I: pbuilder: network access will be disabled during build I: Current time: Thu May 22 19:23:49 +14 2025 I: pbuilder-time-stamp: 1747891429 I: Building the build Environment I: extracting base tarball [/var/cache/pbuilder/trixie-reproducible-base.tgz] I: copying local configuration W: --override-config is not set; not updating apt.conf Read the manpage for details. I: mounting /proc filesystem I: mounting /sys filesystem I: creating /{dev,run}/shm I: mounting /dev/pts filesystem I: redirecting /dev/ptmx to /dev/pts/ptmx I: policy-rc.d already exists I: Copying source file I: copying [milib_2.2.0+dfsg-1.dsc] I: copying [./milib_2.2.0+dfsg.orig.tar.xz] I: copying [./milib_2.2.0+dfsg-1.debian.tar.xz] I: Extracting source gpgv: Signature made Fri Dec 30 14:08:01 2022 gpgv: using RSA key 33CB284313E90BD27DCB4523600316A6DC277476 gpgv: Can't check signature: No public key dpkg-source: warning: cannot verify inline signature for ./milib_2.2.0+dfsg-1.dsc: no acceptable signature found dpkg-source: info: extracting milib in milib-2.2.0+dfsg dpkg-source: info: unpacking milib_2.2.0+dfsg.orig.tar.xz dpkg-source: info: unpacking milib_2.2.0+dfsg-1.debian.tar.xz dpkg-source: info: using patch list from debian/patches/series dpkg-source: info: applying build_gradle.patch dpkg-source: info: applying guava_interface.patch dpkg-source: info: applying deactivate_test_reading_build_properties.patch dpkg-source: info: applying flaky_test.patch I: Not using root during the build. I: Installing the build-deps I: user script /srv/workspace/pbuilder/1445111/tmp/hooks/D01_modify_environment starting debug: Running on codethink01-arm64. I: Changing host+domainname to test build reproducibility I: Adding a custom variable just for the fun of it... I: Changing /bin/sh to bash '/bin/sh' -> '/bin/bash' lrwxrwxrwx 1 root root 9 May 22 05:23 /bin/sh -> /bin/bash I: Setting pbuilder2's login shell to /bin/bash I: Setting pbuilder2's GECOS to second user,second room,second work-phone,second home-phone,second other I: user script /srv/workspace/pbuilder/1445111/tmp/hooks/D01_modify_environment finished I: user script /srv/workspace/pbuilder/1445111/tmp/hooks/D02_print_environment starting I: set BASH=/bin/sh BASHOPTS=checkwinsize:cmdhist:complete_fullquote:extquote:force_fignore:globasciiranges:globskipdots:hostcomplete:interactive_comments:patsub_replacement:progcomp:promptvars:sourcepath BASH_ALIASES=() BASH_ARGC=() BASH_ARGV=() BASH_CMDS=() BASH_LINENO=([0]="12" [1]="0") BASH_LOADABLES_PATH=/usr/local/lib/bash:/usr/lib/bash:/opt/local/lib/bash:/usr/pkg/lib/bash:/opt/pkg/lib/bash:. BASH_SOURCE=([0]="/tmp/hooks/D02_print_environment" [1]="/tmp/hooks/D02_print_environment") BASH_VERSINFO=([0]="5" [1]="2" [2]="21" [3]="1" [4]="release" [5]="aarch64-unknown-linux-gnu") BASH_VERSION='5.2.21(1)-release' BUILDDIR=/build/reproducible-path BUILDUSERGECOS='second user,second room,second work-phone,second home-phone,second other' BUILDUSERNAME=pbuilder2 BUILD_ARCH=arm64 DEBIAN_FRONTEND=noninteractive DEB_BUILD_OPTIONS='buildinfo=+all reproducible=+all parallel=12 ' DIRSTACK=() DISTRIBUTION=trixie EUID=0 FUNCNAME=([0]="Echo" [1]="main") GROUPS=() HOME=/root HOSTNAME=i-capture-the-hostname HOSTTYPE=aarch64 HOST_ARCH=arm64 IFS=' ' INVOCATION_ID=f240bf838e2f40809463d5c05e9fd7b0 LANG=C LANGUAGE=nl_BE:nl LC_ALL=C MACHTYPE=aarch64-unknown-linux-gnu MAIL=/var/mail/root OPTERR=1 OPTIND=1 OSTYPE=linux-gnu PATH=/usr/sbin:/usr/bin:/sbin:/bin:/usr/games:/i/capture/the/path PBCURRENTCOMMANDLINEOPERATION=build PBUILDER_OPERATION=build PBUILDER_PKGDATADIR=/usr/share/pbuilder PBUILDER_PKGLIBDIR=/usr/lib/pbuilder PBUILDER_SYSCONFDIR=/etc PIPESTATUS=([0]="0") POSIXLY_CORRECT=y PPID=1445111 PS4='+ ' PWD=/ SHELL=/bin/bash SHELLOPTS=braceexpand:errexit:hashall:interactive-comments:posix SHLVL=3 SUDO_COMMAND='/usr/bin/timeout -k 24.1h 24h /usr/bin/ionice -c 3 /usr/bin/nice -n 11 /usr/bin/unshare --uts -- /usr/sbin/pbuilder --build --configfile /srv/reproducible-results/rbuild-debian/r-b-build.fi8AkScT/pbuilderrc_p6Ls --distribution trixie --hookdir /etc/pbuilder/rebuild-hooks --debbuildopts -b --basetgz /var/cache/pbuilder/trixie-reproducible-base.tgz --buildresult /srv/reproducible-results/rbuild-debian/r-b-build.fi8AkScT/b2 --logfile b2/build.log milib_2.2.0+dfsg-1.dsc' SUDO_GID=109 SUDO_UID=104 SUDO_USER=jenkins TERM=unknown TZ=/usr/share/zoneinfo/Etc/GMT-14 UID=0 USER=root _='I: set' http_proxy=http://192.168.101.4:3128 I: uname -a Linux i-capture-the-hostname 6.1.0-20-cloud-arm64 #1 SMP Debian 6.1.85-1 (2024-04-11) aarch64 GNU/Linux I: ls -l /bin lrwxrwxrwx 1 root root 7 May 20 17:46 /bin -> usr/bin I: user script /srv/workspace/pbuilder/1445111/tmp/hooks/D02_print_environment finished -> Attempting to satisfy build-dependencies -> Creating pbuilder-satisfydepends-dummy package Package: pbuilder-satisfydepends-dummy Version: 0.invalid.0 Architecture: arm64 Maintainer: Debian Pbuilder Team Description: Dummy package to satisfy dependencies with aptitude - created by pbuilder This package was created automatically by pbuilder to satisfy the build-dependencies of the package being currently built. Depends: debhelper-compat (= 13), default-jdk, gradle-debian-helper, javahelper, maven-repo-helper, junit4, libcommons-compress-java, libcommons-io-java, libcommons-math3-java, libguava-java, libjackson2-annotations-java, libjackson2-core-java, libjackson2-databind-java, libjcommander-java, liblz4-java, libmockito-java, libredberry-pipe-java, libtrove3-java dpkg-deb: building package 'pbuilder-satisfydepends-dummy' in '/tmp/satisfydepends-aptitude/pbuilder-satisfydepends-dummy.deb'. Selecting previously unselected package pbuilder-satisfydepends-dummy. (Reading database ... 19930 files and directories currently installed.) Preparing to unpack .../pbuilder-satisfydepends-dummy.deb ... Unpacking pbuilder-satisfydepends-dummy (0.invalid.0) ... dpkg: pbuilder-satisfydepends-dummy: dependency problems, but configuring anyway as you requested: pbuilder-satisfydepends-dummy depends on debhelper-compat (= 13); however: Package debhelper-compat is not installed. pbuilder-satisfydepends-dummy depends on default-jdk; however: Package default-jdk is not installed. pbuilder-satisfydepends-dummy depends on gradle-debian-helper; however: Package gradle-debian-helper is not installed. pbuilder-satisfydepends-dummy depends on javahelper; however: Package javahelper is not installed. pbuilder-satisfydepends-dummy depends on maven-repo-helper; however: Package maven-repo-helper is not installed. pbuilder-satisfydepends-dummy depends on junit4; however: Package junit4 is not installed. pbuilder-satisfydepends-dummy depends on libcommons-compress-java; however: Package libcommons-compress-java is not installed. pbuilder-satisfydepends-dummy depends on libcommons-io-java; however: Package libcommons-io-java is not installed. pbuilder-satisfydepends-dummy depends on libcommons-math3-java; however: Package libcommons-math3-java is not installed. pbuilder-satisfydepends-dummy depends on libguava-java; however: Package libguava-java is not installed. pbuilder-satisfydepends-dummy depends on libjackson2-annotations-java; however: Package libjackson2-annotations-java is not installed. pbuilder-satisfydepends-dummy depends on libjackson2-core-java; however: Package libjackson2-core-java is not installed. pbuilder-satisfydepends-dummy depends on libjackson2-databind-java; however: Package libjackson2-databind-java is not installed. pbuilder-satisfydepends-dummy depends on libjcommander-java; however: Package libjcommander-java is not installed. pbuilder-satisfydepends-dummy depends on liblz4-java; however: Package liblz4-java is not installed. pbuilder-satisfydepends-dummy depends on libmockito-java; however: Package libmockito-java is not installed. pbuilder-satisfydepends-dummy depends on libredberry-pipe-java; however: Package libredberry-pipe-java is not installed. pbuilder-satisfydepends-dummy depends on libtrove3-java; however: Package libtrove3-java is not installed. Setting up pbuilder-satisfydepends-dummy (0.invalid.0) ... Reading package lists... Building dependency tree... Reading state information... Initializing package states... Writing extended state information... Building tag database... pbuilder-satisfydepends-dummy is already installed at the requested version (0.invalid.0) pbuilder-satisfydepends-dummy is already installed at the requested version (0.invalid.0) The following NEW packages will be installed: adwaita-icon-theme{a} ant{a} ant-optional{a} antlr{a} at-spi2-common{a} autoconf{a} automake{a} autopoint{a} autotools-dev{a} binfmt-support{a} bnd{a} bsdextrautils{a} ca-certificates{a} ca-certificates-java{a} dctrl-tools{a} debhelper{a} default-jdk{a} default-jdk-headless{a} default-jre{a} default-jre-headless{a} devscripts{a} dh-autoreconf{a} dh-strip-nondeterminism{a} dirmngr{a} dwz{a} fastjar{a} file{a} fontconfig{a} fontconfig-config{a} fonts-dejavu-core{a} fonts-dejavu-mono{a} gettext{a} gettext-base{a} gnupg{a} gnupg-l10n{a} gnupg-utils{a} gpg{a} gpg-agent{a} gpg-wks-client{a} gpg-wks-server{a} gpgconf{a} gpgsm{a} gradle{a} gradle-debian-helper{a} groff-base{a} groovy{a} gtk-update-icon-cache{a} hicolor-icon-theme{a} intltool-debian{a} ivy{a} jarwrapper{a} java-common{a} java-wrappers{a} javahelper{a} junit4{a} libantlr-java{a} libaopalliance-java{a} libapache-pom-java{a} libarchive-zip-perl{a} libasm-java{a} libasound2{a} libasound2-data{a} libassuan0{a} libatinject-jsr330-api-java{a} libatk1.0-0{a} libavahi-client3{a} libavahi-common-data{a} libavahi-common3{a} libb-hooks-op-check-perl{a} libbcel-java{a} libbcpg-java{a} libbcprov-java{a} libbrotli1{a} libbsd0{a} libbsf-java{a} libbsh-java{a} libbyte-buddy-java{a} libcairo2{a} libcdi-api-java{a} libclass-method-modifiers-perl{a} libclass-xsaccessor-perl{a} libclone-perl{a} libcommons-cli-java{a} libcommons-codec-java{a} libcommons-collections3-java{a} libcommons-compress-java{a} libcommons-io-java{a} libcommons-lang-java{a} libcommons-lang3-java{a} libcommons-logging-java{a} libcommons-math3-java{a} libcommons-parent-java{a} libcups2{a} libdatrie1{a} libdbus-1-3{a} libdd-plist-java{a} libdebhelper-perl{a} libdeflate0{a} libdevel-callchecker-perl{a} libdom4j-java{a} libdrm-amdgpu1{a} libdrm-common{a} libdrm-nouveau2{a} libdrm-radeon1{a} libdrm2{a} libdynaloader-functions-perl{a} libeclipse-jdt-annotation-java{a} libedit2{a} libel-api-java{a} libelf1{a} libencode-locale-perl{a} liberror-prone-java{a} libexpat1{a} libfelix-framework-java{a} libfelix-gogo-runtime-java{a} libfelix-resolver-java{a} libfile-dirlist-perl{a} libfile-homedir-perl{a} libfile-listing-perl{a} libfile-stripnondeterminism-perl{a} libfile-touch-perl{a} libfile-which-perl{a} libfindbugs-java{a} libfontconfig1{a} libfreetype6{a} libfribidi0{a} libgdk-pixbuf-2.0-0{a} libgdk-pixbuf2.0-common{a} libgeronimo-annotation-1.3-spec-java{a} libgeronimo-interceptor-3.0-spec-java{a} libgif7{a} libgl1{a} libgl1-mesa-dri{a} libglapi-mesa{a} libglib2.0-0{a} libglvnd0{a} libglx-mesa0{a} libglx0{a} libgoogle-gson-java{a} libgradle-core-java{a} libgradle-plugins-java{a} libgraphite2-3{a} libgtk2.0-0{a} libgtk2.0-common{a} libguava-java{a} libguice-java{a} libhamcrest-java{a} libharfbuzz0b{a} libhawtjni-runtime-java{a} libhtml-parser-perl{a} libhtml-tagset-perl{a} libhtml-tree-perl{a} libhttp-cookies-perl{a} libhttp-date-perl{a} libhttp-message-perl{a} libhttp-negotiate-perl{a} libhttpclient-java{a} libhttpcore-java{a} libicu72{a} libimport-into-perl{a} libio-html-perl{a} libio-pty-perl{a} libio-socket-ssl-perl{a} libipc-run-perl{a} libjackson2-annotations-java{a} libjackson2-core-java{a} libjackson2-databind-java{a} libjansi-java{a} libjansi-native-java{a} libjansi1-java{a} libjarjar-java{a} libjatl-java{a} libjavaewah-java{a} libjaxen-java{a} libjbig0{a} libjcifs-java{a} libjcip-annotations-java{a} libjcommander-java{a} libjetty9-java{a} libjformatstring-java{a} libjgit-java{a} libjline2-java{a} libjna-java{a} libjna-jni{a} libjpeg62-turbo{a} libjs-jquery{a} libjsch-java{a} libjsoup-java{a} libjsp-api-java{a} libjsr305-java{a} libjzlib-java{a} libkryo-java