21.2%) IO speed: 205.73MiB/s Concurrency adjusted uncompressed speed: 108.45MiB/s Actual uncompressed speed: 121.3MiB/s Actual speed: 25.72MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 451B Blocks: 20 (~200.13KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 2: Wall clock time: 334.86ms Total CPU time: 301.16ms Serialization time: 94.86ms (31.5%) Checksum calculation time: 93.49ms (31.04%) Compression time: 111.4ms (36.99%) Total IO delay: 37.08ms Input size: 7.82MiB Decompressed size: 36.87MiB (compression = 21.2%) IO speed: 211.29MiB/s Concurrency adjusted uncompressed speed: 109.09MiB/s Actual uncompressed speed: 110.4MiB/s Actual speed: 23.41MiB/s Objects: 18158 Average object size uncompressed: 2.08KiB Average object size compressed: 451B Blocks: 40 (~200.13KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 com.milaboratory.primitivio.blocks.PrimitivOBlocksTest > bigBlocks STANDARD_OUT Pending / IO / Serde / Objs: 0 / 1 / 1 / 2000 Pending / IO / Serde / Objs: 0 / 1 / 1 / 5000 Pending / IO / Serde / Objs: 0 / 1 / 1 / 8000 Pending / IO / Serde / Objs: 3 / 1 / 0 / 12000 Pending / IO / Serde / Objs: 6 / 1 / 1 / 15000 Pending / IO / Serde / Objs: 7 / 1 / 0 / 17000 Pending / IO / Serde / Objs: 7 / 1 / 0 / 18000 Pending / IO / Serde / Objs: 7 / 1 / 0 / 19000 Pending / IO / Serde / Objs: 7 / 1 / 0 / 19000 Pending / IO / Serde / Objs: 7 / 1 / 0 / 20000 Pending / IO / Serde / Objs: 7 / 1 / 0 / 20000 Pending / IO / Serde / Objs: 6 / 1 / 0 / 20000 Pending / IO / Serde / Objs: 6 / 1 / 0 / 20000 Pending / IO / Serde / Objs: 6 / 1 / 0 / 20000 Pending / IO / Serde / Objs: 2 / 1 / 0 / 20000 O. Stats: Wall clock time: 31.13s Total CPU time: 9.86s User wait time: 8.86s Serialization time: 1.74s (17.69%) Checksum calculation time: 5.36s (54.4%) Compression time: 1.4s (14.18%) Total IO delay: 28.99s Concurrency overhead: 17.93ms Uncompressed size: 1.86GiB (~97.66KiB per object) Output size: 1.86GiB (~97.66KiB per object; compression = 100%) IO speed: 65.81MiB/s Concurrency adjusted uncompressed speed: 391.35MiB/s Actual uncompressed speed: 61.27MiB/s Actual speed: 61.27MiB/s Objects: 20000 Average object size uncompressed: 97.66KiB Average object size compressed: 97.66KiB Blocks: 20 (~95.37MiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 com.milaboratory.test.TestUtil > testLT STANDARD_OUT Short tests. No system env properties. com.milaboratory.util.JsonOverriderTest > test1 STANDARD_OUT WARNING: unnecessary override -Ob= with the same value. com.milaboratory.util.NSequenceWithQualityPrintHelperTest > test1 SKIPPED com.milaboratory.util.sorting.HashSorterTest > testSingleton STANDARD_OUT /tmp/milib_aee945127b385e425ffc80c643dff33168bef3171153829001150018388 timeInCollate: 16.1s timeInCollatorInit: 11.57s timeAwaitingO: 8.19ms timeAwaitingI: 2.58s timeInFinalSorting1: 0ns timeInFinalSorting2: 45.58ms timeInFinalSorting3: 141.65ms /10S (5|27|32): objs=50000 size=3.25MiB com.milaboratory.util.sorting.HashSorterTest > test1 STANDARD_OUT /tmp/milib_53df74567ccc5016930e8a54c698fe4dce829e5f2259518515305100732 timeInCollate: 40.13s timeInCollatorInit: 1.97s timeAwaitingO: 5.59s timeAwaitingI: 9.63s timeInFinalSorting1: 5.65s timeInFinalSorting2: 4.9s timeInFinalSorting3: 1.83s /0N (5|27|32): objs=158653 size=8.97MiB /1N (5|27|32): objs=163310 size=9.3MiB /2N (5|27|32): objs=150713 size=8.53MiB /3N (5|27|32): objs=156613 size=8.79MiB /4N (5|27|32): objs=159098 size=8.96MiB /5N (5|27|32): objs=151704 size=8.5MiB /6N (5|27|32): objs=158734 size=9.28MiB /7N (5|27|32): objs=147555 size=8.19MiB /8N (5|27|32): objs=156552 size=8.64MiB /9N (5|27|32): objs=151581 size=8.75MiB /10N (5|27|32): objs=155437 size=8.79MiB /11N (5|27|32): objs=160693 size=9.37MiB /12N (5|27|32): objs=162987 size=9.23MiB /13N (5|27|32): objs=154226 size=8.74MiB /14N (5|27|32): objs=152777 size=8.83MiB /15N (5|27|32): objs=153416 size=8.51MiB /16N (5|27|32): objs=158301 size=9MiB /17N (5|27|32): objs=152724 size=8.87MiB /18N (5|27|32): objs=155107 size=8.75MiB /19N (5|27|32): objs=158714 size=9.29MiB /20N (5|27|32): objs=163779 size=9.36MiB /21N (5|27|32): objs=160918 size=9.24MiB /22N (5|27|32): objs=158151 size=9.02MiB /23N (5|27|32): objs=150136 size=8.36MiB /24N (5|27|32): objs=152732 size=8.68MiB /25N (5|27|32): objs=154239 size=8.49MiB /26N (5|27|32): objs=150457 size=8.54MiB /27N (5|27|32): objs=160777 size=9.28MiB /28N (5|27|32): objs=151462 size=8.64MiB /29N (5|27|32): objs=156554 size=8.91MiB /30N (5|27|32): objs=159846 size=9.32MiB /31N (5|27|32): objs=162054 size=9.22MiB /0/0N (2|25|36): objs=27771 size=532.61KiB /0/1S (2|25|36): objs=174 size=174B /0/2N (2|25|36): objs=9192 size=45.69KiB /0/3N (2|25|36): objs=37769 size=784.57KiB /0/4N (2|25|36): objs=42863 size=1.01MiB /0/5N (2|25|36): objs=14169 size=87.83KiB /0/6S (2|25|36): objs=144 size=182B /0/8S (2|25|36): objs=166 size=139B /0/9N (2|25|36): objs=439 size=1.66KiB /0/10S (2|25|36): objs=153 size=324B /0/11N (2|25|36): objs=7452 size=37.99KiB /0/12S (2|25|36): objs=176 size=203B /0/14S (2|25|36): objs=150 size=150B /0/15N (2|25|36): objs=2278 size=10.27KiB /0/16S (2|25|36): objs=160 size=125B /0/17N (2|25|36): objs=1105 size=4.33KiB /0/18S (2|25|36): objs=161 size=221B /0/19N (2|25|36): objs=3434 size=15.74KiB /0/20S (2|25|36): objs=163 size=332B /0/21N (2|25|36): objs=1981 size=8.11KiB /0/22S (2|25|36): objs=138 size=261B /0/23N (2|25|36): objs=3209 size=14.08KiB /0/24S (2|25|36): objs=158 size=271B /0/25S (2|25|36): objs=153 size=174B /0/26S (2|25|36): objs=163 size=135B /0/27N (2|25|36): objs=916 size=3.5KiB /0/28S (2|25|36): objs=138 size=188B /0/29N (2|25|36): objs=775 size=3.11KiB /0/30S (2|25|36): objs=147 size=314B /0/31N (2|25|36): objs=1078 size=4.28KiB /0/32S (2|25|36): objs=162 size=139B /0/34S (2|25|36): objs=145 size=210B /0/35N (2|25|36): objs=1571 size=6.61KiB /1/0N (2|25|36): objs=41977 size=1.02MiB /1/1N (2|25|36): objs=38077 size=834.77KiB /1/2N (2|25|36): objs=38012 size=778.74KiB /1/3N (2|25|36): objs=18373 size=137.03KiB /1/4S (2|25|36): objs=185 size=247B /1/5N (2|25|36): objs=2748 size=11.59KiB /1/6S (2|25|36): objs=136 size=289B /1/7N (2|25|36): objs=2545 size=10.79KiB /1/8S (2|25|36): objs=167 size=196B /1/9N (2|25|36): objs=429 size=1.46KiB /1/10S (2|25|36): objs=130 size=255B /1/11N (2|25|36): objs=1871 size=7.7KiB /1/12S (2|25|36): objs=139 size=90B /1/13S (2|25|36): objs=130 size=254B /1/14S (2|25|36): objs=144 size=220B /1/15N (2|25|36): objs=303 size=968B /1/16S (2|25|36): objs=161 size=250B /1/17N (2|25|36): objs=2840 size=11.91KiB /1/18S (2|25|36): objs=141 