{a} libksba8{a} liblcms2-2{a} libldap-2.5-0{a} liblerc4{a} libllvm17{a} liblogback-java{a} liblwp-mediatypes-perl{a} liblwp-protocol-https-perl{a} liblz4-java{a} liblz4-jni{a} libmagic-mgc{a} libmagic1{a} libmaven-parent-java{a} libmaven-resolver-java{a} libmaven-shared-utils-java{a} libmaven3-core-java{a} libminlog-java{a} libmockito-java{a} libmodule-runtime-perl{a} libmoo-perl{a} libnative-platform-java{a} libnative-platform-jni{a} libnekohtml-java{a} libnet-http-perl{a} libnet-ssleay-perl{a} libnpth0{a} libnspr4{a} libnss3{a} libobjenesis-java{a} libosgi-annotation-java{a} libosgi-compendium-java{a} libosgi-core-java{a} libpango-1.0-0{a} libpangocairo-1.0-0{a} libpangoft2-1.0-0{a} libparams-classify-perl{a} libpcsclite1{a} libpipeline1{a} libpixman-1-0{a} libplexus-cipher-java{a} libplexus-classworlds-java{a} libplexus-component-annotations-java{a} libplexus-container-default-java{a} libplexus-interpolation-java{a} libplexus-sec-dispatcher-java{a} libplexus-utils2-java{a} libpng16-16{a} libpolyglot-maven-java{a} libpython3-stdlib{a} libpython3.11-minimal{a} libpython3.11-stdlib{a} libqdox-java{a} libreadline8{a} libredberry-pipe-java{a} libreflectasm-java{a} librhino-java{a} librole-tiny-perl{a} libsasl2-2{a} libsasl2-modules-db{a} libsensors-config{a} libsensors5{a} libservlet-api-java{a} libsharpyuv0{a} libsimple-http-java{a} libsisu-inject-java{a} libsisu-plexus-java{a} libslf4j-java{a} libsub-override-perl{a} libsub-quote-perl{a} libthai-data{a} libthai0{a} libtiff6{a} libtimedate-perl{a} libtool{a} libtrove3-java{a} libtry-tiny-perl{a} libuchardet0{a} liburi-perl{a} libvulkan1{a} libwagon-file-java{a} libwagon-http-java{a} libwagon-provider-api-java{a} libwebp7{a} libwebsocket-api-java{a} libwww-perl{a} libwww-robotrules-perl{a} libx11-6{a} libx11-data{a} libx11-xcb1{a} libxau6{a} libxbean-reflect-java{a} libxcb-dri2-0{a} libxcb-dri3-0{a} libxcb-glx0{a} libxcb-present0{a} libxcb-randr0{a} libxcb-render0{a} libxcb-shm0{a} libxcb-sync1{a} libxcb-xfixes0{a} libxcb1{a} libxcomposite1{a} libxcursor1{a} libxdamage1{a} libxdmcp6{a} libxerces2-java{a} libxext6{a} libxfixes3{a} libxi6{a} libxinerama1{a} libxml-commons-external-java{a} libxml-commons-resolver1.1-java{a} libxml2{a} libxpp3-java{a} libxrandr2{a} libxrender1{a} libxshmfence1{a} libxstream-java{a} libxtst6{a} libxxf86vm1{a} libxz-java{a} libyaml-snake-java{a} libz3-4{a} m4{a} man-db{a} maven-repo-helper{a} media-types{a} netbase{a} openjdk-17-jdk{a} openjdk-17-jdk-headless{a} openjdk-17-jre{a} openjdk-17-jre-headless{a} openssl{a} patchutils{a} perl-openssl-defaults{a} pinentry-curses{a} po-debconf{a} python3{a} python3-minimal{a} python3.11{a} python3.11-minimal{a} readline-common{a} sensible-utils{a} shared-mime-info{a} testng{a} tzdata{a} unzip{a} wdiff{a} x11-common{a} The following packages are RECOMMENDED but will NOT be installed: alsa-topology-conf alsa-ucm-conf curl dbus debian-keyring dput dput-ng dupload equivs fonts-dejavu-extra javascript-common libarchive-cpio-perl libatk-wrapper-java-jni libbindex-java libdata-dump-perl libdistro-info-perl libgail-common libgdk-pixbuf2.0-bin libgit-wrapper-perl libgitlab-api-v4-perl libglib2.0-data libgpars-groovy-java libgtk2.0-bin libhtml-form-perl libhtml-format-perl libhttp-daemon-perl libio-compress-brotli-perl libjson-perl libldap-common liblist-compare-perl libltdl-dev libmail-sendmail-perl libmailtools-perl libnamespace-clean-perl libreflectasm-java-doc librsvg2-common libsasl2-modules libsoap-lite-perl libstring-shellquote-perl libxstring-perl libxt-dev licensecheck lintian lynx mesa-vulkan-drivers pristine-tar python3-apt python3-debian python3-magic python3-requests python3-unidiff python3-xdg strace wget xdg-user-dirs 0 packages upgraded, 341 newly installed, 0 to remove and 0 not upgraded. Need to get 301 MB of archives. After unpacking 811 MB will be used. Writing extended state information... Get: 1 http://deb.debian.org/debian trixie/main arm64 libpipeline1 arm64 1.5.7-2 [36.5 kB] Get: 2 http://deb.debian.org/debian trixie/main arm64 binfmt-support arm64 2.2.2-7 [61.4 kB] Get: 3 http://deb.debian.org/debian trixie/main arm64 libpython3.11-minimal arm64 3.11.8-1 [811 kB] Get: 4 http://deb.debian.org/debian trixie/main arm64 libexpat1 arm64 2.5.0-2+b2 [85.8 kB] Get: 5 http://deb.debian.org/debian trixie/main arm64 python3.11-minimal arm64 3.11.8-1 [1848 kB] Get: 6 http://deb.debian.org/debian trixie/main arm64 python3-minimal arm64 3.11.6-1 [26.2 kB] Get: 7 http://deb.debian.org/debian trixie/main arm64 media-types all 10.1.0 [26.9 kB] Get: 8 http://deb.debian.org/debian trixie/main arm64 netbase all 6.4 [12.8 kB] Get: 9 http://deb.debian.org/debian trixie/main arm64 tzdata all 2024a-1 [255 kB] Get: 10 http://deb.debian.org/debian trixie/main arm64 readline-common all 8.2-3 [69.1 kB] Get: 11 http://deb.debian.org/debian trixie/main arm64 libreadline8 arm64 8.2-3+b1 [157 kB] Get: 12 http://deb.debian.org/debian trixie/main arm64 libpython3.11-stdlib arm64 3.11.8-1 [1781 kB] Get: 13 http://deb.debian.org/debian trixie/main arm64 python3.11 arm64 3.11.8-1 [597 kB] Get: 14 http://deb.debian.org/debian trixie/main arm64 libpython3-stdlib arm64 3.11.6-1 [9224 B] Get: 15 http://deb.debian.org/debian trixie/main arm64 python3 arm64 3.11.6-1 [26.2 kB] Get: 16 http://deb.debian.org/debian trixie/main arm64 sensible-utils all 0.0.22 [22.4 kB] Get: 17 http://deb.debian.org/debian trixie/main arm64 openssl arm64 3.1.5-1 [1208 kB] Get: 18 http://deb.debian.org/debian trixie/main arm64 ca-certificates all 20240203 [158 kB] Get: 19 http://deb.debian.org/debian trixie/main arm64 libmagic-mgc arm64 1:5.45-2+b1 [314 kB] Get: 20 http://deb.debian.org/debian trixie/main arm64 libmagic1 arm64 1:5.45-2+b1 [100 kB] Get: 21 http://deb.debian.org/debian trixie/main arm64 file arm64 1:5.45-2+b1 [43.2 kB] Get: 22 http://deb.debian.org/debian trixie/main arm64 gettext-base arm64 0.21-14+b1 [160 kB] Get: 23 http://deb.debian.org/debian trixie/main arm64 libuchardet0 arm64 0.0.8-1+b1 [69.0 kB] Get: 24 http://deb.debian.org/debian trixie/main arm64 groff-base arm64 1.23.0-3 [1127 kB] Get: 25 http://deb.debian.org/debian trixie/main arm64 bsdextrautils arm64 2.39.3-6 [90.0 kB] Get: 26 http://deb.debian.org/debian trixie/main arm64 man-db arm64 2.12.0-3 [1385 kB] Get: 27 http://deb.debian.org/debian trixie/main arm64 libgdk-pixbuf2.0-common all 2.42.10+dfsg-3 [307 kB] Get: 28 http://deb.debian.org/debian trixie/main arm64 libglib2.0-0 arm64 2.78.4-1 [1361 kB] Get: 29 http://deb.debian.org/debian trixie/main arm64 libicu72 arm64 72.1-4+b1 [9224 kB] Get: 30 http://deb.debian.org/debian trixie/main arm64 libxml2 arm64 2.9.14+dfsg-1.3+b2 [624 kB] Get: 31 http://deb.debian.org/debian trixie/main arm64 shared-mime-info arm64 2.4-1 [747 kB] Get: 32 http://deb.debian.org/debian trixie/main arm64 libjpeg62-turbo arm64 1:2.1.5-2+b2 [172 kB] Get: 33 http://deb.debian.org/debian trixie/main arm64 libpng16-16 arm64 1.6.43-1 [271 kB] Get: 34 http://deb.debian.org/debian trixie/main arm64 libdeflate0 arm64 1.20-1 [41.5 kB] Get: 35 http://deb.debian.org/debian trixie/main arm64 libjbig0 arm64 2.1-6.1+b1 [30.4 kB] Get: 36 http://deb.debian.org/debian trixie/main arm64 liblerc4 arm64 4.0.0+ds-4+b1 [142 kB] Get: 37 http://deb.debian.org/debian trixie/main arm64 libsharpyuv0 arm64 1.3.2-0.4 [106 kB] Get: 38 http://deb.debian.org/debian trixie/main arm64 libwebp7 arm64 1.3.2-0.4 [263 kB] Get: 39 http://deb.debian.org/debian trixie/main arm64 libtiff6 arm64 4.5.1+git230720-4 [307 kB] Get: 40 http://deb.debian.org/debian trixie/main arm64 libgdk-pixbuf-2.0-0 arm64 2.42.10+dfsg-3+b1 [130 kB] Get: 41 http://deb.debian.org/debian trixie/main arm64 gtk-update-icon-cache arm64 3.24.41-1 [45.2 kB] Get: 42 http://deb.debian.org/debian trixie/main arm64 hicolor-icon-theme all 0.17-2 [11.4 kB] Get: 43 http://deb.debian.org/debian trixie/main arm64 adwaita-icon-theme all 46.0-1 [614 kB] Get: 44 http://deb.debian.org/debian trixie/main arm64 ca-certificates-java all 20240118 [11.6 kB] Get: 45 http://deb.debian.org/debian trixie/main arm64 java-common all 0.75 [6640 B] Get: 46 http://deb.debian.org/debian trixie/main arm64 libavahi-common-data arm64 0.8-13+b1 [112 kB] Get: 47 http://deb.debian.org/debian trixie/main arm64 libavahi-common3 arm64 0.8-13+b1 [42.4 kB] Get: 48 http://deb.debian.org/debian trixie/main arm64 libdbus-1-3 arm64 1.14.10-4 [196 kB] Get: 49 http://deb.debian.org/debian trixie/main arm64 libavahi-client3 arm64 0.8-13+b1 [45.8 kB] Get: 50 http://deb.debian.org/debian trixie/main arm64 libcups2 arm64 2.4.7-1+b1 [230 kB] Get: 51 http://deb.debian.org/debian trixie/main arm64 liblcms2-2 arm64 2.14-2+b1 [144 kB] Get: 52 http://deb.debian.org/debian trixie/main arm64 libbrotli1 arm64 1.1.0-2+b3 [295 kB] Get: 53 http://deb.debian.org/debian trixie/main arm64 libfreetype6 arm64 2.13.2+dfsg-1+b1 [408 kB] Get: 54 http://deb.debian.org/debian trixie/main arm64 fonts-dejavu-mono all 2.37-8 [489 kB] Get: 55 http://deb.debian.org/debian trixie/main arm64 fonts-dejavu-core all 2.37-8 [840 kB] Get: 56 http://deb.debian.org/debian trixie/main arm64 fontconfig-config arm64 2.15.0-1.1 [317 kB] Get: 57 http://deb.debian.org/debian trixie/main arm64 libfontconfig1 arm64 2.15.0-1.1 [385 kB] Get: 58 http://deb.debian.org/debian trixie/main arm64 libnspr4 arm64 2:4.35-1.1+b1 [101 kB] Get: 59 http://deb.debian.org/debian trixie/main arm64 libnss3 arm64 2:3.99-1 [1293 kB] Get: 60 http://deb.debian.org/debian trixie/main arm64 libasound2-data all 1.2.10-3 [20.7 kB] Get: 61 http://deb.debian.org/debian trixie/main arm64 libasound2 arm64 1.2.10-3 [333 kB] Get: 62 http://deb.debian.org/debian trixie/main arm64 libgraphite2-3 arm64 1.3.14-2 [69.2 kB] Get: 63 http://deb.debian.org/debian trixie/main arm64 libharfbuzz0b arm64 8.3.0-2 [2178 kB] Get: 64 http://deb.debian.org/debian trixie/main arm64 libpcsclite1 arm64 2.0.1-1+b1 [50.3 kB] Get: 65 http://deb.debian.org/debian trixie/main arm64 openjdk-17-jre-headless arm64 17.0.10+7-1 [42.7 MB] Get: 66 http://deb.debian.org/debian trixie/main arm64 default-jre-headless arm64 2:1.17-75 [3068 B] Get: 67 http://deb.debian.org/debian trixie/main arm64 ant all 1.10.14-1 [2162 kB] Get: 68 http://deb.debian.org/debian trixie/main arm64 ant-optional all 1.10.14-1 [455 kB] Get: 69 http://deb.debian.org/debian trixie/main arm64 libantlr-java all 2.7.7+dfsg-13 [458 kB] Get: 70 http://deb.debian.org/debian trixie/main arm64 antlr all 2.7.7+dfsg-13 [8272 B] Get: 71 http://deb.debian.org/debian trixie/main arm64 at-spi2-common all 2.50.0-1 [163 kB] Get: 72 http://deb.debian.org/debian trixie/main arm64 m4 arm64 1.4.19-4 [277 kB] Get: 73 http://deb.debian.org/debian trixie/main arm64 autoconf all 2.71-3 [332 kB] Get: 74 http://deb.debian.org/debian trixie/main arm64 autotools-dev all 20220109.1 [51.6 kB] Get: 75 http://deb.debian.org/debian trixie/main arm64 automake all 1:1.16.5-1.3 [823 kB] Get: 76 http://deb.debian.org/debian trixie/main arm64 autopoint all 0.21-14 [496 kB] Get: 77 http://deb.debian.org/debian trixie/main arm64 unzip arm64 6.0-28 [157 kB] Get: 78 http://deb.debian.org/debian trixie/main arm64 java-wrappers all 0.4 [8916 B] Get: 79 http://deb.debian.org/debian trixie/main arm64 libhamcrest-java all 2.2-2 [121 kB] Get: 80 http://deb.debian.org/debian trixie/main arm64 junit4 all 4.13.2-4 [349 kB] Get: 81 http://deb.debian.org/debian trixie/main arm64 libfelix-framework-java all 4.6.1-2.1 [569 kB] Get: 82 http://deb.debian.org/debian trixie/main arm64 libfelix-gogo-runtime-java all 0.16.2-1.1 [114 kB] Get: 83 http://deb.debian.org/debian trixie/main arm64 libosgi-annotation-java all 8.1.0-1 [9436 B] Get: 84 http://deb.debian.org/debian trixie/main arm64 libosgi-core-java all 8.0.0-2 [182 kB] Get: 85 http://deb.debian.org/debian trixie/main arm64 libfelix-resolver-java all 1.16.0-1 [180 kB] Get: 86 http://deb.debian.org/debian trixie/main arm64 libhawtjni-runtime-java all 1.18-1 [36.3 kB] Get: 87 http://deb.debian.org/debian trixie/main arm64 libjansi-native-java all 1.8-2 [26.0 kB] Get: 88 http://deb.debian.org/debian trixie/main arm64 libjansi1-java all 1.18-3 [66.5 kB] Get: 89 