size=238B /1/19N (2|25|36): objs=1205 size=4.9KiB /1/20S (2|25|36): objs=146 size=218B /1/21N (2|25|36): objs=741 size=2.59KiB /1/22S (2|25|36): objs=154 size=134B /1/23N (2|25|36): objs=1552 size=6.51KiB /1/24S (2|25|36): objs=155 size=176B /1/25N (2|25|36): objs=590 size=1.98KiB /1/26S (2|25|36): objs=171 size=274B /1/27N (2|25|36): objs=609 size=2.14KiB /1/28S (2|25|36): objs=138 size=304B /1/29N (2|25|36): objs=1366 size=5.7KiB /1/30S (2|25|36): objs=143 size=219B /1/31N (2|25|36): objs=738 size=2.74KiB /1/32S (2|25|36): objs=152 size=205B /1/33N (2|25|36): objs=2233 size=9.57KiB /1/34S (2|25|36): objs=133 size=150B /1/35N (2|25|36): objs=4576 size=20.27KiB /2/0N (2|25|36): objs=37094 size=752.19KiB /2/1N (2|25|36): objs=39478 size=870.15KiB /2/2N (2|25|36): objs=32590 size=701.14KiB /2/3S (2|25|36): objs=142 size=119B /2/4N (2|25|36): objs=1555 size=6.61KiB /2/5S (2|25|36): objs=147 size=103B /2/6N (2|25|36): objs=2754 size=11.82KiB /2/7N (2|25|36): objs=1369 size=5.61KiB /2/8S (2|25|36): objs=184 size=301B /2/9N (2|25|36): objs=756 size=2.86KiB /2/10S (2|25|36): objs=170 size=221B /2/11N (2|25|36): objs=593 size=2.19KiB /2/12S (2|25|36): objs=135 size=264B /2/13N (2|25|36): objs=3491 size=15.75KiB /2/14S (2|25|36): objs=159 size=304B /2/15N (2|25|36): objs=2187 size=9.47KiB /2/16S (2|25|36): objs=148 size=283B /2/17N (2|25|36): objs=3563 size=16.51KiB /2/18S (2|25|36): objs=148 size=280B /2/19N (2|25|36): objs=3759 size=17KiB /2/20S (2|25|36): objs=144 size=126B /2/21N (2|25|36): objs=2909 size=12.25KiB /2/22S (2|25|36): objs=171 size=338B /2/23N (2|25|36): objs=4620 size=20.09KiB /2/24S (2|25|36): objs=149 size=173B /2/25N (2|25|36): objs=3572 size=15.31KiB /2/26S (2|25|36): objs=166 size=296B /2/27N (2|25|36): objs=1657 size=7KiB /2/28S (2|25|36): objs=143 size=157B /2/29N (2|25|36): objs=2394 size=10.41KiB /2/30S (2|25|36): objs=173 size=331B /2/31N (2|25|36): objs=2643 size=11.87KiB /2/32S (2|25|36): objs=166 size=134B /2/33S (2|25|36): objs=119 size=82B /2/34S (2|25|36): objs=155 size=301B /2/35N (2|25|36): objs=1110 size=4.2KiB /3/0N (2|25|36): objs=43096 size=1.02MiB /3/1N (2|25|36): objs=39367 size=904.34KiB /3/2N (2|25|36): objs=19312 size=153.98KiB /3/3S (2|25|36): objs=147 size=323B /3/4N (2|25|36): objs=14600 size=79.22KiB /3/5N (2|25|36): objs=6272 size=32.84KiB /3/6S (2|25|36): objs=143 size=103B /3/7N (2|25|36): objs=2281 size=9.8KiB /3/8S (2|25|36): objs=145 size=131B /3/10S (2|25|36): objs=141 size=308B /3/11N (2|25|36): objs=3208 size=13.97KiB /3/12S (2|25|36): objs=168 size=338B /3/13N (2|25|36): objs=1071 size=4.07KiB /3/14S (2|25|36): objs=155 size=255B /3/15N (2|25|36): objs=3316 size=13.95KiB /3/16S (2|25|36): objs=154 size=134B /3/17N (2|25|36): objs=1237 size=4.99KiB /3/18S (2|25|36): objs=157 size=213B /3/19N (2|25|36): objs=289 size=1001B /3/20S (2|25|36): objs=163 size=168B /3/21N (2|25|36): objs=1305 size=5.52KiB /3/22S (2|25|36): objs=148 size=212B /3/23N (2|25|36): objs=5234 size=26.61KiB /3/24S (2|25|36): objs=159 size=291B /3/25N (2|25|36): objs=1076 size=4.31KiB /3/26S (2|25|36): objs=159 size=103B /3/28S (2|25|36): objs=151 size=334B /3/29N (2|25|36): objs=610 size=2.31KiB /3/30S (2|25|36): objs=156 size=168B /3/31N (2|25|36): objs=4747 size=25.59KiB /3/32S (2|25|36): objs=143 size=250B /3/33N (2|25|36): objs=5570 size=25.96KiB /3/34S (2|25|36): objs=152 size=281B /3/35N (2|25|36): objs=1581 size=6.42KiB /4/0N (2|25|36): objs=42375 size=1.03MiB /4/1N (2|25|36): objs=36460 size=718.37KiB /4/2N (2|25|36): objs=40625 size=970.2KiB /4/3N (2|25|36): objs=1879 size=7.59KiB /4/4S (2|25|36): objs=157 size=149B /4/5N (2|25|36): objs=1734 size=7.07KiB /4/6S (2|25|36): objs=143 size=275B /4/7N (2|25|36): objs=4025 size=17.89KiB /4/8S (2|25|36): objs=161 size=317B /4/9N (2|25|36): objs=918 size=3.55KiB /4/10S (2|25|36): objs=172 size=253B /4/11N (2|25|36): objs=459 size=1.48KiB /4/12S (2|25|36): objs=170 size=162B /4/13N (2|25|36): objs=3100 size=13.01KiB /4/14S (2|25|36): objs=164 size=338B /4/15N (2|25|36): objs=3493 size=15.58KiB /4/16S (2|25|36): objs=140 size=150B /4/17N (2|25|36): objs=4815 size=21.84KiB /4/18S (2|25|36): objs=144 size=160B /4/19N (2|25|36): objs=747 size=2.81KiB /4/20S (2|25|36): objs=172 size=255B /4/21N (2|25|36): objs=1039 size=4.21KiB /4/22S (2|25|36): objs=154 size=191B /4/23N (2|25|36): objs=2783 size=11.69KiB /4/24S (2|25|36): objs=127 size=272B /4/25N (2|25|36): objs=2415 size=10.12KiB /4/26S (2|25|36): objs=151 size=164B /4/27N (2|25|36): objs=1081 size=4.37KiB /4/28S (2|25|36): objs=166 size=321B /4/29N (2|25|36): objs=1673 size=7.21KiB /4/30S (2|25|36): objs=151 size=263B /4/31N (2|25|36): objs=2942 size=12.64KiB /4/32S (2|25|36): objs=158 size=166B /4/33N (2|25|36): objs=1513 size=6.08KiB /4/34S (2|25|36): objs=149 size=93B /4/35N (2|25|36): objs=2543 size=10.88KiB /5/0N (2|25|36): objs=27604 size=387.9KiB /5/1S (2|25|36): objs=135 size=174B /5/2N (2|25|36): objs=10393 size=60.6KiB /5/3N (2|25|36): objs=38142 size=826.03KiB /5/4N (2|25|36): objs=14648 size=113.35KiB /5/5S (2|25|36): objs=175 size=94B /5/6N (2|25|36): objs=19177 size=193.23KiB /5/7S (2|25|36): objs=165 size=253B /5/8N (2|25|36): objs=5077 size=23.16KiB /5/9N (2|25|36): objs=468 size=1.54KiB /5/10S (2|25|36): objs=166 size=260B /5/11N (2|25|36): objs=1047 size=4.05KiB /5/12S (2|25|36): objs=130 size=138B /5/13N (2|25|36): objs=4972 size=25.55KiB /5/14S (2|25|36): objs=155 size=96B /5/15N (2|25|36): objs=2913 size=13.34KiB /5/16S (2|25|36): objs=160 size=332B /5/17N (2|25|36): objs=444 size=1.61KiB /5/18S (2|25|36): objs=170 size=112B /5/19N (2|25|36): objs=5123 size=23.24KiB /5/20S (2|25|36): objs=164 size=297B /5/21N (2|25|36): objs=9921 size=56.57KiB /5/22S (2|25|36): objs=146 size=268B /5/23N (2|25|36): objs=283 size=844B /5/24S (2|25|36): objs=149 size=280B /5/26S (2|25|36): objs=136 size=89B /5/27N (2|25|36): objs=279 size=803B /5/28S (2|25|36): objs=173 size=144B /5/30S (2|25|36): objs=150 size=184B /5/31N (2|25|36): objs=2547 size=10.94KiB /5/32S (2|25|36): objs=160 size=104B /5/33N (2|25|36): objs=2985 size=12.59KiB /5/34S (2|25|36): objs=164 size=307B /5/35N (2|25|36): objs=3183 size=14.42KiB /6/0N (2|25|36): objs=41674 size=977.31KiB /6/1N (2|25|36): objs=36086 size=695.73KiB /6/2N (2|25|36): objs=33710 size=645.57KiB /6/3S (2|25|36): objs=164 size=90B /6/4N (2|25|36): objs=6870 size=32.02KiB /6/5S (2|25|36): objs=140 size=176B /6/6N (2|25|36): objs=755 size=2.98KiB /6/7S (2|25|36): objs=134 size=215B /6/8S (2|25|36): objs=139 size=232B /6/9S (2|25|36): objs=157 size=301B /6/10N (2|25|36): objs=467 size=1.41KiB /6/11S (2|25|36): objs=164 size=330B /6/12S (2|25|36): objs=162 size=231B /6/13S (2|25|36): objs=164 size=311B /6/14N (2|25|36): objs=465 size=1.56KiB /6/15N (2|25|36): objs=1998 size=8.67KiB /6/16S (2|25|36): objs=140 size=309B /6/17N (2|25|36): objs=1225 size=4.9KiB /6/18S (2|25|36): objs=171 size=311B /6/19N (2|25|36): objs=7485 size=35.51KiB /6/20S (2|25|36): objs=171 size=309B /6/21N (2|25|36): objs=492 size=1.73KiB /6/22S (2|25|36): objs=183 size=257B /6/23N (2|25|36): objs=3054 size=16.44KiB /6/24S (2|25|36): objs=155 size=256B /6/25N (2|25|36): objs=8821 size=51.88KiB /6/26S (2|25|36): objs=137 size=150B /6/27N (2|25|36): objs=2727 size=12.82KiB /6/28S (2|25|36): objs=154 size=138B /6/29N (2|25|36): objs=941 size=3.62KiB /6/30S (2|25|36): objs=144 size=142B /6/31N (2|25|36): objs=1578 size=6.65KiB /6/32S (2|25|36): objs=143 size=169B /6/33N (2|25|36): objs=1986 size=8.62KiB /6/34S (2|25|36): objs=147 size=300B /6/35N (2|25|36): objs=5631 size=27.82KiB /7/0N (2|25|36): objs=36048 size=707.19KiB /7/1N (2|25|36): objs=37655 size=888.81KiB /7/2N (2|25|36): objs=38023 size=767.66KiB /7/3N (2|25|36): objs=10988 size=63.18KiB /7/4S (2|25|36): objs=137 size=226B /7/5N (2|25|36): objs=1932 size=8.05KiB /7/6S (2|25|36): objs=170 size=162B /7/7N (2|25|36): objs=323 size=907B /7/8S (2|25|36): objs=145 size=278B /7/9N (2|25|36): objs=1046 size=4.39KiB /7/10S (2|25|36): objs=147 size=206B /7/11N (2|25|36): objs=309 size=1.07KiB /7/12S (2|25|36): objs=173 size=217B /7/13N (2|25|36): objs=1522 size=6.35KiB /7/14S (2|25|36): objs=158 size=96B /7/15N (2|25|36): objs=5015 size=21.67KiB /7/16S (2|25|36): objs=162 size=320B /7/17N (2|25|36): objs=285 size=870B /7/18S (2|25|36): objs=140 size=98B /7/19N (2|25|36): objs=2194 size=9.18KiB /7/20S (2|25|36): objs=139 size=110B /7/21N (2|25|36): objs=2433 size=10.56KiB /7/22S (2|25|36): objs=152 size=211B /7/23N (2|25|36): objs=480 size=1.42KiB /7/24S (2|25|36): objs=164 size=285B /7/25N (2|25|36): objs=328 size=889B /7/26S (2|25|36): objs=156 size=248B /7/27N (2|25|36): objs=752 size=2.88KiB /7/28S (2|25|36): objs=156 size=252B /7/29N (2|25|36): objs=307 size=762B /7/30S (2|25|36): objs=151 size=162B /7/31N (2|25|36): objs=4386 size=19.4KiB /7/32S (2|25|36): objs=161 size=108B /7/33N (2|25|36): objs=290 size=692B /7/34S (2|25|36): objs=143 size=286B /7/35N (2|25|36): objs=785 size=3.03KiB /8/0N (2|25|36): objs=41101 size=930.12KiB /8/1N (2|25|36): objs=39633 size=905.78KiB /8/2N (2|25|36): objs=28380 size=411.04KiB /8/3S (2|25|36): objs=138 size=309B /8/4N (2|25|36): objs=948 size=3.67KiB /8/5S (2|25|36): objs=155 size=323B /8/6N (2|25|36): objs=9492 size=50.1KiB /8/7N (2|25|36): objs=1680 size=7.06KiB /8/8S (2|25|36): objs=167 size=209B /8/9N (2|25|36): objs=4274 size=18.76KiB /8/10S (2|25|36): objs=160 size=280B /8/11N (2|25|36): objs=1519 size=6.2KiB /8/12S (2|25|36): objs=150 size=180B /8/13N (2|25|36): objs=1091 size=4.22KiB /8/14S (2|25|36): objs=137 size=264B /8/15N (2|25|36): objs=333 size=1.09KiB /8/16S (2|25|36): objs=162 size=163B /8/17N (2|25|36): objs=784 size=2.86KiB /8/18S (2|25|36): objs=152 size=89B /8/19N (2|25|36): objs=1996 size=8.43KiB /8/20S (2|25|36): objs=146 size=267B /8/21N (2|25|36): objs=327 size=1.02KiB /8/22S (2|25|36): objs=151 size=158B /8/23N (2|25|36): objs=1463 size=5.94KiB /8/24S (2|25|36): objs=146 size=275B /8/25N (2|25|36): objs=3697 size=16.18KiB /8/26S (2|25|36): objs=160 size=125B /8/27N (2|25|36): objs=1411 size=5.76KiB /8/28S (2|25|36): objs=177 size=356B /8/29N (2|25|36): objs=4197 size=18.96KiB /8/30S (2|25|36): objs=139 size=194B /8/31N (2|25|36): objs=3883 size=17.09KiB /8/32S (2|25|36): objs=159 size=334B /8/33N (2|25|36): objs=3297 size=15.39KiB /8/34S (2|25|36): objs=138 size=168B /8/35N (2|25|36): objs=4609 size=20.68KiB /9/0N (2|25|36): objs=37578 size=763.09KiB /9/1N (2|25|36): objs=40623 size=1.08MiB /9/2N (2|25|36): objs=38100 size=793.34KiB /9/3N (2|25|36): objs=870 size=3.38KiB /9/4S (2|25|36): objs=136 size=247B /9/5N (2|25|36): objs=3983 size=17.14KiB /9/6S (2|25|36): objs=146 size=275B /9/7N (2|25|36): objs=308 size=937B /9/8S (2|25|36): objs=165 size=311B /9/9N (2|25|36): objs=305 size=984B /9/10S (2|25|36): objs=161 size=138B /9/11N (2|25|36): objs=1101 size=4.48KiB /9/12S (2|25|36): objs=150 size=113B /9/13N (2|25|36): objs=2796 size=11.88KiB /9/14S (2|25|36): objs=149 size=168B /9/16S (2|25|36): objs=140 size=172B /9/17N (2|25|36): objs=6522 size=32.63KiB /9/18S (2|25|36): objs=145 size=278B /9/19N (2|25|36): objs=2015 size=8.63KiB /9/20S (2|25|36): objs=160 size=121B /9/21N (2|25|36): objs=3288 size=15.26KiB /9/22S (2|25|36): objs=149 size=319B /9/23N (2|25|36): objs=1526 size=6.28KiB /9/24S (2|25|36): objs=161 size=268B /9/26S (2|25|36): objs=163 size=315B /9/27N (2|25|36): objs=4041 size=21.64KiB /9/28S (2|25|36): objs=157 size=251B /9/29N (2|25|36): objs=1852 size=7.7KiB /9/30S (2|25|36): objs=152 size=245B /9/31N (2|25|36): objs=2703 size=11.09KiB /9/32S (2|25|36): objs=167 size=238B /9/33N (2|25|36): objs=290 size=835B /9/34S (2|25|36): objs=139 size=298B /9/35N (2|25|36): objs=1240 size=5.12KiB /10/0N (2|25|36): objs=40867 size=868.06KiB /10/1N (2|25|36): objs=37950 size=775.92KiB /10/2N (2|25|36): objs=37242 size=777.52KiB /10/3S (2|25|36): objs=159 size=127B /10/4N (2|25|36): objs=1344 size=5.5KiB /10/5S (2|25|36): objs=155 size=262B /10/6N (2|25|36): objs=908 size=3.61KiB /10/7N (2|25|36): objs=8697 size=41.31KiB /10/8S (2|25|36): objs=145 size=249B /10/9N (2|25|36): objs=1226 size=4.95KiB /10/10S (2|25|36): objs=148 size=229B /10/11N (2|25|36): objs=957 size=3.69KiB /10/12S (2|25|36): objs=164 size=334B /10/13N (2|25|36): objs=568 size=2.21KiB /10/14S (2|25|36): objs=153 size=198B /10/15N (2|25|36): objs=618 size=2.21KiB /10/16S (2|25|36): objs=167 size=151B /10/17N (2|25|36): objs=4620 size=25.62KiB /10/18S (2|25|36): objs=146 size=127B /10/19S (2|25|36): objs=153 size=146B /10/20S (2|25|36): objs=163 size=349B /10/21N (2|25|36): objs=1194 size=4.64KiB /10/22S (2|25|36): objs=165 size=348B /10/23N (2|25|36): objs=5726 size=28.96KiB /10/24S (2|25|36): objs=170 size=189B /10/25N (2|25|36): objs=5472 size=26.79KiB /10/26S (2|25|36): objs=173 size=321B /10/27N (2|25|36): objs=887 size=3.32KiB /10/28S (2|25|36): objs=144 size=94B /10/29N (2|25|36): objs=1166 size=4.65KiB /10/30S (2|25|36): objs=166 size=201B /10/31N (2|25|36): objs=938 size=3.5KiB /10/32S (2|25|36): objs=174 size=194B /10/33N (2|25|36): objs=777 size=2.78KiB /10/34S (2|25|36): objs=152 size=112B /10/35N (2|25|36): objs=1583 size=6.4KiB /11/0N (2|25|36): objs=40763 size=902.79KiB /11/1N (2|25|36): objs=38851 size=956.23KiB /11/2N (2|25|36): objs=42192 size=916.74KiB /11/3N (2|25|36): objs=3672 size=16.38KiB /11/4S (2|25|36): objs=145 size=201B /11/5N (2|25|36): objs=2760 size=12.13KiB /11/6S (2|25|36): objs=145 size=113B /11/7N (2|25|36): objs=3437 size=14.5KiB /11/8S (2|25|36): objs=146 size=272B /11/9N (2|25|36): objs=6008 size=28.19KiB /11/10S (2|25|36): objs=152 size=263B /11/11N (2|25|36): objs=2566 size=10.86KiB /11/12S (2|25|36): objs=158 size=86B /11/13N (2|25|36): objs=2233 size=9.44KiB /11/14S (2|25|36): objs=151 size=242B /11/15S (2|25|36): objs=187 size=296B /11/16S (2|25|36): objs=160 size=281B /11/17N (2|25|36): objs=1888 size=8.04KiB /11/18S (2|25|36): objs=137 size=113B /11/19N (2|25|36): objs=441 size=1.42KiB /11/20S (2|25|36): objs=128 size=199B /11/21S (2|25|36): objs=155 size=210B /11/22S (2|25|36): objs=143 size=198B /11/23N (2|25|36): objs=1850 size=7.81KiB /11/24S (2|25|36): objs=145 size=267B /11/25N (2|25|36): objs=677 size=2.37KiB /11/26S (2|25|36): objs=137 size=223B /11/27N (2|25|36): objs=2924 size=14.52KiB /11/28S (2|25|36): objs=146 size=297B /11/29N (2|25|36): objs=278 size=863B /11/30S (2|25|36): objs=147 size=304B /11/32S (2|25|36): objs=164 size=326B /11/33N (2|25|36): objs=1822 size=7.42KiB /11/34S (2|25|36): objs=164 size=134B /11/35N (2|25|36): objs=5621 size=25.74KiB /12/0N (2|25|36): objs=40346 size=921.46KiB /12/1N (2|25|36): objs=39840 size=1.01MiB /12/2N (2|25|36): objs=41947 size=946.94KiB /12/3N (2|25|36): objs=3968 size=18.89KiB /12/4S (2|25|36): objs=137 size=309B /12/5N (2|25|36): objs=2909 size=12.68KiB /12/6S (2|25|36): objs=127 size=139B /12/7N (2|25|36): objs=4140 size=19.69KiB /12/8S (2|25|36): objs=139 size=270B /12/9N (2|25|36): objs=4520 size=20.85KiB /12/10S (2|25|36): objs=140 size=240B /12/11N (2|25|36): objs=5243 size=27.5KiB /12/12S (2|25|36): objs=159 size=285B /12/13N (2|25|36): objs=1552 size=6.18KiB /12/14S (2|25|36): objs=178 size=142B /12/15N (2|25|36): objs=5518 size=26.33KiB /12/16S (2|25|36): objs=130 size=99B /12/17N (2|25|36): objs=769 size=2.86KiB /12/18S (2|25|36): objs=143 size=126B /12/19N (2|25|36): objs=1400 size=5.78KiB /12/20S (2|25|36): objs=169 size=103B /12/21N (2|25|36): objs=1683 size=6.84KiB /12/22S (2|25|36): objs=145 size=240B /12/23N (2|25|36): objs=2258 size=9.51KiB /12/24S (2|25|36): objs=144 size=258B /12/25S (2|25|36): objs=154 size=312B /12/26S (2|25|36): objs=172 size=208B /12/27S (2|25|36): objs=144 size=165B /12/28S (2|25|36): objs=152 size=308B /12/29N (2|25|36): objs=761 size=2.85KiB /12/30S (2|25|36): objs=148 size=161B /12/31N (2|25|36): objs=2276 size=9.54KiB /12/32S (2|25|36): objs=152 size=133B /12/34S (2|25|36): objs=145 size=276B /12/35N (2|25|36): objs=1179 size=4.71KiB /13/0N (2|25|36): objs=38393 size=822.54KiB /13/1N (2|25|36): objs=36568 size=758.29KiB /13/2N (2|25|36): objs=31777 size=618.14KiB /13/3S (2|25|36): objs=139 size=327B /13/4N (2|25|36): objs=2300 size=9.96KiB /13/5S (2|25|36): objs=163 size=313B /13/6N (2|25|36): objs=2818 size=12.14KiB /13/8S (2|25|36): objs=155 size=115B /13/9N (2|25|36): objs=1389 size=5.64KiB /13/10S (2|25|36): objs=166 size=274B /13/11N (2|25|36): objs=949 size=3.62KiB /13/12S (2|25|36): objs=160 size=344B /13/13N (2|25|36): objs=2406 size=10.58KiB /13/14S (2|25|36): objs=190 size=145B /13/15N (2|25|36): objs=9204 size=47.54KiB /13/16S (2|25|36): objs=163 size=298B /13/17N (2|25|36): objs=1719 size=7.4KiB /13/18S (2|25|36): objs=145 size=312B /13/19N (2|25|36): objs=2021 size=8.47KiB /13/20S (2|25|36): objs=169 size=109B /13/21N (2|25|36): objs=5222 size=24.2KiB /13/22S (2|25|36): objs=154 size=296B /13/23N (2|25|36): objs=1635 size=6.77KiB /13/24S (2|25|36): objs=154 size=96B /13/25N (2|25|36): objs=1998 size=8.34KiB /13/26S (2|25|36): objs=163 size=149B /13/27N (2|25|36): objs=5279 size=23.94KiB /13/28S (2|25|36): objs=144 size=290B /13/29N (2|25|36): objs=2770 size=14.08KiB /13/30S (2|25|36): objs=160 size=350B /13/31N (2|25|36): objs=3603 size=16.83KiB /13/32S (2|25|36): objs=138 size=268B /13/33N (2|25|36): objs=1680 size=6.96KiB /13/34S (2|25|36): objs=132 size=218B /14/0N (2|25|36): objs=38495 size=832.85KiB /14/1N (2|25|36): objs=36562 size=859.71KiB /14/2N (2|25|36): objs=25281 size=327.28KiB /14/3S (2|25|36): objs=133 size=308B /14/4N (2|25|36): objs=11691 size=67.11KiB /14/5N (2|25|36): objs=9188 size=59.81KiB /14/6S (2|25|36): objs=162 size=212B /14/7N (2|25|36): objs=5064 size=23.96KiB /14/8S (2|25|36): objs=136 size=331B /14/9N (2|25|36): objs=480 size=1.66KiB /14/10S (2|25|36): objs=140 size=141B /14/11N (2|25|36): objs=2381 size=10.95KiB /14/12S (2|25|36): objs=148 size=177B /14/13N (2|25|36): objs=2479 size=10.53KiB /14/14S (2|25|36): objs=167 size=345B /14/15N (2|25|36): objs=1170 size=4.88KiB /14/16S (2|25|36): objs=138 size=108B /14/17S (2|25|36): objs=135 size=219B /14/18S (2|25|36): objs=156 size=88B /14/19S (2|25|36): objs=137 size=314B /14/20S (2|25|36): objs=142 size=94B /14/21N (2|25|36): objs=2280 size=9.62KiB /14/22S (2|25|36): objs=154 size=253B /14/23N (2|25|36): objs=3307 size=15.13KiB /14/24S (2|25|36): objs=145 size=229B /14/25N (2|25|36): objs=594 size=2.15KiB /14/26S (2|25|36): objs=146 size=91B /14/27N (2|25|36): objs=1870 size=7.81KiB /14/28S (2|25|36): objs=164 size=229B /14/29N (2|25|36): objs=2695 size=11.51KiB /14/30S (2|25|36): objs=141 size=166B /14/31N (2|25|36): objs=587 size=2.28KiB /14/32S (2|25|36): objs=157 size=241B /14/33N (2|25|36): objs=2627 size=10.99KiB /14/34S (2|25|36): objs=147 size=286B /14/35N (2|25|36): objs=3378 size=15.15KiB /15/0N (2|25|36): objs=38124 size=755.19KiB /15/1N (2|25|36): objs=38873 size=927.92KiB /15/2N (2|25|36): objs=40079 size=913.73KiB /15/3N (2|25|36): objs=5393 size=24.1KiB /15/4S (2|25|36): objs=173 size=326B /15/5N (2|25|36): objs=7106 size=37.12KiB /15/6S (2|25|36): objs=155 size=315B /15/7N (2|25|36): objs=6464 size=30.64KiB /15/8S (2|25|36): objs=154 size=95B /15/9N (2|25|36): objs=2064 size=8.45KiB /15/10S (2|25|36): objs=160 size=249B /15/11N (2|25|36): objs=1234 size=4.92KiB /15/12S (2|25|36): objs=154 size=316B /15/13N (2|25|36): objs=1074 size=4.14KiB /15/14S (2|25|36): objs=175 size=217B /15/15N (2|25|36): objs=598 size=2.1KiB /15/16S (2|25|36): objs=154 size=317B /15/17N (2|25|36): objs=473 size=1.68KiB /15/18S (2|25|36): objs=151 size=217B /15/19N (2|25|36): objs=863 size=3.35KiB /15/20S (2|25|36): objs=153 size=116B /15/21N (2|25|36): objs=318 size=1.07KiB /15/22S (2|25|36): objs=137 size=109B /15/23N (2|25|36): objs=703 