http://deb.debian.org/debian trixie/main arm64 libjline2-java all 2.14.6-5 [151 kB] Get: 90 http://deb.debian.org/debian trixie/main arm64 libosgi-compendium-java all 7.0.0-1 [477 kB] Get: 91 http://deb.debian.org/debian trixie/main arm64 libslf4j-java all 1.7.32-1 [144 kB] Get: 92 http://deb.debian.org/debian trixie/main arm64 libxz-java all 1.9-1 [143 kB] Get: 93 http://deb.debian.org/debian trixie/main arm64 libyaml-snake-java all 1.33-2 [321 kB] Get: 94 http://deb.debian.org/debian trixie/main arm64 bnd all 5.0.1-5 [10.1 MB] Get: 95 http://deb.debian.org/debian trixie/main arm64 dctrl-tools arm64 2.24-3 [101 kB] Get: 96 http://deb.debian.org/debian trixie/main arm64 libdebhelper-perl all 13.15.3 [88.0 kB] Get: 97 http://deb.debian.org/debian trixie/main arm64 libtool all 2.4.7-7 [517 kB] Get: 98 http://deb.debian.org/debian trixie/main arm64 dh-autoreconf all 20 [17.1 kB] Get: 99 http://deb.debian.org/debian trixie/main arm64 libarchive-zip-perl all 1.68-1 [104 kB] Get: 100 http://deb.debian.org/debian trixie/main arm64 libsub-override-perl all 0.10-1 [10.6 kB] Get: 101 http://deb.debian.org/debian trixie/main arm64 libfile-stripnondeterminism-perl all 1.13.1-1 [19.4 kB] Get: 102 http://deb.debian.org/debian trixie/main arm64 dh-strip-nondeterminism all 1.13.1-1 [8620 B] Get: 103 http://deb.debian.org/debian trixie/main arm64 libelf1 arm64 0.190-1+b1 [175 kB] Get: 104 http://deb.debian.org/debian trixie/main arm64 dwz arm64 0.15-1 [101 kB] Get: 105 http://deb.debian.org/debian trixie/main arm64 gettext arm64 0.21-14+b1 [1249 kB] Get: 106 http://deb.debian.org/debian trixie/main arm64 intltool-debian all 0.35.0+20060710.6 [22.9 kB] Get: 107 http://deb.debian.org/debian trixie/main arm64 po-debconf all 1.0.21+nmu1 [248 kB] Get: 108 http://deb.debian.org/debian trixie/main arm64 debhelper all 13.15.3 [901 kB] Get: 109 http://deb.debian.org/debian trixie/main arm64 libgtk2.0-common all 2.24.33-3 [2659 kB] Get: 110 http://deb.debian.org/debian trixie/main arm64 libatk1.0-0 arm64 2.50.0-1+b1 [48.2 kB] Get: 111 http://deb.debian.org/debian trixie/main arm64 libpixman-1-0 arm64 0.42.2-1+b1 [477 kB] Get: 112 http://deb.debian.org/debian trixie/main arm64 libxau6 arm64 1:1.0.9-1 [19.7 kB] Get: 113 http://deb.debian.org/debian trixie/main arm64 libbsd0 arm64 0.12.2-1 [129 kB] Get: 114 http://deb.debian.org/debian trixie/main arm64 libxdmcp6 arm64 1:1.1.2-3 [25.4 kB] Get: 115 http://deb.debian.org/debian trixie/main arm64 libxcb1 arm64 1.15-1 [143 kB] Get: 116 http://deb.debian.org/debian trixie/main arm64 libx11-data all 2:1.8.7-1 [328 kB] Get: 117 http://deb.debian.org/debian trixie/main arm64 libx11-6 arm64 2:1.8.7-1 [772 kB] Get: 118 http://deb.debian.org/debian trixie/main arm64 libxcb-render0 arm64 1.15-1 [115 kB] Get: 119 http://deb.debian.org/debian trixie/main arm64 libxcb-shm0 arm64 1.15-1 [106 kB] Get: 120 http://deb.debian.org/debian trixie/main arm64 libxext6 arm64 2:1.3.4-1+b1 [51.7 kB] Get: 121 http://deb.debian.org/debian trixie/main arm64 libxrender1 arm64 1:0.9.10-1.1 [32.0 kB] Get: 122 http://deb.debian.org/debian trixie/main arm64 libcairo2 arm64 1.18.0-1+b1 [478 kB] Get: 123 http://deb.debian.org/debian trixie/main arm64 fontconfig arm64 2.15.0-1.1 [462 kB] Get: 124 http://deb.debian.org/debian trixie/main arm64 libfribidi0 arm64 1.0.13-3+b1 [71.3 kB] Get: 125 http://deb.debian.org/debian trixie/main arm64 libthai-data all 0.1.29-2 [168 kB] Get: 126 http://deb.debian.org/debian trixie/main arm64 libdatrie1 arm64 0.2.13-3 [37.2 kB] Get: 127 http://deb.debian.org/debian trixie/main arm64 libthai0 arm64 0.1.29-2 [48.0 kB] Get: 128 http://deb.debian.org/debian trixie/main arm64 libpango-1.0-0 arm64 1.52.0+ds-1 [204 kB] Get: 129 http://deb.debian.org/debian trixie/main arm64 libpangoft2-1.0-0 arm64 1.52.0+ds-1 [45.4 kB] Get: 130 http://deb.debian.org/debian trixie/main arm64 libpangocairo-1.0-0 arm64 1.52.0+ds-1 [33.1 kB] Get: 131 http://deb.debian.org/debian trixie/main arm64 libxcomposite1 arm64 1:0.4.5-1 [16.6 kB] Get: 132 http://deb.debian.org/debian trixie/main arm64 libxfixes3 arm64 1:6.0.0-2 [22.9 kB] Get: 133 http://deb.debian.org/debian trixie/main arm64 libxcursor1 arm64 1:1.2.1-1 [40.2 kB] Get: 134 http://deb.debian.org/debian trixie/main arm64 libxdamage1 arm64 1:1.1.6-1 [15.2 kB] Get: 135 http://deb.debian.org/debian trixie/main arm64 libxi6 arm64 2:1.8.1-1 [77.5 kB] Get: 136 http://deb.debian.org/debian trixie/main arm64 libxinerama1 arm64 2:1.1.4-3 [17.8 kB] Get: 137 http://deb.debian.org/debian trixie/main arm64 libxrandr2 arm64 2:1.5.4-1 [35.7 kB] Get: 138 http://deb.debian.org/debian trixie/main arm64 libgtk2.0-0 arm64 2.24.33-3 [1661 kB] Get: 139 http://deb.debian.org/debian trixie/main arm64 libglvnd0 arm64 1.7.0-1 [41.2 kB] Get: 140 http://deb.debian.org/debian trixie/main arm64 libdrm-common all 2.4.120-2 [7688 B] Get: 141 http://deb.debian.org/debian trixie/main arm64 libdrm2 arm64 2.4.120-2 [37.5 kB] Get: 142 http://deb.debian.org/debian trixie/main arm64 libglapi-mesa arm64 23.3.5-1 [45.5 kB] Get: 143 http://deb.debian.org/debian trixie/main arm64 libx11-xcb1 arm64 2:1.8.7-1 [232 kB] Get: 144 http://deb.debian.org/debian trixie/main arm64 libxcb-dri2-0 arm64 1.15-1 [107 kB] Get: 145 http://deb.debian.org/debian trixie/main arm64 libxcb-dri3-0 arm64 1.15-1 [107 kB] Get: 146 http://deb.debian.org/debian trixie/main arm64 libxcb-glx0 arm64 1.15-1 [123 kB] Get: 147 http://deb.debian.org/debian trixie/main arm64 libxcb-present0 arm64 1.15-1 [106 kB] Get: 148 http://deb.debian.org/debian trixie/main arm64 libxcb-randr0 arm64 1.15-1 [117 kB] Get: 149 http://deb.debian.org/debian trixie/main arm64 libxcb-sync1 arm64 1.15-1 [109 kB] Get: 150 http://deb.debian.org/debian trixie/main arm64 libxcb-xfixes0 arm64 1.15-1 [110 kB] Get: 151 http://deb.debian.org/debian trixie/main arm64 libxshmfence1 arm64 1.3-1 [8712 B] Get: 152 http://deb.debian.org/debian trixie/main arm64 libxxf86vm1 arm64 1:1.1.4-1+b2 [20.1 kB] Get: 153 http://deb.debian.org/debian trixie/main arm64 libvulkan1 arm64 1.3.275.0-1 [119 kB] Get: 154 http://deb.debian.org/debian trixie/main arm64 libdrm-amdgpu1 arm64 2.4.120-2 [21.0 kB] Get: 155 http://deb.debian.org/debian trixie/main arm64 libdrm-nouveau2 arm64 2.4.120-2 [18.7 kB] Get: 156 http://deb.debian.org/debian trixie/main arm64 libdrm-radeon1 arm64 2.4.120-2 [21.1 kB] Get: 157 http://deb.debian.org/debian trixie/main arm64 libedit2 arm64 3.1-20230828-1 [88.9 kB] Get: 158 http://deb.debian.org/debian trixie/main arm64 libz3-4 arm64 4.8.12-3.1+b2 [6508 kB] Get: 159 http://deb.debian.org/debian trixie/main arm64 libllvm17 arm64 1:17.0.6-5 [21.3 MB] Get: 160 http://deb.debian.org/debian trixie/main arm64 libsensors-config all 1:3.6.0-9 [14.6 kB] Get: 161 http://deb.debian.org/debian trixie/main arm64 libsensors5 arm64 1:3.6.0-9 [33.9 kB] Get: 162 http://deb.debian.org/debian trixie/main arm64 libgl1-mesa-dri arm64 23.3.5-1 [6928 kB] Get: 163 http://deb.debian.org/debian trixie/main arm64 libglx-mesa0 arm64 23.3.5-1 [150 kB] Get: 164 http://deb.debian.org/debian trixie/main arm64 libglx0 arm64 1.7.0-1 [30.7 kB] Get: 165 http://deb.debian.org/debian trixie/main arm64 libgl1 arm64 1.7.0-1 [90.6 kB] Get: 166 http://deb.debian.org/debian trixie/main arm64 libgif7 arm64 5.2.2-1 [43.7 kB] Get: 167 http://deb.debian.org/debian trixie/main arm64 x11-common all 1:7.7+23 [252 kB] Get: 168 http://deb.debian.org/debian trixie/main arm64 libxtst6 arm64 2:1.2.3-1.1 [27.8 kB] Get: 169 http://deb.debian.org/debian trixie/main arm64 openjdk-17-jre arm64 17.0.10+7-1 [173 kB] Get: 170 http://deb.debian.org/debian trixie/main arm64 default-jre arm64 2:1.17-75 [1056 B] Get: 171 http://deb.debian.org/debian trixie/main arm64 openjdk-17-jdk-headless arm64 17.0.10+7-1 [70.6 MB] Get: 172 http://deb.debian.org/debian trixie/main arm64 default-jdk-headless arm64 2:1.17-75 [1108 B] Get: 173 http://deb.debian.org/debian trixie/main arm64 openjdk-17-jdk arm64 17.0.10+7-1 [2370 kB] Get: 174 http://deb.debian.org/debian trixie/main arm64 default-jdk arm64 2:1.17-75 [1068 B] Get: 175 http://deb.debian.org/debian trixie/main arm64 libassuan0 arm64 2.5.6-1 [47.3 kB] Get: 176 http://deb.debian.org/debian trixie/main arm64 gpgconf arm64 2.2.40-1.1+b1 [558 kB] Get: 177 http://deb.debian.org/debian trixie/main arm64 libksba8 arm64 1.6.6-1 [122 kB] Get: 178 http://deb.debian.org/debian trixie/main arm64 libsasl2-modules-db arm64 2.1.28+dfsg1-4+b1 [20.2 kB] Get: 179 http://deb.debian.org/debian trixie/main arm64 libsasl2-2 arm64 2.1.28+dfsg1-4+b1 [55.5 kB] Get: 180 http://deb.debian.org/debian trixie/main arm64 libldap-2.5-0 arm64 2.5.13+dfsg-5+b3 [172 kB] Get: 181 http://deb.debian.org/debian trixie/main arm64 libnpth0 arm64 1.6-3+b1 [17.9 kB] Get: 182 http://deb.debian.org/debian trixie/main arm64 dirmngr arm64 2.2.40-1.1+b1 [771 kB] Get: 183 http://deb.debian.org/debian trixie/main arm64 gnupg-l10n all 2.2.40-1.1 [1093 kB] Get: 184 http://deb.debian.org/debian trixie/main arm64 gnupg-utils arm64 2.2.40-1.1+b1 [881 kB] Get: 185 http://deb.debian.org/debian trixie/main arm64 gpg arm64 2.2.40-1.1+b1 [903 kB] Get: 186 http://deb.debian.org/debian trixie/main arm64 pinentry-curses arm64 1.2.1-3 [75.7 kB] Get: 187 http://deb.debian.org/debian trixie/main arm64 gpg-agent arm64 2.2.40-1.1+b1 [676 kB] Get: 188 http://deb.debian.org/debian trixie/main arm64 gpg-wks-client arm64 2.2.40-1.1+b1 [533 kB] Get: 189 http://deb.debian.org/debian trixie/main arm64 gpg-wks-server arm64 2.2.40-1.1+b1 [525 kB] Get: 190 http://deb.debian.org/debian trixie/main arm64 gpgsm arm64 2.2.40-1.1+b1 [650 kB] Get: 191 http://deb.debian.org/debian trixie/main arm64 gnupg all 2.2.40-1.1 [846 kB] Get: 192 http://deb.debian.org/debian trixie/main arm64 libfile-dirlist-perl all 0.05-3 [7600 B] Get: 193 http://deb.debian.org/debian trixie/main arm64 libfile-which-perl all 1.27-2 [15.1 kB] Get: 194 http://deb.debian.org/debian trixie/main arm64 libfile-homedir-perl all 1.006-2 [42.4 kB] Get: 195 http://deb.debian.org/debian trixie/main arm64 libfile-touch-perl all 0.12-2 [8816 B] Get: 196 http://deb.debian.org/debian trixie/main arm64 libio-pty-perl arm64 1:1.20-1 [33.8 kB] Get: 197 http://deb.debian.org/debian trixie/main arm64 libipc-run-perl all 20231003.0-2 [101 kB] Get: 198 http://deb.debian.org/debian trixie/main arm64 libclass-method-modifiers-perl all 2.15-1 [18.0 kB] Get: 199 http://deb.debian.org/debian trixie/main arm64 libclass-xsaccessor-perl arm64 1.19-4+b2 [35.2 kB] Get: 200 http://deb.debian.org/debian trixie/main arm64 libb-hooks-op-check-perl arm64 0.22-2+b2 [10.7 kB] Get: 201 http://deb.debian.org/debian trixie/main arm64 libdynaloader-functions-perl all 0.003-3 [12.7 kB] Get: 202 http://deb.debian.org/debian trixie/main arm64 libdevel-callchecker-perl arm64 0.008-2+b1 [15.2 kB] Get: 203 http://deb.debian.org/debian trixie/main arm64 libparams-classify-perl arm64 0.015-2+b2 [22.3 kB] Get: 204 http://deb.debian.org/debian trixie/main arm64 libmodule-runtime-perl all 0.016-2 [19.6 kB] Get: 205 http://deb.debian.org/debian trixie/main arm64 libimport-into-perl all 1.002005-2 [11.3 kB] Get: 206 http://deb.debian.org/debian trixie/main arm64 librole-tiny-perl all 2.002004-1 [21.4 kB] Get: 207 http://deb.debian.org/debian trixie/main arm64 libsub-quote-perl all 2.006008-1 [21.8 kB] Get: 208 http://deb.debian.org/debian trixie/main arm64 libmoo-perl all 2.005005-1 [58.0 kB] Get: 209 http://deb.debian.org/debian trixie/main arm64 libencode-locale-perl all 1.05-3 [12.9 kB] Get: 210 http://deb.debian.org/debian trixie/main arm64 libtimedate-perl all 2.3300-2 [39.3 kB] Get: 211 http://deb.debian.org/debian trixie/main arm64 libhttp-date-perl all 6.06-1 [10.7 kB] Get: 212 http://deb.debian.org/debian trixie/main arm64 libfile-listing-perl all 6.16-1 [12.4 kB] Get: 213 http://deb.debian.org/debian trixie/main arm64 libhtml-tagset-perl all 3.24-1 [14.7 kB] Get: 214 http://deb.debian.org/debian trixie/main arm64 liburi-perl all 5.28-1 [98.6 kB] Get: 215 http://deb.debian.org/debian trixie/main arm64 libhtml-parser-perl arm64 3.81-1+b1 [97.1 kB] Get: 216 http://deb.debian.org/debian trixie/main arm64 libhtml-tree-perl all 5.07-3 [211 kB] Get: 217 http://deb.debian.org/debian trixie/main arm64 libclone-perl arm64 0.46-1+b1 [13.6 kB] Get: 218 http://deb.debian.org/debian trixie/main arm64 libio-html-perl all 1.004-3 [16.2 kB] Get: 219 http://deb.debian.org/debian trixie/main arm64 liblwp-mediatypes-perl all 6.04-2 [20.2 kB] Get: 220 http://deb.debian.org/debian trixie/main arm64 libhttp-message-perl all 6.45-1 [82.0 kB] Get: 221 http://deb.debian.org/debian trixie/main arm64 libhttp-cookies-perl all 6.11-1 [19.1 kB] Get: 222 http://deb.debian.org/debian trixie/main arm64 libhttp-negotiate-perl all 6.01-2 [13.1 kB] Get: 223 http://deb.debian.org/debian trixie/main arm64 perl-openssl-defaults arm64 7+b1 [7924 B] Get: 224 http://deb.debian.org/debian trixie/main arm64 libnet-ssleay-perl arm64 1.94-1 [327 kB] Get: 225 http://deb.debian.org/debian trixie/main arm64 libio-socket-ssl-perl all 2.085-1 [218 kB] Get: 226 http://deb.debian.org/debian trixie/main arm64 libnet-http-perl all 6.23-1 [23.9 kB] Get: 227 http://deb.debian.org/debian trixie/main arm64 liblwp-protocol-https-perl all 6.14-1 [10.8 kB] Get: 228 http://deb.debian.org/debian trixie/main arm64 libtry-tiny-perl all 0.31-2 [22.6 kB] Get: 229 http://deb.debian.org/debian trixie/main arm64 libwww-robotrules-perl all 6.02-1 [12.9 kB] Get: 230 http://deb.debian.org/debian trixie/main arm64 libwww-perl all 6.77-1 [183 kB] Get: 231 http://deb.debian.org/debian trixie/main arm64 patchutils arm64 0.4.2-1 [73.5 kB] Get: 232 http://deb.debian.org/debian trixie/main arm64 wdiff arm64 1.2.2-6 [118 kB] Get: 233 http://deb.debian.org/debian trixie/main arm64 devscripts all 2.23.7 [1068 kB] Get: 234 http://deb.debian.org/debian trixie/main arm64 fastjar arm64 2:0.98-7 [75.5 kB] Get: 235 http://deb.debian.org/debian trixie/main arm64 ivy all 2.5.2-1 [1295 kB] Get: 236 http://deb.debian.org/debian trixie/main arm64 libasm-java all 9.7-1 [394 kB] Get: 237 http://deb.debian.org/debian trixie/main arm64 libbsf-java all 1:2.4.0-8 [76.3 kB] Get: 238 http://deb.debian.org/debian trixie/main arm64 libcommons-cli-java all 1.6.0-1 [60.4 kB] Get: 239 http://deb.debian.org/debian trixie/main arm64 libapache-pom-java all 29-2 [5276 B] Get: 240 http://deb.debian.org/debian trixie/main arm64 libcommons-parent-java all 56-1 [10.8 kB] Get: 241 http://deb.debian.org/debian trixie/main arm64 libcommons-logging-java all 1.3.0-1 [68.6 kB] Get: 242 http://deb.debian.org/debian trixie/main arm64 libjansi-java all 2.4.1-2 [100 kB] Get: 243 http://deb.debian.org/debian trixie/main arm64 libjsp-api-java all 2.3.4-3 [53.7 kB] Get: 244 http://deb.debian.org/debian trixie/main arm64 libqdox-java all 1.12.1-3 [172 kB] Get: 245 http://deb.debian.org/debian trixie/main arm64 libservlet-api-java all 4.0.1-2 [81.0 kB] Get: 246 http://deb.debian.org/debian trixie/main arm64 libxpp3-java all 1.1.4c-3 [292 kB] Get: 247 http://deb.debian.org/debian trixie/main arm64 libxstream-java all 1.4.20-1 [565 kB] Get: 248 http://deb.debian.org/debian trixie/main arm64 groovy all 2.4.21-10 [12.8 MB] Get: 249 http://deb.debian.org/debian trixie/main arm64 libatinject-jsr330-api-java all 1.0+ds1-5 [5312 B] Get: 250 http://deb.debian.org/debian trixie/main arm64 libcommons-collections3-java all 3.2.2-3 [530 kB] Get: 251 http://deb.debian.org/debian trixie/main arm64 libcommons-compress-java all 1.25.0-1 [635 kB] Get: 252 http://deb.debian.org/debian trixie/main arm64 libcommons-io-java all 2.16.0-1 [484 kB] Get: 253 http://deb.debian.org/debian trixie/main arm64 libcommons-lang-java all 2.6-10 [273 kB] Get: 254 http://deb.debian.org/debian trixie/main arm64 liberror-prone-java all 2.18.0-1 [22.5 kB] Get: 255 http://deb.debian.org/debian trixie/main arm64 libjsr305-java all 0.1~+svn49-11 [26.9 kB] Get: 256 http://deb.debian.org/debian trixie/main arm64 libguava-java all 32.0.1-1 [2708 kB] Get: 257 http://deb.debian.org/debian trixie/main arm64 libcommons-codec-java all 1.16.0-1 [297 kB] Get: 258 http://deb.debian.org/debian trixie/main arm64 libhttpcore-java all 4.4.16-1 [636 kB] Get: 259 http://deb.debian.org/debian trixie/main arm64 libhttpclient-java all 4.5.14-1 [1247 kB] Get: 260 http://deb.debian.org/debian trixie/main arm64 libjarjar-java all 1.4+svn142-12 [205 kB] Get: 261 http://deb.debian.org/debian trixie/main arm64 libjcip-annotations-java all 20060626-6 [11.8 kB] Get: 262 http://deb.debian.org/debian trixie/main arm64 libjna-jni arm64 5.14.0-1 [61.5 kB] Get: 263 http://deb.debian.org/debian trixie/main arm64 libjna-java all 5.14.0-1 [237 kB] Get: 264 http://deb.debian.org/debian trixie/main arm64 libjzlib-java all 1.1.3-3 [79.4 kB] Get: 265 http://deb.debian.org/debian trixie/main arm64 libjsch-java all 0.1.55-1 [298 kB] Get: 266 http://deb.debian.org/debian trixie/main arm64 libminlog-java all 1.3.0-1.1 [7928 B] Get: 267 http://deb.debian.org/debian trixie/main arm64 libobjenesis-java all 3.3-3 [41.3 kB] Get: 268 http://deb.debian.org/debian trixie/main arm64 libreflectasm-java all 1.11.9+dfsg-4 [25.0 kB] Get: 269 http://deb.debian.org/debian trixie/main arm64 libkryo-java all 2.20-7 [158 kB] Get: 270 http://deb.debian.org/debian trixie/main arm64 liblogback-java all 1:1.2.11-5 [701 kB] Get: 271 http://deb.debian.org/debian trixie/main arm64 libnative-platform-jni arm64 0.14-6 [11.4 kB] Get: 272 http://deb.debian.org/debian trixie/main arm64 libnative-platform-java all 0.14-6 [69.8 kB] Get: 273 http://deb.debian.org/debian trixie/main arm64 libxml-commons-external-java all 1.4.01-6 [240 kB] Get: 274 http://deb.debian.org/debian trixie/main arm64 libxml-commons-resolver1.1-java all 1.2-11 [98.3 kB] Get: 275 http://deb.debian.org/debian trixie/main arm64 libxerces2-java all 2.12.2-1 [1440 kB] Get: 276 http://deb.debian.org/debian trixie/main arm64 libnekohtml-java all 1.9.22.noko2-0.1 [125 kB] Get: 277 http://deb.debian.org/debian trixie/main arm64 libxbean-reflect-java all 4.5-8 [133 kB] Get: 278 http://deb.debian.org/debian trixie/main arm64 libgradle-core-java all 4.4.1-20 [4293 kB] Get: 279 http://deb.debian.org/debian trixie/main arm64 libbcprov-java all 1.77-1 [5300 kB] Get: 280 http://deb.debian.org/debian trixie/main arm64 libbcpg-java all 1.77-1 [428 kB] Get: 281 http://deb.debian.org/debian trixie/main arm64 libbsh-java all 2.0b4-20 [291 kB] Get: 282 http://deb.debian.org/debian trixie/main arm64 libdd-plist-java all 1.20-1.1 [72.6 kB] Get: 283 http://deb.debian.org/debian trixie/main arm64 libjaxen-java all 1.1.6-4 [214 kB] Get: 284 http://deb.debian.org/debian trixie/main arm64 libdom4j-java all 2.1.4-1 [312 kB] Get: 285 http://deb.debian.org/debian trixie/main arm64 libbcel-java all 6.5.0-2 [634 kB] Get: 286 http://deb.debian.org/debian trixie/main arm64 libjformatstring-java all 0.10~20131207-2.1 [34.5 kB] Get: 287 http://deb.debian.org/debian trixie/main arm64 libfindbugs-java all 3.1.0~preview2-3 [3502 kB] Get: 288 http://deb.debian.org/debian trixie/main arm64 libgoogle-gson-java all 2.10.1-1 [262 kB] Get: 289 http://deb.debian.org/debian trixie/main arm64 libaopalliance-java all 20070526-7 [8572 B] Get: 290 http://deb.debian.org/debian trixie/main arm64 libguice-java all 4.2.3-2 [1435 kB] Get: 291 http://deb.debian.org/debian trixie/main arm64 libjatl-java all 0.2.3-1.1 [29.0 kB] Get: 292 http://deb.debian.org/debian trixie/main arm64 libjcifs-java all 1.3.19-2 [394 kB] Get: 293 http://deb.debian.org/debian trixie/main arm64 libeclipse-jdt-annotation-java all 2.2.700+eclipse4.26-2 [25.3 kB] Get: 294 http://deb.debian.org/debian trixie/main arm64 libjavaewah-java all 1.2.3-1 [159 kB] Get: 295 http://deb.debian.org/debian trixie/main arm64 libel-api-java all 3.0.0-3 [64.9 kB] Get: 296 http://deb.debian.org/debian trixie/main arm64 libwebsocket-api-java all 1.1-2 [40.1 kB] Get: 297 http://deb.debian.org/debian trixie/main arm64 libjetty9-java all 9.4.54-1 [2980 kB] Get: 298 http://deb.debian.org/debian trixie/main arm64 libjgit-java all 4.11.9-2 [2534 kB] Get: 299 http://deb.debian.org/debian trixie/main arm64 libjs-jquery all 3.6.1+dfsg+~3.5.14-1 [326 kB] Get: 300 http://deb.debian.org/debian trixie/main arm64 libcommons-lang3-java all 3.14.0-1 [621 kB] Get: 301 http://deb.debian.org/debian trixie/main arm64 libplexus-utils2-java all 3.4.2-1 [258 kB] Get: 302 http://deb.debian.org/debian trixie/main arm64 libwagon-provider-api-java all 3.5.3-1 [48.2 kB] Get: 303 http://deb.debian.org/debian trixie/main arm64 libmaven-resolver-java all 1.6.3-1 [548 kB] Get: 304 http://deb.debian.org/debian trixie/main arm64 libgeronimo-annotation-1.3-spec-java all 1.3-1 [11.1 kB] Get: 305 http://deb.debian.org/debian trixie/main arm64 libmaven-parent-java all 35-1 [6140 B] Get: 306 http://deb.debian.org/debian trixie/main arm64 libmaven-shared-utils-java all 3.3.4-1 [138 kB] Get: 307 http://deb.debian.org/debian trixie/main arm64 libplexus-cipher-java all 2.0-1 [14.9 kB] Get: 308 http://deb.debian.org/debian trixie/main arm64 libplexus-classworlds-java all 2.7.0-1 [50.6 kB] Get: 309 http://deb.debian.org/debian trixie/main arm64 libplexus-component-annotations-java all 2.1.1-1 [7660 B] Get: 310 http://deb.debian.org/debian trixie/main arm64 libplexus-interpolation-java all 1.26-1 [76.8 kB] Get: 311 http://deb.debian.org/debian trixie/main arm64 libplexus-sec-dispatcher-java all 2.0-3 [28.3 kB] Get: 312 http://deb.debian.org/debian trixie/main arm64 libgeronimo-interceptor-3.0-spec-java all 1.0.1-4 [8484 B] Get: 313 http://deb.debian.org/debian trixie/main arm64 libcdi-api-java all 1.2-3 [54.3 kB] Get: 314 http://deb.debian.org/debian trixie/main arm64 libsisu-inject-java all 0.3.4-2 [347 kB] Get: 315 http://deb.debian.org/debian trixie/main arm64 libsisu-plexus-java all 0.3.4-3 [181 kB] Get: 316 http://deb.debian.org/debian trixie/main arm64 libmaven3-core-java all 3.8.7-2 [1573 kB] Get: 317 http://deb.debian.org/debian trixie/main arm64 libplexus-container-default-java all 2.1.1-1 [193 kB] Get: 318 http://deb.debian.org/debian trixie/main arm64 libpolyglot-maven-java all 0.8~tobrien+git20120905-10 [74.9 kB] Get: 319 http://deb.debian.org/debian trixie/main arm64 librhino-java all 1.7.14-2.1 [1357 kB] Get: 320 http://deb.debian.org/debian trixie/main arm64 libsimple-http-java all 4.1.21-1.1 [211 kB] Get: 321 http://deb.debian.org/debian trixie/main arm64 libwagon-file-java all 3.5.3-1 [8388 B] Get: 322 http://deb.debian.org/debian trixie/main arm64 libjsoup-java all 1.15.3-1 [431 kB] Get: 323 http://deb.debian.org/debian trixie/main arm64 libwagon-http-java all 3.5.3-1 [49.5 kB] Get: 324 http://deb.debian.org/debian trixie/main arm64 libjcommander-java all 1.71-4 [73.0 kB] Get: 325 http://deb.debian.org/debian trixie/main arm64 testng all 6.9.12-4 [795 kB] Get: 326 http://deb.debian.org/debian trixie/main arm64 libgradle-plugins-java all 4.4.1-20 [5206 kB] Get: 327 http://deb.debian.org/debian trixie/main arm64 gradle all 4.4.1-20 [398 kB] Get: 328 http://deb.debian.org/debian trixie/main arm64 maven-repo-helper all 1.11 [142 kB] Get: 329 http://deb.debian.org/debian trixie/main arm64 gradle-debian-helper all 2.4 [24.5 kB] Get: 330 http://deb.debian.org/debian trixie/main arm64 jarwrapper all 0.79 [10.1 kB] Get: 331 http://deb.debian.org/debian trixie/main arm64 javahelper all 0.79 [84.6 kB] Get: 332 http://deb.debian.org/debian trixie/main arm64 libbyte-buddy-java all 1.14.13-1 [4709 kB] Get: 333 http://deb.debian.org/debian trixie/main arm64 libcommons-math3-java all 3.6.1-3 [2018 kB] Get: 334 http://deb.debian.org/debian trixie/main arm64 libjackson2-annotations-java all 2.14.0-1 [68.8 kB] Get: 335 http://deb.debian.org/debian trixie/main arm64 libjackson2-core-java all 2.14.1-1 [447 kB] Get: 336 http://deb.debian.org/debian trixie/main arm64 libjackson2-databind-java all 2.14.0-1 [1584 kB] Get: 337 http://deb.debian.org/debian trixie/main arm64 liblz4-jni arm64 1.8.0-4 [10.1 kB] Get: 338 http://deb.debian.org/debian trixie/main arm64 liblz4-java all 1.8.0-4 [116 kB] Get: 339 http://deb.debian.org/debian trixie/main arm64 libmockito-java all 2.23.0-2 [479 kB] Get: 340 http://deb.debian.org/debian trixie/main arm64 libredberry-pipe-java all 1.0.0~alpha0-3 [62.7 kB] Get: 341 http://deb.debian.org/debian