size=2.71KiB /15/24S (2|25|36): objs=148 size=299B /15/25N (2|25|36): objs=2104 size=9.21KiB /15/26S (2|25|36): objs=163 size=187B /15/27N (2|25|36): objs=633 size=2.21KiB /15/28S (2|25|36): objs=147 size=285B /15/29N (2|25|36): objs=3166 size=17.79KiB /15/30S (2|25|36): objs=160 size=212B /15/31N (2|25|36): objs=452 size=1.62KiB /15/32S (2|25|36): objs=156 size=296B /15/33N (2|25|36): objs=1085 size=4.29KiB /15/34S (2|25|36): objs=139 size=180B /15/35S (2|25|36): objs=131 size=183B /16/0N (2|25|36): objs=38053 size=746.42KiB /16/1N (2|25|36): objs=39785 size=960.27KiB /16/2N (2|25|36): objs=29462 size=512.11KiB /16/3S (2|25|36): objs=155 size=287B /16/4N (2|25|36): objs=2161 size=8.83KiB /16/5S (2|25|36): objs=164 size=105B /16/6N (2|25|36): objs=7304 size=36.85KiB /16/7N (2|25|36): objs=2426 size=10.13KiB /16/8S (2|25|36): objs=164 size=343B /16/9N (2|25|36): objs=3201 size=13.35KiB /16/10S (2|25|36): objs=164 size=216B /16/11N (2|25|36): objs=700 size=2.56KiB /16/12S (2|25|36): objs=159 size=158B /16/13S (2|25|36): objs=163 size=245B /16/14S (2|25|36): objs=176 size=160B /16/15N (2|25|36): objs=1080 size=4.22KiB /16/16S (2|25|36): objs=149 size=271B /16/17S (2|25|36): objs=143 size=307B /16/18S (2|25|36): objs=143 size=230B /16/19N (2|25|36): objs=3271 size=15.85KiB /16/20S (2|25|36): objs=177 size=328B /16/21N (2|25|36): objs=15344 size=119.48KiB /16/22S (2|25|36): objs=139 size=290B /16/23N (2|25|36): objs=2356 size=9.79KiB /16/24S (2|25|36): objs=167 size=333B /16/25N (2|25|36): objs=2603 size=10.96KiB /16/26S (2|25|36): objs=150 size=103B /16/27N (2|25|36): objs=1489 size=5.95KiB /16/28S (2|25|36): objs=153 size=95B /16/29N (2|25|36): objs=1218 size=4.98KiB /16/30S (2|25|36): objs=137 size=281B /16/31N (2|25|36): objs=3933 size=17.9KiB /16/32S (2|25|36): objs=137 size=221B /16/33N (2|25|36): objs=614 size=2.32KiB /16/34S (2|25|36): objs=147 size=302B /16/35N (2|25|36): objs=514 size=1.97KiB /17/0N (2|25|36): objs=37784 size=806.5KiB /17/1N (2|25|36): objs=38737 size=817.71KiB /17/2N (2|25|36): objs=38497 size=972.55KiB /17/3N (2|25|36): objs=7606 size=39.35KiB /17/4S (2|25|36): objs=169 size=327B /17/5N (2|25|36): objs=2401 size=10.6KiB /17/6S (2|25|36): objs=147 size=317B /17/7N (2|25|36): objs=3588 size=16.37KiB /17/8S (2|25|36): objs=145 size=94B /17/9N (2|25|36): objs=640 size=2.31KiB /17/10S (2|25|36): objs=131 size=298B /17/11S (2|25|36): objs=163 size=188B /17/12S (2|25|36): objs=158 size=118B /17/13N (2|25|36): objs=1415 size=5.61KiB /17/14S (2|25|36): objs=154 size=265B /17/15S (2|25|36): objs=148 size=255B /17/16S (2|25|36): objs=127 size=257B /17/17N (2|25|36): objs=1236 size=5KiB /17/18S (2|25|36): objs=129 size=276B /17/20S (2|25|36): objs=156 size=150B /17/21N (2|25|36): objs=600 size=2.03KiB /17/22S (2|25|36): objs=146 size=243B /17/23S (2|25|36): objs=163 size=248B /17/24S (2|25|36): objs=169 size=224B /17/25N (2|25|36): objs=807 size=3.02KiB /17/26S (2|25|36): objs=167 size=240B /17/27N (2|25|36): objs=2773 size=12.92KiB /17/28S (2|25|36): objs=151 size=306B /17/29N (2|25|36): objs=275 size=877B /17/30S (2|25|36): objs=148 size=296B /17/31N (2|25|36): objs=2009 size=8.36KiB /17/32S (2|25|36): objs=152 size=245B /17/33N (2|25|36): objs=1385 size=5.75KiB /17/34S (2|25|36): objs=163 size=145B /17/35N (2|25|36): objs=10085 size=50.07KiB /18/0N (2|25|36): objs=42755 size=1017.33KiB /18/1N (2|25|36): objs=37584 size=814.55KiB /18/2N (2|25|36): objs=33849 size=714.17KiB /18/3S (2|25|36): objs=169 size=253B /18/5S (2|25|36): objs=156 size=123B /18/6N (2|25|36): objs=620 size=2.28KiB /18/7S (2|25|36): objs=130 size=169B /18/8N (2|25|36): objs=4650 size=21.32KiB /18/9N (2|25|36): objs=2153 size=9.27KiB /18/10S (2|25|36): objs=158 size=111B /18/11N (2|25|36): objs=794 size=3.07KiB /18/12S (2|25|36): objs=155 size=145B /18/13N (2|25|36): objs=5580 size=27.79KiB /18/14S (2|25|36): objs=158 size=333B /18/15N (2|25|36): objs=475 size=1.55KiB /18/16S (2|25|36): objs=161 size=257B /18/17N (2|25|36): objs=2435 size=10.31KiB /18/18S (2|25|36): objs=150 size=260B /18/19N (2|25|36): objs=2720 size=11.72KiB /18/20S (2|25|36): objs=153 size=172B /18/21N (2|25|36): objs=6455 size=35.33KiB /18/22S (2|25|36): objs=169 size=100B /18/23N (2|25|36): objs=1041 size=4KiB /18/24S (2|25|36): objs=166 size=118B /18/25N (2|25|36): objs=6014 size=27.55KiB /18/26S (2|25|36): objs=165 size=119B /18/27N (2|25|36): objs=459 size=1.71KiB /18/28S (2|25|36): objs=173 size=304B /18/29N (2|25|36): objs=2703 size=10.94KiB /18/30S (2|25|36): objs=171 size=111B /18/31N (2|25|36): objs=308 size=905B /18/32S (2|25|36): objs=158 size=172B /18/33N (2|25|36): objs=762 size=2.96KiB /18/34S (2|25|36): objs=138 size=103B /18/35N (2|25|36): objs=1220 size=4.95KiB /19/0N (2|25|36): objs=45084 size=1.25MiB /19/1N (2|25|36): objs=37352 size=895.05KiB /19/2N (2|25|36): objs=38632 size=830.76KiB /19/3N (2|25|36): objs=2087 size=8.69KiB /19/4S (2|25|36): objs=168 size=232B /19/5N (2|25|36): objs=4323 size=19.77KiB /19/6S (2|25|36): objs=150 size=325B /19/7N (2|25|36): objs=466 size=1.72KiB /19/8S (2|25|36): objs=149 size=165B /19/9S (2|25|36): objs=166 size=181B /19/10S (2|25|36): objs=163 size=127B /19/11N (2|25|36): objs=601 size=2.28KiB /19/12S (2|25|36): objs=139 size=168B /19/13N (2|25|36): objs=5894 size=28.44KiB /19/14S (2|25|36): objs=171 size=119B /19/15N (2|25|36): objs=777 size=2.75KiB /19/16S (2|25|36): objs=141 size=191B /19/17N (2|25|36): objs=2691 size=12.31KiB /19/18S (2|25|36): objs=150 size=178B /19/19N (2|25|36): objs=1451 size=6.04KiB /19/20S (2|25|36): objs=166 size=309B /19/21N (2|25|36): objs=764 size=2.83KiB /19/22S (2|25|36): objs=165 size=174B /19/23S (2|25|36): objs=146 size=278B /19/24S (2|25|36): objs=125 size=151B /19/25N (2|25|36): objs=1498 size=6.57KiB /19/26S (2|25|36): objs=156 size=230B /19/27S (2|25|36): objs=140 size=301B /19/28S (2|25|36): objs=147 size=311B /19/29N (2|25|36): objs=3863 size=18.8KiB /19/30S (2|25|36): objs=154 size=265B /19/31N (2|25|36): objs=5769 size=28.4KiB /19/32S (2|25|36): objs=159 size=254B /19/33N (2|25|36): objs=1353 size=5.33KiB /19/34S (2|25|36): objs=158 size=319B /19/35N (2|25|36): objs=3196 size=14.27KiB /20/0N (2|25|36): objs=36882 size=719.16KiB /20/1N (2|25|36): objs=45145 size=1.04MiB /20/2N (2|25|36): objs=1078 size=3.97KiB /20/3S (2|25|36): objs=158 size=329B /20/4N (2|25|36): objs=43257 size=1.04MiB /20/5N (2|25|36): objs=434 size=1.34KiB /20/6S (2|25|36): objs=142 size=281B /20/7N (2|25|36): objs=13191 size=95.74KiB /20/8S (2|25|36): objs=155 size=219B /20/9N (2|25|36): objs=291 