trixie/main arm64 libtrove3-java all 3.0.3-5 [2146 kB] Fetched 301 MB in 2s (134 MB/s) debconf: delaying package configuration, since apt-utils is not installed Selecting previously unselected package libpipeline1:arm64. (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 19930 files and directories currently installed.) Preparing to unpack .../libpipeline1_1.5.7-2_arm64.deb ... Unpacking libpipeline1:arm64 (1.5.7-2) ... Selecting previously unselected package binfmt-support. Preparing to unpack .../binfmt-support_2.2.2-7_arm64.deb ... Unpacking binfmt-support (2.2.2-7) ... Selecting previously unselected package libpython3.11-minimal:arm64. Preparing to unpack .../libpython3.11-minimal_3.11.8-1_arm64.deb ... Unpacking libpython3.11-minimal:arm64 (3.11.8-1) ... Selecting previously unselected package libexpat1:arm64. Preparing to unpack .../libexpat1_2.5.0-2+b2_arm64.deb ... Unpacking libexpat1:arm64 (2.5.0-2+b2) ... Selecting previously unselected package python3.11-minimal. Preparing to unpack .../python3.11-minimal_3.11.8-1_arm64.deb ... Unpacking python3.11-minimal (3.11.8-1) ... Setting up libpython3.11-minimal:arm64 (3.11.8-1) ... Setting up libexpat1:arm64 (2.5.0-2+b2) ... Setting up python3.11-minimal (3.11.8-1) ... Selecting previously unselected package python3-minimal. (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 20270 files and directories currently installed.) Preparing to unpack .../0-python3-minimal_3.11.6-1_arm64.deb ... Unpacking python3-minimal (3.11.6-1) ... Selecting previously unselected package media-types. Preparing to unpack .../1-media-types_10.1.0_all.deb ... Unpacking media-types (10.1.0) ... Selecting previously unselected package netbase. Preparing to unpack .../2-netbase_6.4_all.deb ... Unpacking netbase (6.4) ... Selecting previously unselected package tzdata. Preparing to unpack .../3-tzdata_2024a-1_all.deb ... Unpacking tzdata (2024a-1) ... Selecting previously unselected package readline-common. Preparing to unpack .../4-readline-common_8.2-3_all.deb ... Unpacking readline-common (8.2-3) ... Selecting previously unselected package libreadline8:arm64. Preparing to unpack .../5-libreadline8_8.2-3+b1_arm64.deb ... Unpacking libreadline8:arm64 (8.2-3+b1) ... Selecting previously unselected package libpython3.11-stdlib:arm64. Preparing to unpack .../6-libpython3.11-stdlib_3.11.8-1_arm64.deb ... Unpacking libpython3.11-stdlib:arm64 (3.11.8-1) ... Selecting previously unselected package python3.11. Preparing to unpack .../7-python3.11_3.11.8-1_arm64.deb ... Unpacking python3.11 (3.11.8-1) ... Selecting previously unselected package libpython3-stdlib:arm64. Preparing to unpack .../8-libpython3-stdlib_3.11.6-1_arm64.deb ... Unpacking libpython3-stdlib:arm64 (3.11.6-1) ... Setting up python3-minimal (3.11.6-1) ... Selecting previously unselected package python3. (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 21258 files and directories currently installed.) Preparing to unpack .../000-python3_3.11.6-1_arm64.deb ... Unpacking python3 (3.11.6-1) ... Selecting previously unselected package sensible-utils. Preparing to unpack .../001-sensible-utils_0.0.22_all.deb ... Unpacking sensible-utils (0.0.22) ... Selecting previously unselected package openssl. Preparing to unpack .../002-openssl_3.1.5-1_arm64.deb ... Unpacking openssl (3.1.5-1) ... Selecting previously unselected package ca-certificates. Preparing to unpack .../003-ca-certificates_20240203_all.deb ... Unpacking ca-certificates (20240203) ... Selecting previously unselected package libmagic-mgc. Preparing to unpack .../004-libmagic-mgc_1%3a5.45-2+b1_arm64.deb ... Unpacking libmagic-mgc (1:5.45-2+b1) ... Selecting previously unselected package libmagic1:arm64. Preparing to unpack .../005-libmagic1_1%3a5.45-2+b1_arm64.deb ... Unpacking libmagic1:arm64 (1:5.45-2+b1) ... Selecting previously unselected package file. Preparing to unpack .../006-file_1%3a5.45-2+b1_arm64.deb ... Unpacking file (1:5.45-2+b1) ... Selecting previously unselected package gettext-base. Preparing to unpack .../007-gettext-base_0.21-14+b1_arm64.deb ... Unpacking gettext-base (0.21-14+b1) ... Selecting previously unselected package libuchardet0:arm64. Preparing to unpack .../008-libuchardet0_0.0.8-1+b1_arm64.deb ... Unpacking libuchardet0:arm64 (0.0.8-1+b1) ... Selecting previously unselected package groff-base. Preparing to unpack .../009-groff-base_1.23.0-3_arm64.deb ... Unpacking groff-base (1.23.0-3) ... Selecting previously unselected package bsdextrautils. Preparing to unpack .../010-bsdextrautils_2.39.3-6_arm64.deb ... Unpacking bsdextrautils (2.39.3-6) ... Selecting previously unselected package man-db. Preparing to unpack .../011-man-db_2.12.0-3_arm64.deb ... Unpacking man-db (2.12.0-3) ... Selecting previously unselected package libgdk-pixbuf2.0-common. Preparing to unpack .../012-libgdk-pixbuf2.0-common_2.42.10+dfsg-3_all.deb ... Unpacking libgdk-pixbuf2.0-common (2.42.10+dfsg-3) ... Selecting previously unselected package libglib2.0-0:arm64. Preparing to unpack .../013-libglib2.0-0_2.78.4-1_arm64.deb ... Unpacking libglib2.0-0:arm64 (2.78.4-1) ... Selecting previously unselected package libicu72:arm64. Preparing to unpack .../014-libicu72_72.1-4+b1_arm64.deb ... Unpacking libicu72:arm64 (72.1-4+b1) ... Selecting previously unselected package libxml2:arm64. Preparing to unpack .../015-libxml2_2.9.14+dfsg-1.3+b2_arm64.deb ... Unpacking libxml2:arm64 (2.9.14+dfsg-1.3+b2) ... Selecting previously unselected package shared-mime-info. Preparing to unpack .../016-shared-mime-info_2.4-1_arm64.deb ... Unpacking shared-mime-info (2.4-1) ... Selecting previously unselected package libjpeg62-turbo:arm64. Preparing to unpack .../017-libjpeg62-turbo_1%3a2.1.5-2+b2_arm64.deb ... Unpacking libjpeg62-turbo:arm64 (1:2.1.5-2+b2) ... Selecting previously unselected package libpng16-16:arm64. Preparing to unpack .../018-libpng16-16_1.6.43-1_arm64.deb ... Unpacking libpng16-16:arm64 (1.6.43-1) ... Selecting previously unselected package libdeflate0:arm64. Preparing to unpack .../019-libdeflate0_1.20-1_arm64.deb ... Unpacking libdeflate0:arm64 (1.20-1) ... Selecting previously unselected package libjbig0:arm64. Preparing to unpack .../020-libjbig0_2.1-6.1+b1_arm64.deb ... Unpacking libjbig0:arm64 (2.1-6.1+b1) ... Selecting previously unselected package liblerc4:arm64. Preparing to unpack .../021-liblerc4_4.0.0+ds-4+b1_arm64.deb ... Unpacking liblerc4:arm64 (4.0.0+ds-4+b1) ... Selecting previously unselected package libsharpyuv0:arm64. Preparing to unpack .../022-libsharpyuv0_1.3.2-0.4_arm64.deb ... Unpacking libsharpyuv0:arm64 (1.3.2-0.4) ... Selecting previously unselected package libwebp7:arm64. Preparing to unpack .../023-libwebp7_1.3.2-0.4_arm64.deb ... Unpacking libwebp7:arm64 (1.3.2-0.4) ... Selecting previously unselected package libtiff6:arm64. Preparing to unpack .../024-libtiff6_4.5.1+git230720-4_arm64.deb ... Unpacking libtiff6:arm64 (4.5.1+git230720-4) ... Selecting previously unselected package libgdk-pixbuf-2.0-0:arm64. Preparing to unpack .../025-libgdk-pixbuf-2.0-0_2.42.10+dfsg-3+b1_arm64.deb ... Unpacking libgdk-pixbuf-2.0-0:arm64 (2.42.10+dfsg-3+b1) ... Selecting previously unselected package gtk-update-icon-cache. Preparing to unpack .../026-gtk-update-icon-cache_3.24.41-1_arm64.deb ... Unpacking gtk-update-icon-cache (3.24.41-1) ... Selecting previously unselected package hicolor-icon-theme. Preparing to unpack .../027-hicolor-icon-theme_0.17-2_all.deb ... Unpacking hicolor-icon-theme (0.17-2) ... Selecting previously unselected package adwaita-icon-theme. Preparing to unpack .../028-adwaita-icon-theme_46.0-1_all.deb ... Unpacking adwaita-icon-theme (46.0-1) ... Selecting previously unselected package ca-certificates-java. Preparing to unpack .../029-ca-certificates-java_20240118_all.deb ... Unpacking ca-certificates-java (20240118) ... Selecting previously unselected package java-common. Preparing to unpack .../030-java-common_0.75_all.deb ... Unpacking java-common (0.75) ... Selecting previously unselected package libavahi-common-data:arm64. Preparing to unpack .../031-libavahi-common-data_0.8-13+b1_arm64.deb ... Unpacking libavahi-common-data:arm64 (0.8-13+b1) ... Selecting previously unselected package libavahi-common3:arm64. Preparing to unpack .../032-libavahi-common3_0.8-13+b1_arm64.deb ... Unpacking libavahi-common3:arm64 (0.8-13+b1) ... Selecting previously unselected package libdbus-1-3:arm64. Preparing to unpack .../033-libdbus-1-3_1.14.10-4_arm64.deb ... Unpacking libdbus-1-3:arm64 (1.14.10-4) ... Selecting previously unselected package libavahi-client3:arm64. Preparing to unpack .../034-libavahi-client3_0.8-13+b1_arm64.deb ... Unpacking libavahi-client3:arm64 (0.8-13+b1) ... Selecting previously unselected package libcups2:arm64. Preparing to unpack .../035-libcups2_2.4.7-1+b1_arm64.deb ... Unpacking libcups2:arm64 (2.4.7-1+b1) ... Selecting previously unselected package liblcms2-2:arm64. Preparing to unpack .../036-liblcms2-2_2.14-2+b1_arm64.deb ... Unpacking liblcms2-2:arm64 (2.14-2+b1) ... Selecting previously unselected package libbrotli1:arm64. Preparing to unpack .../037-libbrotli1_1.1.0-2+b3_arm64.deb ... Unpacking libbrotli1:arm64 (1.1.0-2+b3) ... Selecting previously unselected package libfreetype6:arm64. Preparing to unpack .../038-libfreetype6_2.13.2+dfsg-1+b1_arm64.deb ... Unpacking libfreetype6:arm64 (2.13.2+dfsg-1+b1) ... Selecting previously unselected package fonts-dejavu-mono. Preparing to unpack .../039-fonts-dejavu-mono_2.37-8_all.deb ... Unpacking fonts-dejavu-mono (2.37-8) ... Selecting previously unselected package fonts-dejavu-core. Preparing to unpack .../040-fonts-dejavu-core_2.37-8_all.deb ... Unpacking fonts-dejavu-core (2.37-8) ... Selecting previously unselected package fontconfig-config. Preparing to unpack .../041-fontconfig-config_2.15.0-1.1_arm64.deb ... Unpacking fontconfig-config (2.15.0-1.1) ... Selecting previously unselected package libfontconfig1:arm64. Preparing to unpack .../042-libfontconfig1_2.15.0-1.1_arm64.deb ... Unpacking libfontconfig1:arm64 (2.15.0-1.1) ... Selecting previously unselected package libnspr4:arm64. Preparing to unpack .../043-libnspr4_2%3a4.35-1.1+b1_arm64.deb ... Unpacking libnspr4:arm64 (2:4.35-1.1+b1) ... Selecting previously unselected package libnss3:arm64. Preparing to unpack .../044-libnss3_2%3a3.99-1_arm64.deb ... Unpacking libnss3:arm64 (2:3.99-1) ... Selecting previously unselected package libasound2-data. Preparing to unpack .../045-libasound2-data_1.2.10-3_all.deb ... Unpacking libasound2-data (1.2.10-3) ... Selecting previously unselected package libasound2:arm64. Preparing to unpack .../046-libasound2_1.2.10-3_arm64.deb ... Unpacking libasound2:arm64 (1.2.10-3) ... Selecting previously unselected package libgraphite2-3:arm64. Preparing to unpack .../047-libgraphite2-3_1.3.14-2_arm64.deb ... Unpacking libgraphite2-3:arm64 (1.3.14-2) ... Selecting previously unselected package libharfbuzz0b:arm64. Preparing to unpack .../048-libharfbuzz0b_8.3.0-2_arm64.deb ... Unpacking libharfbuzz0b:arm64 (8.3.0-2) ... Selecting previously unselected package libpcsclite1:arm64. Preparing to unpack .../049-libpcsclite1_2.0.1-1+b1_arm64.deb ... Unpacking libpcsclite1:arm64 (2.0.1-1+b1) ... Selecting previously unselected package openjdk-17-jre-headless:arm64. Preparing to unpack .../050-openjdk-17-jre-headless_17.0.10+7-1_arm64.deb ... Unpacking openjdk-17-jre-headless:arm64 (17.0.10+7-1) ... Selecting previously unselected package default-jre-headless. Preparing to unpack .../051-default-jre-headless_2%3a1.17-75_arm64.deb ... Unpacking default-jre-headless (2:1.17-75) ... Selecting previously unselected package ant. Preparing to unpack .../052-ant_1.10.14-1_all.deb ... Unpacking ant (1.10.14-1) ... Selecting previously unselected package ant-optional. Preparing to unpack .../053-ant-optional_1.10.14-1_all.deb ... Unpacking ant-optional (1.10.14-1) ... Selecting previously unselected package libantlr-java. Preparing to unpack .../054-libantlr-java_2.7.7+dfsg-13_all.deb ... Unpacking libantlr-java (2.7.7+dfsg-13) ... Selecting previously