size=878B /20/10S (2|25|36): objs=155 size=130B /20/11N (2|25|36): objs=5391 size=25.89KiB /20/12S (2|25|36): objs=146 size=98B /20/13N (2|25|36): objs=1500 size=6.22KiB /20/14S (2|25|36): objs=119 size=278B /20/15N (2|25|36): objs=3598 size=16.25KiB /20/16S (2|25|36): objs=121 size=280B /20/17N (2|25|36): objs=1317 size=5.31KiB /20/18S (2|25|36): objs=156 size=194B /20/19S (2|25|36): objs=156 size=250B /20/20S (2|25|36): objs=170 size=215B /20/21N (2|25|36): objs=737 size=2.93KiB /20/22S (2|25|36): objs=159 size=99B /20/23N (2|25|36): objs=3199 size=13.16KiB /20/24S (2|25|36): objs=154 size=171B /20/25N (2|25|36): objs=606 size=2.2KiB /20/26S (2|25|36): objs=173 size=220B /20/27S (2|25|36): objs=139 size=194B /20/28S (2|25|36): objs=152 size=255B /20/29N (2|25|36): objs=613 size=1.99KiB /20/30S (2|25|36): objs=158 size=323B /20/31N (2|25|36): objs=2743 size=12.57KiB /20/32S (2|25|36): objs=143 size=192B /20/33N (2|25|36): objs=919 size=3.64KiB /20/34S (2|25|36): objs=161 size=309B /20/35S (2|25|36): objs=161 size=323B /21/0N (2|25|36): objs=46066 size=1.18MiB /21/1N (2|25|36): objs=37596 size=828.32KiB /21/2N (2|25|36): objs=36865 size=697.23KiB /21/3N (2|25|36): objs=2584 size=11.46KiB /21/4S (2|25|36): objs=146 size=275B /21/5N (2|25|36): objs=4567 size=20.67KiB /21/6S (2|25|36): objs=133 size=203B /21/7N (2|25|36): objs=918 size=3.46KiB /21/8S (2|25|36): objs=162 size=88B /21/9N (2|25|36): objs=9749 size=53.69KiB /21/10S (2|25|36): objs=154 size=204B /21/11N (2|25|36): objs=2180 size=9.46KiB /21/12S (2|25|36): objs=158 size=283B /21/13N (2|25|36): objs=3984 size=19.42KiB /21/14S (2|25|36): objs=158 size=249B /21/15N (2|25|36): objs=1366 size=5.52KiB /21/16S (2|25|36): objs=154 size=173B /21/17N (2|25|36): objs=907 size=3.52KiB /21/18S (2|25|36): objs=147 size=139B /21/19N (2|25|36): objs=1004 size=4.19KiB /21/20S (2|25|36): objs=150 size=337B /21/21N (2|25|36): objs=600 size=2.17KiB /21/22S (2|25|36): objs=164 size=342B /21/23N (2|25|36): objs=1670 size=6.88KiB /21/24S (2|25|36): objs=167 size=295B /21/25N (2|25|36): objs=5604 size=26.68KiB /21/26S (2|25|36): objs=140 size=322B /21/27N (2|25|36): objs=1103 size=4.05KiB /21/28S (2|25|36): objs=158 size=198B /21/29N (2|25|36): objs=640 size=2.27KiB /21/30S (2|25|36): objs=153 size=293B /21/32S (2|25|36): objs=144 size=280B /21/33N (2|25|36): objs=423 size=1.44KiB /21/34S (2|25|36): objs=151 size=134B /21/35N (2|25|36): objs=653 size=2.24KiB /22/0N (2|25|36): objs=38858 size=810.62KiB /22/1N (2|25|36): objs=40398 size=975.4KiB /22/2N (2|25|36): objs=38741 size=848.04KiB /22/3N (2|25|36): objs=14655 size=97.84KiB /22/4S (2|25|36): objs=150 size=336B /22/5N (2|25|36): objs=4370 size=20.45KiB /22/6S (2|25|36): objs=149 size=247B /22/7N (2|25|36): objs=295 size=699B /22/8S (2|25|36): objs=132 size=322B /22/9N (2|25|36): objs=321 size=961B /22/10S (2|25|36): objs=144 size=326B /22/11N (2|25|36): objs=449 size=1.39KiB /22/12S (2|25|36): objs=141 size=95B /22/13N (2|25|36): objs=1071 size=4.29KiB /22/14S (2|25|36): objs=154 size=302B /22/15N (2|25|36): objs=3997 size=18.25KiB /22/16S (2|25|36): objs=150 size=341B /22/17S (2|25|36): objs=137 size=129B /22/18S (2|25|36): objs=149 size=285B /22/19N (2|25|36): objs=871 size=3.46KiB /22/20S (2|25|36): objs=154 size=145B /22/21N (2|25|36): objs=3496 size=15.07KiB /22/22S (2|25|36): objs=157 size=291B /22/23N (2|25|36): objs=726 size=2.73KiB /22/24S (2|25|36): objs=162 size=151B /22/25N (2|25|36): objs=464 size=1.56KiB /22/26S (2|25|36): objs=142 size=193B /22/27N (2|25|36): objs=585 size=2.18KiB /22/28S (2|25|36): objs=161 size=110B /22/29N (2|25|36): objs=723 size=2.86KiB /22/30S (2|25|36): objs=158 size=288B /22/31N (2|25|36): objs=2143 size=9.03KiB /22/32S (2|25|36): objs=146 size=134B /22/33N (2|25|36): objs=907 size=3.63KiB /22/34S (2|25|36): objs=152 size=97B /22/35N (2|25|36): objs=2543 size=10.89KiB /23/0N (2|25|36): objs=38754 size=827.53KiB /23/1N (2|25|36): objs=38267 size=864.7KiB /23/2N (2|25|36): objs=18207 size=147.23KiB /23/3S (2|25|36): objs=138 size=268B /23/4N (2|25|36): objs=19529 size=156.1KiB /23/5N (2|25|36): objs=5750 size=25.64KiB /23/6S (2|25|36): objs=151 size=195B /23/7N (2|25|36): objs=676 size=2.55KiB /23/8S (2|25|36): objs=151 size=176B /23/9N (2|25|36): objs=1232 size=5.08KiB /23/10S (2|25|36): objs=144 size=165B /23/11N (2|25|36): objs=436 size=1.51KiB /23/12S (2|25|36): objs=163 size=332B /23/14S (2|25|36): objs=142 size=306B /23/15N (2|25|36): objs=5181 size=26.19KiB /23/16S (2|25|36): objs=161 size=182B /23/17N (2|25|36): objs=3276 size=14.74KiB /23/18S (2|25|36): objs=154 size=111B /23/19N (2|25|36): objs=1250 size=4.8KiB /23/20S (2|25|36): objs=152 size=217B /23/21N (2|25|36): objs=5766 size=30.11KiB /23/22S (2|25|36): objs=156 size=123B /23/24S (2|25|36): objs=156 size=302B /23/25N (2|25|36): objs=493 size=1.57KiB /23/26S (2|25|36): objs=157 size=183B /23/27N (2|25|36): objs=299 size=941B /23/28S (2|25|36): objs=151 size=283B /23/29S (2|25|36): objs=190 size=115B /23/30S (2|25|36): objs=151 size=217B /23/31N (2|25|36): objs=4246 size=19.89KiB /23/32S (2|25|36): objs=155 size=238B /23/33N (2|25|36): objs=1072 size=4.26KiB /23/34S (2|25|36): objs=160 size=109B /23/35N (2|25|36): objs=3070 size=13.27KiB /24/0N (2|25|36): objs=37205 size=802.66KiB /24/1N (2|25|36): objs=38387 size=946.63KiB /24/2N (2|25|36): objs=34994 size=682.42KiB /24/3S (2|25|36): objs=155 size=327B /24/4N (2|25|36): objs=1336 size=5.46KiB /24/5N (2|25|36): objs=643 size=2.51KiB /24/6S (2|25|36): objs=133 size=200B /24/7N (2|25|36): objs=344 size=1.07KiB /24/8S (2|25|36): objs=139 size=268B /24/9N (2|25|36): objs=904 size=3.55KiB /24/10S (2|25|36): objs=148 size=284B /24/11N (2|25|36): objs=321 size=937B /24/12S (2|25|36): objs=156 size=343B /24/13N (2|25|36): objs=5677 size=27.47KiB /24/14S (2|25|36): objs=148 size=269B /24/15N (2|25|36): objs=1989 size=8.39KiB /24/16S (2|25|36): objs=151 size=272B /24/17N (2|25|36): objs=5635 size=26.93KiB /24/18S (2|25|36): objs=140 size=95B /24/19N (2|25|36): objs=4365 size=19.82KiB /24/20S (2|25|36): objs=152 size=189B /24/21N (2|25|36): objs=1101 size=4.28KiB /24/22S (2|25|36): objs=164 size=269B /24/23N (2|25|36): objs=481 size=1.7KiB /24/24S (2|25|36): objs=152 size=299B /24/25N (2|25|36): objs=4065 size=18.52KiB /24/26S (2|25|36): objs=159 size=179B /24/27N (2|25|36): objs=733 size=2.71KiB /24/28S (2|25|36): objs=143 size=248B /24/29N (2|25|36): objs=605 size=2.15KiB /24/30S (2|25|36): objs=153 size=316B /24/31N (2|25|36): objs=5471 size=23.34KiB /24/32S (2|25|36): objs=153 size=119B /24/33N (2|25|36): objs=4581 size=20.03KiB /24/34S (2|25|36): objs=145 size=211B /24/35N (2|25|36): objs=1504 size=6.23KiB /25/0N (2|25|36): objs=39131 size=821.03KiB /25/1N (2|25|36): objs=38307 size=688.04KiB /25/2N (2|25|36): objs=14691 size=89.29KiB /25/3S (2|25|36): objs=157 size=150B /25/4N (2|25|36): objs=2709 size=11.74KiB /25/5S (2|25|36): objs=164 size=165B /25/6N (2|25|36): objs=21907 size=285.26KiB /25/7N (2|25|36): objs=7250 size=37.34KiB /25/8S (2|25|36): objs=144 size=229B /25/9N (2|25|36): objs=2596 size=11.42KiB /25/10S (2|25|36): objs=155 size=169B /25/11N (2|25|36): objs=1649 size=6.88KiB /25/12S (2|25|36): objs=156 size=335B /25/13N (2|25|36): objs=2299 size=9.93KiB /25/14S (2|25|36): objs=175 size=280B /25/15N (2|25|36): objs=2238 size=9.53KiB /25/16S (2|25|36): objs=156 size=93B /25/17N (2|25|36): objs=1713 size=7.29KiB /25/18S (2|25|36): objs=183 size=198B /25/19N (2|25|36): objs=1008 size=3.99KiB /25/20S (2|25|36): objs=150 size=322B /25/21N (2|25|36): objs=308 size=1.1KiB /25/22S (2|25|36): objs=163 size=296B /25/23N (2|25|36): objs=460 size=1.5KiB /25/24S (2|25|36): objs=139 size=287B /25/25N (2|25|36): objs=1421 size=5.66KiB /25/26S (2|25|36): objs=160 size=244B /25/27N (2|25|36): objs=4049 size=19.16KiB /25/28S (2|25|36): objs=160 size=187B /25/29N (2|25|36): objs=315 size=874B /25/30S (2|25|36): objs=168 size=262B /25/31N (2|25|36): objs=2148 size=9.15KiB /25/32S (2|25|36): objs=148 size=203B /25/33N (2|25|36): objs=6522 size=31.21KiB /25/34S (2|25|36): objs=131 size=91B /25/35N (2|25|36): objs=1009 size=3.92KiB /26/0N (2|25|36): objs=35909 size=759.41KiB /26/1N (2|25|36): objs=37714 size=790.54KiB /26/2N (2|25|36): objs=35907 size=720.01KiB /26/3N (2|25|36): objs=12424 size=71.99KiB /26/4S (2|25|36): objs=146 size=192B /26/5N (2|25|36): objs=428 size=1.41KiB /26/6S (2|25|36): objs=138 size=262B /26/7N (2|25|36): objs=2066 size=8.62KiB /26/8S (2|25|36): objs=150 size=334B /26/9N (2|25|36): objs=1559 size=6.5KiB /26/10S (2|25|36): objs=157 size=156B /26/11N (2|25|36): objs=4814 size=21.73KiB /26/12S (2|25|36): objs=141 size=155B /26/13N (2|25|36): objs=1748 size=7.52KiB /26/14S (2|25|36): objs=147 size=285B /26/15N (2|25|36): objs=1746 size=7.69KiB /26/16S (2|25|36): objs=154 size=149B /26/17N (2|25|36): objs=4098 size=18.37KiB /26/18S (2|25|36): objs=159 size=300B /26/19S (2|25|36): objs=152 size=174B /26/20S (2|25|36): objs=154 size=286B /26/22S (2|25|36): objs=137 size=302B /26/23N (2|25|36): objs=1755 size=7.45KiB /26/24S (2|25|36): objs=143 size=163B /26/25N (2|25|36): objs=751 size=2.88KiB /26/26S (2|25|36): objs=159 size=125B /26/27S (2|25|36): objs=162 size=289B /26/28S (2|25|36): objs=163 size=259B /26/29N (2|25|36): objs=3239 size=13.71KiB /26/30S (2|25|36): objs=155 size=144B /26/31N (2|25|36): objs=1912 size=7.9KiB /26/32S (2|25|36): objs=163 size=287B /26/33N (2|25|36): objs=652 size=2.54KiB /26/34S (2|25|36): objs=146 size=152B /26/35N (2|25|36): objs=1009 size=4.27KiB /27/0N (2|25|36): objs=41544 size=973.21KiB /27/1N (2|25|36): objs=39003 size=1.01MiB /27/2N (2|25|36): objs=38918 size=895.42KiB /27/3N (2|25|36): objs=13502 size=77.31KiB /27/4S (2|25|36): objs=142 size=268B /27/5N (2|25|36): objs=842 size=3.35KiB /27/6S (2|25|36): objs=167 size=121B /27/8S (2|25|36): objs=156 size=111B /27/9N (2|25|36): objs=2713 size=11.68KiB /27/10S (2|25|36): objs=144 size=168B /27/11N (2|25|36): objs=1508 size=6.41KiB /27/12S (2|25|36): objs=150 size=297B /27/13N (2|25|36): objs=1109 size=4.25KiB /27/14S (2|25|36): objs=142 size=144B /27/15N (2|25|36): objs=1097 size=4.17KiB /27/16S (2|25|36): objs=150 size=303B /27/18S (2|25|36): objs=167 size=318B /27/19N (2|25|36): objs=2450 size=10.21KiB /27/20S (2|25|36): objs=169 size=217B /27/22S (2|25|36): objs=164 size=345B /27/23N (2|25|36): objs=437 size=1.45KiB /27/24S (2|25|36): objs=149 size=218B /27/25N (2|25|36): objs=1365 size=5.53KiB /27/26S (2|25|36): objs=173 size=90B /27/27S (2|25|36): objs=142 size=272B /27/28S (2|25|36): objs=171 size=198B /27/29N (2|25|36): objs=7478 size=34.86KiB /27/30S (2|25|36): objs=163 size=123B /27/31N (2|25|36): objs=924 size=3.59KiB /27/32S (2|25|36): objs=146 size=109B /27/33N (2|25|36): objs=3174 size=15.95KiB /27/34S (2|25|36): objs=156 size=179B /27/35N (2|25|36): objs=2062 size=8.65KiB /28/0N (2|25|36): objs=39811 size=991.03KiB /28/1N (2|25|36): objs=37845 size=854.37KiB /28/2N (2|25|36): objs=36237 size=694.6KiB /28/3S (2|25|36): objs=167 size=104B /28/4S (2|25|36): objs=137 size=165B /28/5N (2|25|36): objs=1796 size=7.34KiB /28/6S (2|25|36): objs=152 size=283B /28/7N (2|25|36): objs=2126 size=9.06KiB /28/8S (2|25|36): objs=155 size=226B /28/9N (2|25|36): objs=2971 size=12.9KiB /28/10S (2|25|36): objs=142 size=124B /28/11N (2|25|36): objs=936 size=3.82KiB /28/12S (2|25|36): objs=154 size=321B /28/13S (2|25|36): objs=138 size=322B /28/14S (2|25|36): objs=159 size=172B /28/15N (2|25|36): objs=2028 size=8.68KiB /28/16S (2|25|36): objs=153 size=120B /28/17N (2|25|36): objs=14041 size=85.9KiB /28/18S (2|25|36): objs=151 size=193B /28/19N (2|25|36): objs=605 size=2.27KiB /28/20S (2|25|36): objs=139 size=322B /28/22S (2|25|36): objs=149 size=122B /28/23S (2|25|36): objs=159 size=232B /28/24S (2|25|36): objs=133 size=121B /28/25N (2|25|36): objs=2589 size=11.6KiB /28/26S (2|25|36): objs=171 size=357B /28/27N (2|25|36): objs=2143 size=10.21KiB /28/28S (2|25|36): objs=142 size=88B /28/29N (2|25|36): objs=731 size=2.85KiB /28/30S (2|25|36): objs=147 size=274B /28/31N (2|25|36): objs=1589 size=6.46KiB /28/32S (2|25|36): objs=151 size=319B /28/33N (2|25|36): objs=2178 size=8.97KiB /28/34S (2|25|36): objs=158 size=324B /28/35N (2|25|36): objs=979 size=3.98KiB /29/0N (2|25|36): objs=40663 size=1.01MiB /29/1N (2|25|36): objs=36828 size=770.37KiB /29/2N (2|25|36): objs=40028 size=906.13KiB /29/3N (2|25|36): objs=4147 size=18.24KiB /29/4S (2|25|36): objs=173 size=306B /29/5N (2|25|36): objs=1417 size=6.96KiB /29/6S (2|25|36): objs=170 size=246B /29/7S (2|25|36): objs=144 size=191B /29/8S (2|25|36): objs=165 size=255B /29/9N (2|25|36): objs=1833 size=7.65KiB /29/10S (2|25|36): objs=143 size=147B /29/11N (2|25|36): objs=1225 size=5.14KiB /29/12S (2|25|36): objs=167 size=291B /29/13N (2|25|36): objs=3498 size=15.22KiB /29/14S (2|25|36): objs=141 size=151B /29/15N (2|25|36): objs=3507 size=14.88KiB /29/16S (2|25|36): objs=155 size=187B /29/17N (2|25|36): objs=3278 size=13.91KiB /29/18S (2|25|36): objs=160 size=286B /29/19N (2|25|36): objs=1969 size=8.52KiB /29/20S (2|25|36): objs=162 size=146B /29/21S (2|25|36): objs=148 size=260B /29/22S (2|25|36): objs=159 size=297B /29/23N (2|25|36): objs=3102 size=12.92KiB /29/24S (2|25|36): objs=155 size=208B /29/25N (2|25|36): objs=3956 size=17.67KiB /29/26S (2|25|36): objs=154 size=148B /29/27N (2|25|36): objs=2341 size=10.01KiB /29/28S (2|25|36): objs=152 size=206B /29/29N (2|25|36): objs=2570 size=12.58KiB /29/30S (2|25|36): objs=163 size=164B /29/31N (2|25|36): objs=297 size=744B /29/32S (2|25|36): objs=147 size=295B /29/33N (2|25|36): objs=941 size=3.95KiB /29/34S (2|25|36): objs=147 size=333B /29/35N (2|25|36): objs=2149 size=8.96KiB /30/0N (2|25|36): objs=40399 size=958.51KiB /30/1N (2|25|36): objs=33225 size=542.22KiB /30/2S (2|25|36): objs=167 size=210B /30/3N (2|25|36): objs=6807 size=33.15KiB /30/4N (2|25|36): objs=41994 size=1.01MiB /30/5N (2|25|36): objs=8787 size=53.31KiB /30/6S (2|25|36): objs=157 size=307B /30/7N (2|25|36): objs=2993 size=14.29KiB /30/8S (2|25|36): objs=157 size=230B /30/9S (2|25|36): objs=132 size=277B /30/10S (2|25|36): objs=152 size=110B /30/12S (2|25|36): objs=152 size=179B /30/13S (2|25|36): objs=170 size=145B /30/14S (2|25|36): objs=161 size=121B /30/15S (2|25|36): objs=150 size=236B /30/16S (2|25|36): objs=147 size=247B /30/17N (2|25|36): objs=3404 size=15.34KiB /30/18S (2|25|36): objs=144 size=225B /30/19N (2|25|36): objs=931 size=3.62KiB /30/20S (2|25|36): objs=141 size=161B /30/21N (2|25|36): objs=1533 size=6.22KiB /30/22S (2|25|36): objs=151 size=138B /30/23N (2|25|36): objs=4225 size=22.35KiB /30/24S (2|25|36): objs=137 size=268B /30/25N (2|25|36): objs=3086 size=13.16KiB /30/26S (2|25|36): objs=162 size=98B /30/27N (2|25|36): objs=2629 size=11.33KiB /30/28S (2|25|36): objs=147 size=261B /30/30S (2|25|36): objs=147 size=261B /30/31N (2|25|36): objs=3188 size=14.36KiB /30/32S (2|25|36): objs=155 size=290B /30/33N (2|25|36): objs=1956 size=8.64KiB /30/34S (2|25|36): objs=162 size=107B /30/35N (2|25|36): objs=1798 size=7.18KiB /31/0N (2|25|36): objs=41348 size=1.04MiB /31/1N (2|25|36): objs=43007 size=953.95KiB /31/2N (2|25|36): objs=7688 size=38.54KiB /31/3S (2|25|36): objs=169 size=349B /31/4N (2|25|36): objs=30020 size=468.37KiB /31/5N (2|25|36): objs=9398 size=56.47KiB /31/6S (2|25|36): objs=168 size=142B /31/7N (2|25|36): objs=9727 size=56.78KiB /31/8S (2|25|36): objs=164 size=289B /31/9N (2|25|36): objs=1309 size=5.44KiB /31/10S (2|25|36): objs=168 size=284B /31/11N (2|25|36): objs=738 size=2.78KiB /31/12S (2|25|36): objs=163 size=172B /31/13N (2|25|36): objs=303 size=867B /31/14S (2|25|36): objs=141 size=153B /31/15N (2|25|36): objs=293 size=743B /31/16S (2|25|36): objs=161 size=325B /31/17N (2|25|36): objs=4305 size=19.27KiB /31/18S (2|25|36): objs=159 size=217B /31/19N (2|25|36): objs=3503 size=14.74KiB /31/20S (2|25|36): objs=170 size=264B /31/21N (2|25|36): objs=2077 size=8.61KiB /31/22S (2|25|36): objs=154 size=227B /31/23N (2|25|36): objs=313 size=1.08KiB /31/24S (2|25|36): objs=148 size=111B /31/25N (2|25|36): objs=1052 size=4.24KiB /31/26S (2|25|36): objs=163 size=142B /31/27N (2|25|36): objs=1505 size=6.26KiB /31/28S (2|25|36): objs=155 size=114B /31/29N (2|25|36): objs=763 size=2.81KiB /31/30S (2|25|36): objs=158 size=143B /31/31N (2|25|36): objs=762 size=2.9KiB /31/32S (2|25|36): objs=127 size=200B /31/33S (2|25|36): objs=149 size=211B /31/34S (2|25|36): objs=145 size=270B /31/35N (2|25|36): objs=1281 size=5.42KiB com.milaboratory.util.sorting.HashSorterTest > test2 SKIPPED com.milaboratory.util.sorting.SortingUtilTest > test1 STANDARD_OUT Collation: 383.03ms Sorting: 496.15ms 1 217 41410 99493 99998 com.milaboratory.util.IntCombinationsTest > test1 STANDARD_OUT [0, 1] [0, 2] [1, 2] com.milaboratory.util.AtomicEnumHistogramTest > test1 STANDARD_OUT {"labels":["A","B","C","null"],"hist":[1,2,0,1]} com.milaboratory.util.ByteStringTest > testSpeed1 STANDARD_OUT Time per hash: 645ns Addition to hash set (per operation): 1.76us Hash set removal (per operation): 987ns b com.milaboratory.util.CacheTest > test1 STANDARD_OUT Cache misses:400 Cache hits:800 com.milaboratory.util.VersionInfoTest > test3 SKIPPED com.milaboratory.util.RemoveActionTest > test1 STANDARD_OUT /tmp/milib_ba90a62062f71f558a0fd59ba70307ae9d6c518111601913460444030730 com.milaboratory.util.RemoveActionTest > test2 STANDARD_OUT /tmp/milib_22f00791c386cf1288e40b528a13435542d250c016042928911936768415.tmp Gradle Test Executor 1 finished executing tests. WARNING: A terminally deprecated method in java.lang.System has been called WARNING: System::setSecurityManager has been called by org.gradle.api.internal.tasks.testing.worker.TestWorker (file:/usr/share/gradle/lib/plugins/gradle-testing-base-4.4.1.jar) WARNING: Please consider reporting this to the maintainers of org.gradle.api.internal.tasks.testing.worker.TestWorker WARNING: System::setSecurityManager will be removed in a future release Finished generating test XML results (0.488 secs) into: /build/reproducible-path/milib-2.2.0+dfsg/build/test-results/test Generating HTML test report... Finished generating test html results (0.64 secs) into: /build/reproducible-path/milib-2.2.0+dfsg/build/reports/tests/test :test (Thread[Task worker for ':' Thread 3,5,main]) completed. Took 9 mins 13.464 secs. BUILD SUCCESSFUL in 9m 54s 5 actionable tasks: 3 executed, 2 up-to-date create-stamp debian/debhelper-build-stamp dh_prep dh_auto_install --destdir=debian/libmilib-java/ mh_install jh_installjavadoc dh_installdocs dh_installchangelogs dh_perl dh_link jh_installlibs jh_classpath jh_manifest jh_depends dh_strip_nondeterminism dh_compress dh_fixperms dh_missing dh_installdeb dh_gencontrol dh_md5sums dh_builddeb dpkg-deb: building package 'libmilib-java' in '../libmilib-java_2.2.0+dfsg-1_all.deb'. dpkg-genbuildinfo --build=binary -O../milib_2.2.0+dfsg-1_armhf.buildinfo dpkg-genchanges --build=binary -O../milib_2.2.0+dfsg-1_armhf.changes dpkg-genchanges: info: binary-only upload (no source code included) dpkg-source --after-build . dpkg-buildpackage: info: binary-only upload (no source included) dpkg-genchanges: info: including full source code in upload I: copying local configuration I: user script /srv/workspace/pbuilder/1635/tmp/hooks/B01_cleanup starting I: user script /srv/workspace/pbuilder/1635/tmp/hooks/B01_cleanup finished I: unmounting dev/ptmx filesystem I: unmounting dev/pts filesystem I: unmounting dev/shm filesystem I: unmounting proc filesystem I: unmounting sys filesystem I: cleaning the build env I: removing directory /srv/workspace/pbuilder/1635 and its subdirectories I: Current time: Tue Mar 26 06:58:32 +14 2024 I: pbuilder-time-stamp: 1711385912