unselected package antlr. Preparing to unpack .../055-antlr_2.7.7+dfsg-13_all.deb ... Unpacking antlr (2.7.7+dfsg-13) ... Selecting previously unselected package at-spi2-common. Preparing to unpack .../056-at-spi2-common_2.50.0-1_all.deb ... Unpacking at-spi2-common (2.50.0-1) ... Selecting previously unselected package m4. Preparing to unpack .../057-m4_1.4.19-4_arm64.deb ... Unpacking m4 (1.4.19-4) ... Selecting previously unselected package autoconf. Preparing to unpack .../058-autoconf_2.71-3_all.deb ... Unpacking autoconf (2.71-3) ... Selecting previously unselected package autotools-dev. Preparing to unpack .../059-autotools-dev_20220109.1_all.deb ... Unpacking autotools-dev (20220109.1) ... Selecting previously unselected package automake. Preparing to unpack .../060-automake_1%3a1.16.5-1.3_all.deb ... Unpacking automake (1:1.16.5-1.3) ... Selecting previously unselected package autopoint. Preparing to unpack .../061-autopoint_0.21-14_all.deb ... Unpacking autopoint (0.21-14) ... Selecting previously unselected package unzip. Preparing to unpack .../062-unzip_6.0-28_arm64.deb ... Unpacking unzip (6.0-28) ... Selecting previously unselected package java-wrappers. Preparing to unpack .../063-java-wrappers_0.4_all.deb ... Unpacking java-wrappers (0.4) ... Selecting previously unselected package libhamcrest-java. Preparing to unpack .../064-libhamcrest-java_2.2-2_all.deb ... Unpacking libhamcrest-java (2.2-2) ... Selecting previously unselected package junit4. Preparing to unpack .../065-junit4_4.13.2-4_all.deb ... Unpacking junit4 (4.13.2-4) ... Selecting previously unselected package libfelix-framework-java. Preparing to unpack .../066-libfelix-framework-java_4.6.1-2.1_all.deb ... Unpacking libfelix-framework-java (4.6.1-2.1) ... Selecting previously unselected package libfelix-gogo-runtime-java. Preparing to unpack .../067-libfelix-gogo-runtime-java_0.16.2-1.1_all.deb ... Unpacking libfelix-gogo-runtime-java (0.16.2-1.1) ... Selecting previously unselected package libosgi-annotation-java. Preparing to unpack .../068-libosgi-annotation-java_8.1.0-1_all.deb ... Unpacking libosgi-annotation-java (8.1.0-1) ... Selecting previously unselected package libosgi-core-java. Preparing to unpack .../069-libosgi-core-java_8.0.0-2_all.deb ... Unpacking libosgi-core-java (8.0.0-2) ... Selecting previously unselected package libfelix-resolver-java. Preparing to unpack .../070-libfelix-resolver-java_1.16.0-1_all.deb ... Unpacking libfelix-resolver-java (1.16.0-1) ... Selecting previously unselected package libhawtjni-runtime-java. Preparing to unpack .../071-libhawtjni-runtime-java_1.18-1_all.deb ... Unpacking libhawtjni-runtime-java (1.18-1) ... Selecting previously unselected package libjansi-native-java. Preparing to unpack .../072-libjansi-native-java_1.8-2_all.deb ... Unpacking libjansi-native-java (1.8-2) ... Selecting previously unselected package libjansi1-java. Preparing to unpack .../073-libjansi1-java_1.18-3_all.deb ... Unpacking libjansi1-java (1.18-3) ... Selecting previously unselected package libjline2-java. Preparing to unpack .../074-libjline2-java_2.14.6-5_all.deb ... Unpacking libjline2-java (2.14.6-5) ... Selecting previously unselected package libosgi-compendium-java. Preparing to unpack .../075-libosgi-compendium-java_7.0.0-1_all.deb ... Unpacking libosgi-compendium-java (7.0.0-1) ... Selecting previously unselected package libslf4j-java. Preparing to unpack .../076-libslf4j-java_1.7.32-1_all.deb ... Unpacking libslf4j-java (1.7.32-1) ... Selecting previously unselected package libxz-java. Preparing to unpack .../077-libxz-java_1.9-1_all.deb ... Unpacking libxz-java (1.9-1) ... Selecting previously unselected package libyaml-snake-java. Preparing to unpack .../078-libyaml-snake-java_1.33-2_all.deb ... Unpacking libyaml-snake-java (1.33-2) ... Selecting previously unselected package bnd. Preparing to unpack .../079-bnd_5.0.1-5_all.deb ... Unpacking bnd (5.0.1-5) ... Selecting previously unselected package dctrl-tools. Preparing to unpack .../080-dctrl-tools_2.24-3_arm64.deb ... Unpacking dctrl-tools (2.24-3) ... Selecting previously unselected package libdebhelper-perl. Preparing to unpack .../081-libdebhelper-perl_13.15.3_all.deb ... Unpacking libdebhelper-perl (13.15.3) ... Selecting previously unselected package libtool. Preparing to unpack .../082-libtool_2.4.7-7_all.deb ... Unpacking libtool (2.4.7-7) ... Selecting previously unselected package dh-autoreconf. Preparing to unpack .../083-dh-autoreconf_20_all.deb ... Unpacking dh-autoreconf (20) ... Selecting previously unselected package libarchive-zip-perl. Preparing to unpack .../084-libarchive-zip-perl_1.68-1_all.deb ... Unpacking libarchive-zip-perl (1.68-1) ... Selecting previously unselected package libsub-override-perl. Preparing to unpack .../085-libsub-override-perl_0.10-1_all.deb ... Unpacking libsub-override-perl (0.10-1) ... Selecting previously unselected package libfile-stripnondeterminism-perl. Preparing to unpack .../086-libfile-stripnondeterminism-perl_1.13.1-1_all.deb ... Unpacking libfile-stripnondeterminism-perl (1.13.1-1) ... Selecting previously unselected package dh-strip-nondeterminism. Preparing to unpack .../087-dh-strip-nondeterminism_1.13.1-1_all.deb ... Unpacking dh-strip-nondeterminism (1.13.1-1) ... Selecting previously unselected package libelf1:arm64. Preparing to unpack .../088-libelf1_0.190-1+b1_arm64.deb ... Unpacking libelf1:arm64 (0.190-1+b1) ... Selecting previously unselected package dwz. Preparing to unpack .../089-dwz_0.15-1_arm64.deb ... Unpacking dwz (0.15-1) ... Selecting previously unselected package gettext. Preparing to unpack .../090-gettext_0.21-14+b1_arm64.deb ... Unpacking gettext (0.21-14+b1) ... Selecting previously unselected package intltool-debian. Preparing to unpack .../091-intltool-debian_0.35.0+20060710.6_all.deb ... Unpacking intltool-debian (0.35.0+20060710.6) ... Selecting previously unselected package po-debconf. Preparing to unpack .../092-po-debconf_1.0.21+nmu1_all.deb ... Unpacking po-debconf (1.0.21+nmu1) ... Selecting previously unselected package debhelper. Preparing to unpack .../093-debhelper_13.15.3_all.deb ... Unpacking debhelper (13.15.3) ... Selecting previously unselected package libgtk2.0-common. Preparing to unpack .../094-libgtk2.0-common_2.24.33-3_all.deb ... Unpacking libgtk2.0-common (2.24.33-3) ... Selecting previously unselected package libatk1.0-0:arm64. Preparing to unpack .../095-libatk1.0-0_2.50.0-1+b1_arm64.deb ... Unpacking libatk1.0-0:arm64 (2.50.0-1+b1) ... Selecting previously unselected package libpixman-1-0:arm64. Preparing to unpack .../096-libpixman-1-0_0.42.2-1+b1_arm64.deb ... Unpacking libpixman-1-0:arm64 (0.42.2-1+b1) ... Selecting previously unselected package libxau6:arm64. Preparing to unpack .../097-libxau6_1%3a1.0.9-1_arm64.deb ... Unpacking libxau6:arm64 (1:1.0.9-1) ... Selecting previously unselected package libbsd0:arm64. Preparing to unpack .../098-libbsd0_0.12.2-1_arm64.deb ... Unpacking libbsd0:arm64 (0.12.2-1) ... Selecting previously unselected package libxdmcp6:arm64. Preparing to unpack .../099-libxdmcp6_1%3a1.1.2-3_arm64.deb ... Unpacking libxdmcp6:arm64 (1:1.1.2-3) ... Selecting previously unselected package libxcb1:arm64. Preparing to unpack .../100-libxcb1_1.15-1_arm64.deb ... Unpacking libxcb1:arm64 (1.15-1) ... Selecting previously unselected package libx11-data. Preparing to unpack .../101-libx11-data_2%3a1.8.7-1_all.deb ... Unpacking libx11-data (2:1.8.7-1) ... Selecting previously unselected package libx11-6:arm64. Preparing to unpack .../102-libx11-6_2%3a1.8.7-1_arm64.deb ... Unpacking libx11-6:arm64 (2:1.8.7-1) ... Selecting previously unselected package libxcb-render0:arm64. Preparing to unpack .../103-libxcb-render0_1.15-1_arm64.deb ... Unpacking libxcb-render0:arm64 (1.15-1) ... Selecting previously unselected package libxcb-shm0:arm64. Preparing to unpack .../104-libxcb-shm0_1.15-1_arm64.deb ... Unpacking libxcb-shm0:arm64 (1.15-1) ... Selecting previously unselected package libxext6:arm64. Preparing to unpack .../105-libxext6_2%3a1.3.4-1+b1_arm64.deb ... Unpacking libxext6:arm64 (2:1.3.4-1+b1) ... Selecting previously unselected package libxrender1:arm64. Preparing to unpack .../106-libxrender1_1%3a0.9.10-1.1_arm64.deb ... Unpacking libxrender1:arm64 (1:0.9.10-1.1) ... Selecting previously unselected package libcairo2:arm64. Preparing to unpack .../107-libcairo2_1.18.0-1+b1_arm64.deb ... Unpacking libcairo2:arm64 (1.18.0-1+b1) ... Selecting previously unselected package fontconfig. Preparing to unpack .../108-fontconfig_2.15.0-1.1_arm64.deb ... Unpacking fontconfig (2.15.0-1.1) ... Selecting previously unselected package libfribidi0:arm64. Preparing to unpack .../109-libfribidi0_1.0.13-3+b1_arm64.deb ... Unpacking libfribidi0:arm64 (1.0.13-3+b1) ... Selecting previously unselected package libthai-data. Preparing to unpack .../110-libthai-data_0.1.29-2_all.deb ... Unpacking libthai-data (0.1.29-2) ... Selecting previously unselected package libdatrie1:arm64. Preparing to unpack .../111-libdatrie1_0.2.13-3_arm64.deb ... Unpacking libdatrie1:arm64 (0.2.13-3) ... Selecting previously unselected package libthai0:arm64. Preparing to unpack .../112-libthai0_0.1.29-2_arm64.deb ... Unpacking libthai0:arm64 (0.1.29-2) ... Selecting previously unselected package libpango-1.0-0:arm64. Preparing to unpack .../113-libpango-1.0-0_1.52.0+ds-1_arm64.deb ... Unpacking libpango-1.0-0:arm64 (1.52.0+ds-1) ... Selecting previously unselected package libpangoft2-1.0-0:arm64. Preparing to unpack .../114-libpangoft2-1.0-0_1.52.0+ds-1_arm64.deb ... Unpacking libpangoft2-1.0-0:arm64 (1.52.0+ds-1) ... Selecting previously unselected package libpangocairo-1.0-0:arm64. Preparing to unpack .../115-libpangocairo-1.0-0_1.52.0+ds-1_arm64.deb ... Unpacking libpangocairo-1.0-0:arm64 (1.52.0+ds-1) ... Selecting previously unselected package libxcomposite1:arm64. Preparing to unpack .../116-libxcomposite1_1%3a0.4.5-1_arm64.deb ... Unpacking libxcomposite1:arm64 (1:0.4.5-1) ... Selecting previously unselected package libxfixes3:arm64. Preparing to unpack .../117-libxfixes3_1%3a6.0.0-2_arm64.deb ... Unpacking libxfixes3:arm64 (1:6.0.0-2) ... Selecting previously unselected package libxcursor1:arm64. Preparing to unpack .../118-libxcursor1_1%3a1.2.1-1_arm64.deb ... Unpacking libxcursor1:arm64 (1:1.2.1-1) ... Selecting previously unselected package libxdamage1:arm64. Preparing to unpack .../119-libxdamage1_1%3a1.1.6-1_arm64.deb ... Unpacking libxdamage1:arm64 (1:1.1.6-1) ... Selecting previously unselected package libxi6:arm64. Preparing to unpack .../120-libxi6_2%3a1.8.1-1_arm64.deb ... Unpacking libxi6:arm64 (2:1.8.1-1) ... Selecting previously unselected package libxinerama1:arm64. Preparing to unpack .../121-libxinerama1_2%3a1.1.4-3_arm64.deb ... Unpacking libxinerama1:arm64 (2:1.1.4-3) ... Selecting previously unselected package libxrandr2:arm64. Preparing to unpack .../122-libxrandr2_2%3a1.5.4-1_arm64.deb ... Unpacking libxrandr2:arm64 (2:1.5.4-1) ... Selecting previously unselected package libgtk2.0-0:arm64. Preparing to unpack .../123-libgtk2.0-0_2.24.33-3_arm64.deb ... Unpacking libgtk2.0-0:arm64 (2.24.33-3) ... Selecting previously unselected package libglvnd0:arm64. Preparing to unpack .../124-libglvnd0_1.7.0-1_arm64.deb ... Unpacking libglvnd0:arm64 (1.7.0-1) ... Selecting previously unselected package libdrm-common. Preparing to unpack .../125-libdrm-common_2.4.120-2_all.deb ... Unpacking libdrm-common (2.4.120-2) ... Selecting previously unselected package libdrm2:arm64. Preparing to unpack .../126-libdrm2_2.4.120-2_arm64.deb ... Unpacking libdrm2:arm64 (2.4.120-2) ... Selecting previously unselected package libglapi-mesa:arm64. Preparing to unpack .../127-libglapi-mesa_23.3.5-1_arm64.deb ... Unpacking libglapi-mesa:arm64 (23.3.5-1) ... Selecting previously unselected package libx11-xcb1:arm64. Preparing to unpack .../128-libx11-xcb1_2%3a1.8.7-1_arm64.deb ... Unpacking libx11-xcb1:arm64 (2:1.8.7-1) ... Selecting previously unselected package libxcb-dri2-0:arm64. Preparing to unpack .../129-libxcb-dri2-0_1.15-1_arm64.deb ... Unpacking libxcb-dri2-0:arm64 (1.15-1) ... Selecting previously unselected package libxcb-dri3-0:arm64. Preparing to unpack .../130-libxcb-dri3-0_1.15-1_arm64.deb ... Unpacking libxcb-dri3-0:arm64 (1.15-1) ... Selecting previously unselected package libxcb-glx0:arm64. Preparing to unpack .../131-libxcb-glx0_1.15-1_arm64.deb ... Unpacking libxcb-glx0:arm64 (1.15-1) ... Selecting previously unselected package libxcb-present0:arm64. Preparing to unpack .../132-libxcb-present0_1.15-1_arm64.deb ... Unpacking libxcb-present0:arm64 (1.15-1) ... Selecting previously unselected package libxcb-randr0:arm64. Preparing to unpack .../133-libxcb-randr0_1.15-1_arm64.deb ... Unpacking libxcb-randr0:arm64 (1.15-1) ... Selecting previously unselected package libxcb-sync1:arm64. Preparing to unpack .../134-libxcb-sync1_1.15-1_arm64.deb ... Unpacking libxcb-sync1:arm64 (1.15-1) ... Selecting previously unselected package libxcb-xfixes0:arm64. Preparing to unpack .../135-libxcb-xfixes0_1.15-1_arm64.deb ... Unpacking libxcb-xfixes0:arm64 (1.15-1) ... Selecting previously unselected package libxshmfence1:arm64. Preparing to unpack .../136-libxshmfence1_1.3-1_arm64.deb ... Unpacking libxshmfence1:arm64 (1.3-1) ... Selecting previously unselected package libxxf86vm1:arm64. Preparing to unpack .../137-libxxf86vm1_1%3a1.1.4-1+b2_arm64.deb ... Unpacking libxxf86vm1:arm64 (1:1.1.4-1+b2) ... Selecting previously unselected package libvulkan1:arm64. Preparing to unpack .../138-libvulkan1_1.3.275.0-1_arm64.deb ... Unpacking libvulkan1:arm64 (1.3.275.0-1) ... Selecting previously unselected package libdrm-amdgpu1:arm64. Preparing to unpack .../139-libdrm-amdgpu1_2.4.120-2_arm64.deb ... Unpacking libdrm-amdgpu1:arm64 (2.4.120-2) ... Selecting previously unselected package libdrm-nouveau2:arm64. Preparing to unpack .../140-libdrm-nouveau2_2.4.120-2_arm64.deb ... Unpacking libdrm-nouveau2:arm64 (2.4.120-2) ... Selecting previously unselected package libdrm-radeon1:arm64. Preparing to unpack .../141-libdrm-radeon1_2.4.120-2_arm64.deb ... Unpacking libdrm-radeon1:arm64 (2.4.120-2) ... Selecting previously unselected package libedit2:arm64. Preparing to unpack .../142-libedit2_3.1-20230828-1_arm64.deb ... Unpacking libedit2:arm64 (3.1-20230828-1) ... Selecting previously unselected package libz3-4:arm64. Preparing to unpack .../143-libz3-4_4.8.12-3.1+b2_arm64.deb ... Unpacking libz3-4:arm64 (4.8.12-3.1+b2) ... Selecting previously unselected package libllvm17:arm64. Preparing to unpack .../144-libllvm17_1%3a17.0.6-5_arm64.deb ... Unpacking libllvm17:arm64 (1:17.0.6-5) ... Selecting previously unselected package libsensors-config. Preparing to unpack .../145-libsensors-config_1%3a3.6.0-9_all.deb ... Unpacking libsensors-config (1:3.6.0-9) ... Selecting previously unselected package libsensors5:arm64. Preparing to unpack .../146-libsensors5_1%3a3.6.0-9_arm64.deb ... Unpacking libsensors5:arm64 (1:3.6.0-9) ... Selecting previously unselected package libgl1-mesa-dri:arm64. Preparing to unpack .../147-libgl1-mesa-dri_23.3.5-1_arm64.deb ... Unpacking libgl1-mesa-dri:arm64 (23.3.5-1) ... Selecting previously unselected package libglx-mesa0:arm64. Preparing to unpack .../148-libglx-mesa0_23.3.5-1_arm64.deb ... Unpacking libglx-mesa0:arm64 (23.3.5-1) ... Selecting previously unselected package libglx0:arm64. Preparing to unpack .../149-libglx0_1.7.0-1_arm64.deb ... Unpacking libglx0:arm64 (1.7.0-1) ... Selecting previously unselected package libgl1:arm64. Preparing to unpack .../150-libgl1_1.7.0-1_arm64.deb ... Unpacking libgl1:arm64 (1.7.0-1) ... Selecting previously unselected package libgif7:arm64. Preparing to unpack .../151-libgif7_5.2.2-1_arm64.deb ... Unpacking libgif7:arm64 (5.2.2-1) ... Selecting previously unselected package x11-common. Preparing to unpack .../152-x11-common_1%3a7.7+23_all.deb ... Unpacking x11-common (1:7.7+23) ... Selecting previously unselected package libxtst6:arm64. Preparing to unpack .../153-libxtst6_2%3a1.2.3-1.1_arm64.deb ... Unpacking libxtst6:arm64 (2:1.2.3-1.1) ... Selecting previously unselected package openjdk-17-jre:arm64. Preparing to unpack .../154-openjdk-17-jre_17.0.10+7-1_arm64.deb ... Unpacking openjdk-17-jre:arm64 (17.0.10+7-1) ... Selecting previously unselected package default-jre. Preparing to unpack .../155-default-jre_2%3a1.17-75_arm64.deb ... Unpacking default-jre (2:1.17-75) ... Selecting previously unselected package openjdk-17-jdk-headless:arm64. Preparing to unpack .../156-openjdk-17-jdk-headless_17.0.10+7-1_arm64.deb ... Unpacking openjdk-17-jdk-headless:arm64 (17.0.10+7-1) ... Selecting previously unselected package default-jdk-headless. Preparing to unpack .../157-default-jdk-headless_2%3a1.17-75_arm64.deb ... Unpacking default-jdk-headless (2:1.17-75) ... Selecting previously unselected package openjdk-17-jdk:arm64. Preparing to unpack .../158-openjdk-17-jdk_17.0.10+7-1_arm64.deb ... Unpacking openjdk-17-jdk:arm64 (17.0.10+7-1) ... Selecting previously unselected package default-jdk. Preparing to unpack .../159-default-jdk_2%3a1.17-75_arm64.deb ... Unpacking default-jdk (2:1.17-75) ... Selecting previously unselected package libassuan0:arm64. Preparing to unpack .../160-libassuan0_2.5.6-1_arm64.deb ... Unpacking libassuan0:arm64 (2.5.6-1) ... Selecting previously unselected package gpgconf. Preparing to unpack .../161-gpgconf_2.2.40-1.1+b1_arm64.deb ... Unpacking gpgconf (2.2.40-1.1+b1) ... Selecting previously unselected package libksba8:arm64. Preparing to unpack .../162-libksba8_1.6.6-1_arm64.deb ... Unpacking libksba8:arm64 (1.6.6-1) ... Selecting previously unselected package libsasl2-modules-db:arm64. Preparing to unpack .../163-libsasl2-modules-db_2.1.28+dfsg1-4+b1_arm64.deb ... Unpacking libsasl2-modules-db:arm64 (2.1.28+dfsg1-4+b1) ... Selecting previously unselected package libsasl2-2:arm64. Preparing to unpack .../164-libsasl2-2_2.1.28+dfsg1-4+b1_arm64.deb ... Unpacking libsasl2-2:arm64 (2.1.28+dfsg1-4+b1) ... Selecting previously unselected package libldap-2.5-0:arm64. Preparing to unpack .../165-libldap-2.5-0_2.5.13+dfsg-5+b3_arm64.deb ... Unpacking libldap-2.5-0:arm64 (2.5.13+dfsg-5+b3) ... Selecting previously unselected package libnpth0:arm64. Preparing to unpack .../166-libnpth0_1.6-3+b1_arm64.deb ... Unpacking libnpth0:arm64 (1.6-3+b1) ... Selecting previously unselected package dirmngr. Preparing to unpack .../167-dirmngr_2.2.40-1.1+b1_arm64.deb ... Unpacking dirmngr (2.2.40-1.1+b1) ... Selecting previously unselected package gnupg-l10n. Preparing to unpack .../168-gnupg-l10n_2.2.40-1.1_all.deb ... Unpacking gnupg-l10n (2.2.40-1.1) ... Selecting previously unselected package gnupg-utils. Preparing to unpack .../169-gnupg-utils_2.2.40-1.1+b1_arm64.deb ... Unpacking gnupg-utils (2.2.40-1.1+b1) ... Selecting previously unselected package gpg. Preparing to unpack .../170-gpg_2.2.40-1.1+b1_arm64.deb ... Unpacking gpg (2.2.40-1.1+b1) ... Selecting previously unselected package pinentry-curses. Preparing to unpack .../171-pinentry-curses_1.2.1-3_arm64.deb ... Unpacking pinentry-curses (1.2.1-3) ... Selecting previously unselected package gpg-agent. Preparing to unpack .../172-gpg-agent_2.2.40-1.1+b1_arm64.deb ... Unpacking gpg-agent (2.2.40-1.1+b1) ... Selecting previously unselected package gpg-wks-client. Preparing to unpack .../173-gpg-wks-client_2.2.40-1.1+b1_arm64.deb ... Unpacking gpg-wks-client (2.2.40-1.1+b1) ... Selecting previously unselected package gpg-wks-server. Preparing to unpack .../174-gpg-wks-server_2.2.40-1.1+b1_arm64.deb ... Unpacking gpg-wks-server (2.2.40-1.1+b1) ... Selecting previously unselected package gpgsm. Preparing to unpack .../175-gpgsm_2.2.40-1.1+b1_arm64.deb ... Unpacking gpgsm (2.2.40-1.1+b1) ... Selecting previously unselected package gnupg. Preparing to unpack .../176-gnupg_2.2.40-1.1_all.deb ... Unpacking gnupg (2.2.40-1.1) ... Selecting previously unselected package libfile-dirlist-perl. Preparing to unpack .../177-libfile-dirlist-perl_0.05-3_all.deb ... Unpacking libfile-dirlist-perl (0.05-3) ... Selecting previously unselected package libfile-which-perl. Preparing to unpack .../178-libfile-which-perl_1.27-2_all.deb ... Unpacking libfile-which-perl (1.27-2) ... Selecting previously unselected package libfile-homedir-perl. Preparing to unpack .../179-libfile-homedir-perl_1.006-2_all.deb ... Unpacking libfile-homedir-perl (1.006-2) ... Selecting previously unselected package libfile-touch-perl. Preparing to unpack .../180-libfile-touch-perl_0.12-2_all.deb ... Unpacking libfile-touch-perl (0.12-2) ... Selecting previously unselected package libio-pty-perl. Preparing to unpack .../181-libio-pty-perl_1%3a1.20-1_arm64.deb ... Unpacking libio-pty-perl (1:1.20-1) ... Selecting previously unselected package libipc-run-perl. Preparing to unpack .../182-libipc-run-perl_20231003.0-2_all.deb ... Unpacking libipc-run-perl (20231003.0-2) ... Selecting previously unselected package libclass-method-modifiers-perl. Preparing to unpack .../183-libclass-method-modifiers-perl_2.15-1_all.deb ... Unpacking libclass-method-modifiers-perl (2.15-1) ... Selecting previously unselected package libclass-xsaccessor-perl. Preparing to unpack .../184-libclass-xsaccessor-perl_1.19-4+b2_arm64.deb ... Unpacking libclass-xsaccessor-perl (1.19-4+b2) ... Selecting previously unselected package libb-hooks-op-check-perl:arm64. Preparing to unpack .../185-libb-hooks-op-check-perl_0.22-2+b2_arm64.deb ... Unpacking libb-hooks-op-check-perl:arm64 (0.22-2+b2) ... Selecting previously unselected package libdynaloader-functions-perl. Preparing to unpack .../186-libdynaloader-functions-perl_0.003-3_all.deb ... Unpacking libdynaloader-functions-perl (0.003-3) ... Selecting previously unselected package libdevel-callchecker-perl:arm64. Preparing to unpack .../187-libdevel-callchecker-perl_0.008-2+b1_arm64.deb ... Unpacking libdevel-callchecker-perl:arm64 (0.008-2+b1) ... Selecting previously unselected package libparams-classify-perl:arm64. Preparing to unpack .../188-libparams-classify-perl_0.015-2+b2_arm64.deb ... Unpacking libparams-classify-perl:arm64 (0.015-2+b2) ... Selecting previously unselected package libmodule-runtime-perl. Preparing to unpack .../189-libmodule-runtime-perl_0.016-2_all.deb ... Unpacking libmodule-runtime-perl (0.016-2) ... Selecting previously unselected package libimport-into-perl. Preparing to unpack .../190-libimport-into-perl_1.002005-2_all.deb ... Unpacking libimport-into-perl (1.002005-2) ... Selecting previously unselected package librole-tiny-perl. Preparing to unpack .../191-librole-tiny-perl_2.002004-1_all.deb ... Unpacking librole-tiny-perl (2.002004-1) ... Selecting previously unselected package libsub-quote-perl. Preparing to unpack .../192-libsub-quote-perl_2.006008-1_all.deb ... Unpacking libsub-quote-perl (2.006008-1) ... Selecting previously unselected package libmoo-perl. Preparing to unpack .../193-libmoo-perl_2.005005-1_all.deb ... Unpacking libmoo-perl (2.005005-1) ... Selecting previously unselected package libencode-locale-perl. Preparing to unpack .../194-libencode-locale-perl_1.05-3_all.deb ... Unpacking libencode-locale-perl (1.05-3) ... Selecting previously unselected package libtimedate-perl. Preparing to unpack .../195-libtimedate-perl_2.3300-2_all.deb ... Unpacking libtimedate-perl (2.3300-2) ... Selecting previously unselected package libhttp-date-perl. Preparing to unpack .../196-libhttp-date-perl_6.06-1_all.deb ... Unpacking libhttp-date-perl (6.06-1) ... Selecting previously unselected package libfile-listing-perl. Preparing to unpack .../197-libfile-listing-perl_6.16-1_all.deb ... Unpacking libfile-listing-perl (6.16-1) ... Selecting previously unselected package libhtml-tagset-perl. Preparing to unpack .../198-libhtml-tagset-perl_3.24-1_all.deb ... Unpacking libhtml-tagset-perl (3.24-1) ... Selecting previously unselected package liburi-perl. Preparing to unpack .../199-liburi-perl_5.28-1_all.deb ... Unpacking liburi-perl (5.28-1) ... Selecting previously unselected package libhtml-parser-perl:arm64. Preparing to unpack .../200-libhtml-parser-perl_3.81-1+b1_arm64.deb ... Unpacking libhtml-parser-perl:arm64 (3.81-1+b1) ... Selecting previously unselected package libhtml-tree-perl. Preparing to unpack .../201-libhtml-tree-perl_5.07-3_all.deb ... Unpacking libhtml-tree-perl (5.07-3) ... Selecting previously unselected package libclone-perl:arm64. Preparing to unpack .../202-libclone-perl_0.46-1+b1_arm64.deb ... Unpacking libclone-perl:arm64 (0.46-1+b1) ... Selecting previously unselected package libio-html-perl. Preparing to unpack .../203-libio-html-perl_1.004-3_all.deb ... Unpacking libio-html-perl (1.004-3) ... Selecting previously unselected package liblwp-mediatypes-perl. Preparing to unpack .../204-liblwp-mediatypes-perl_6.04-2_all.deb ... Unpacking liblwp-mediatypes-perl (6.04-2) ... Selecting previously unselected package libhttp-message-perl. Preparing to unpack .../205-libhttp-message-perl_6.45-1_all.deb ... Unpacking libhttp-message-perl (6.45-1) ... Selecting previously unselected package libhttp-cookies-perl. Preparing to unpack .../206-libhttp-cookies-perl_6.11-1_all.deb ... Unpacking libhttp-cookies-perl (6.11-1) ... Selecting previously unselected package libhttp-negotiate-perl. Preparing to unpack .../207-libhttp-negotiate-perl_6.01-2_all.deb ... Unpacking libhttp-negotiate-perl (6.01-2) ... Selecting previously unselected package perl-openssl-defaults:arm64. Preparing to unpack .../208-perl-openssl-defaults_7+b1_arm64.deb ... Unpacking perl-openssl-defaults:arm64 (7+b1) ... Selecting previously unselected package libnet-ssleay-perl:arm64. Preparing to unpack .../209-libnet-ssleay-perl_1.94-1_arm64.deb ... Unpacking libnet-ssleay-perl:arm64 (1.94-1) ... Selecting previously unselected package libio-socket-ssl-perl. Preparing to unpack .../210-libio-socket-ssl-perl_2.085-1_all.deb ... Unpacking libio-socket-ssl-perl (2.085-1) ... Selecting previously unselected package libnet-http-perl. Preparing to unpack .../211-libnet-http-perl_6.23-1_all.deb ... Unpacking libnet-http-perl (6.23-1) ... Selecting previously unselected package liblwp-protocol-https-perl. Preparing to unpack .../212-liblwp-protocol-https-perl_6.14-1_all.deb ... Unpacking liblwp-protocol-https-perl (6.14-1) ... Selecting previously unselected package libtry-tiny-perl. Preparing to unpack .../213-libtry-tiny-perl_0.31-2_all.deb ... Unpacking libtry-tiny-perl (0.31-2) ... Selecting previously unselected package libwww-robotrules-perl. Preparing to unpack .../214-libwww-robotrules-perl_6.02-1_all.deb ... Unpacking libwww-robotrules-perl (6.02-1) ... Selecting previously unselected package libwww-perl. Preparing to unpack .../215-libwww-perl_6.77-1_all.deb ... Unpacking libwww-perl (6.77-1) ... Selecting previously unselected package patchutils. Preparing to unpack .../216-patchutils_0.4.2-1_arm64.deb ... Unpacking patchutils (0.4.2-1) ... Selecting previously unselected package wdiff. Preparing to unpack .../217-wdiff_1.2.2-6_arm64.deb ... Unpacking wdiff (1.2.2-6) ... Selecting previously unselected package devscripts. Preparing to unpack .../218-devscripts_2.23.7_all.deb ... Unpacking devscripts (2.23.7) ... Selecting previously unselected package fastjar. Preparing to unpack .../219-fastjar_2%3a0.98-7_arm64.deb ... Unpacking fastjar (2:0.98-7) ... Selecting previously unselected package ivy. Preparing to unpack .../220-ivy_2.5.2-1_all.deb ... Unpacking ivy (2.5.2-1) ... Selecting previously unselected package libasm-java. Preparing to unpack .../221-libasm-java_9.7-1_all.deb ... Unpacking libasm-java (9.7-1) ... Selecting previously unselected package libbsf-java. Preparing to unpack .../222-libbsf-java_1%3a2.4.0-8_all.deb ... Unpacking libbsf-java (1:2.4.0-8) ... Selecting previously unselected package libcommons-cli-java. Preparing to unpack .../223-libcommons-cli-java_1.6.0-1_all.deb ... Unpacking libcommons-cli-java (1.6.0-1) ... Selecting previously unselected package libapache-pom-java. Preparing to unpack .../224-libapache-pom-java_29-2_all.deb ... Unpacking libapache-pom-java (29-2) ... Selecting previously unselected package libcommons-parent-java. Preparing to unpack .../225-libcommons-parent-java_56-1_all.deb ... Unpacking libcommons-parent-java (56-1) ... Selecting previously unselected package libcommons-logging-java. Preparing to unpack .../226-libcommons-logging-java_1.3.0-1_all.deb ... Unpacking libcommons-logging-java (1.3.0-1) ... Selecting previously unselected package libjansi-java. Preparing to unpack .../227-libjansi-java_2.4.1-2_all.deb ... Unpacking libjansi-java (2.4.1-2) ... Selecting previously unselected package libjsp-api-java. Preparing to unpack .../228-libjsp-api-java_2.3.4-3_all.deb ... Unpacking libjsp-api-java (2.3.4-3) ... Selecting previously unselected package libqdox-java. Preparing to unpack .../229-libqdox-java_1.12.1-3_all.deb ... Unpacking libqdox-java (1.12.1-3) ... Selecting previously unselected package libservlet-api-java. Preparing to unpack .../230-libservlet-api-java_4.0.1-2_all.deb ... Unpacking libservlet-api-java (4.0.1-2) ... Selecting previously unselected package libxpp3-java. Preparing to unpack .../231-libxpp3-java_1.1.4c-3_all.deb ... Unpacking libxpp3-java (1.1.4c-3) ... Selecting previously unselected package libxstream-java. Preparing to unpack .../232-libxstream-java_1.4.20-1_all.deb ... Unpacking libxstream-java (1.4.20-1) ... Selecting previously unselected package groovy. Preparing to unpack .../233-groovy_2.4.21-10_all.deb ... Unpacking groovy (2.4.21-10) ... Selecting previously unselected package libatinject-jsr330-api-java. Preparing to unpack .../234-libatinject-jsr330-api-java_1.0+ds1-5_all.deb ... Unpacking libatinject-jsr330-api-java (1.0+ds1-5) ... Selecting previously unselected package libcommons-collections3-java. Preparing to unpack .../235-libcommons-collections3-java_3.2.2-3_all.deb ... Unpacking libcommons-collections3-java (3.2.2-3) ... Selecting previously unselected package libcommons-compress-java. Preparing to unpack .../236-libcommons-compress-java_1.25.0-1_all.deb ... Unpacking libcommons-compress-java (1.25.0-1) ... Selecting previously unselected package libcommons-io-java. Preparing to unpack .../237-libcommons-io-java_2.16.0-1_all.deb ... Unpacking libcommons-io-java (2.16.0-1) ... Selecting previously unselected package libcommons-lang-java. Preparing to unpack .../238-libcommons-lang-java_2.6-10_all.deb ... Unpacking libcommons-lang-java (2.6-10) ... Selecting previously unselected package liberror-prone-java. Preparing to unpack .../239-liberror-prone-java_2.18.0-1_all.deb ... Unpacking liberror-prone-java (2.18.0-1) ... Selecting previously unselected package libjsr305-java. Preparing to unpack .../240-libjsr305-java_0.1~+svn49-11_all.deb ... Unpacking libjsr305-java (0.1~+svn49-11) ... Selecting previously unselected package libguava-java. Preparing to unpack .../241-libguava-java_32.0.1-1_all.deb ... Unpacking libguava-java (32.0.1-1) ... Selecting previously unselected package libcommons-codec-java. Preparing to unpack .../242-libcommons-codec-java_1.16.0-1_all.deb ... Unpacking libcommons-codec-java (1.16.0-1) ... Selecting previously unselected package libhttpcore-java. Preparing to unpack .../243-libhttpcore-java_4.4.16-1_all.deb ... Unpacking libhttpcore-java (4.4.16-1) ... Selecting previously unselected package libhttpclient-java. Preparing to unpack .../244-libhttpclient-java_4.5.14-1_all.deb ... Unpacking libhttpclient-java (4.5.14-1) ... Selecting previously unselected package libjarjar-java. Preparing to unpack .../245-libjarjar-java_1.4+svn142-12_all.deb ... Unpacking libjarjar-java (1.4+svn142-12) ... Selecting previously unselected package libjcip-annotations-java. Preparing to unpack .../246-libjcip-annotations-java_20060626-6_all.deb ... Unpacking libjcip-annotations-java (20060626-6) ... Selecting previously unselected package libjna-jni. Preparing to unpack .../247-libjna-jni_5.14.0-1_arm64.deb ... Unpacking libjna-jni (5.14.0-1) ... Selecting previously unselected package libjna-java. Preparing to unpack .../248-libjna-java_5.14.0-1_all.deb ... Unpacking libjna-java (5.14.0-1) ... Selecting previously unselected package libjzlib-java. Preparing to unpack .../249-libjzlib-java_1.1.3-3_all.deb ... Unpacking libjzlib-java (1.1.3-3) ... Selecting previously unselected package libjsch-java. Preparing to unpack .../250-libjsch-java_0.1.55-1_all.deb ... Unpacking libjsch-java (0.1.55-1) ... Selecting previously unselected package libminlog-java. Preparing to unpack .../251-libminlog-java_1.3.0-1.1_all.deb ... Unpacking libminlog-java (1.3.0-1.1) ... Selecting previously unselected package libobjenesis-java. Preparing to unpack .../252-libobjenesis-java_3.3-3_all.deb ... Unpacking libobjenesis-java (3.3-3) ... Selecting previously unselected package libreflectasm-java. Preparing to unpack .../253-libreflectasm-java_1.11.9+dfsg-4_all.deb ... Unpacking libreflectasm-java (1.11.9+dfsg-4) ... Selecting previously unselected package libkryo-java. Preparing to unpack .../254-libkryo-java_2.20-7_all.deb ... Unpacking libkryo-java (2.20-7) ... Selecting previously unselected package liblogback-java. Preparing to unpack .../255-liblogback-java_1%3a1.2.11-5_all.deb ... Unpacking liblogback-java (1:1.2.11-5) ... Selecting previously unselected package libnative-platform-jni. Preparing to unpack .../256-libnative-platform-jni_0.14-6_arm64.deb ... Unpacking libnative-platform-jni (0.14-6) ... Selecting previously unselected package libnative-platform-java. Preparing to unpack .../257-libnative-platform-java_0.14-6_all.deb ... Unpacking libnative-platform-java (0.14-6) ... Selecting previously unselected package libxml-commons-external-java. Preparing to unpack .../258-libxml-commons-external-java_1.4.01-6_all.deb ... Unpacking libxml-commons-external-java (1.4.01-6) ... Selecting previously unselected package libxml-commons-resolver1.1-java. Preparing to unpack .../259-libxml-commons-resolver1.1-java_1.2-11_all.deb ... Unpacking libxml-commons-resolver1.1-java (1.2-11) ... Selecting previously unselected package libxerces2-java. Preparing to unpack .../260-libxerces2-java_2.12.2-1_all.deb ... Unpacking libxerces2-java (2.12.2-1) ... Selecting previously unselected package libnekohtml-java. Preparing to unpack .../261-libnekohtml-java_1.9.22.noko2-0.1_all.deb ... Unpacking libnekohtml-java (1.9.22.noko2-0.1) ... Selecting previously unselected package libxbean-reflect-java. Preparing to unpack .../262-libxbean-reflect-java_4.5-8_all.deb ... Unpacking libxbean-reflect-java (4.5-8) ... Selecting previously unselected package libgradle-core-java. Preparing to unpack .../263-libgradle-core-java_4.4.1-20_all.deb ... Unpacking libgradle-core-java (4.4.1-20) ... Selecting previously unselected package libbcprov-java. Preparing to unpack .../264-libbcprov-java_1.77-1_all.deb ... Unpacking libbcprov-java (1.77-1) ... Selecting previously unselected package libbcpg-java. Preparing to unpack .../265-libbcpg-java_1.77-1_all.deb ... Unpacking libbcpg-java (1.77-1) ... Selecting previously unselected package libbsh-java. Preparing to unpack .../266-libbsh-java_2.0b4-20_all.deb ... Unpacking libbsh-java (2.0b4-20) ... Selecting previously unselected package libdd-plist-java. Preparing to unpack .../267-libdd-plist-java_1.20-1.1_all.deb ... Unpacking libdd-plist-java (1.20-1.1) ... Selecting previously unselected package libjaxen-java. Preparing to unpack .../268-libjaxen-java_1.1.6-4_all.deb ... Unpacking libjaxen-java (1.1.6-4) ... Selecting previously unselected package libdom4j-java. Preparing to unpack .../269-libdom4j-java_2.1.4-1_all.deb ... Unpacking libdom4j-java (2.1.4-1) ... Selecting previously unselected package libbcel-java. Preparing to unpack .../270-libbcel-java_6.5.0-2_all.deb ... Unpacking libbcel-java (6.5.0-2) ... Selecting previously unselected package libjformatstring-java. Preparing to unpack .../271-libjformatstring-java_0.10~20131207-2.1_all.deb ... Unpacking libjformatstring-java (0.10~20131207-2.1) ... Selecting previously unselected package libfindbugs-java. Preparing to unpack .../272-libfindbugs-java_3.1.0~preview2-3_all.deb ... Unpacking libfindbugs-java (3.1.0~preview2-3) ... Selecting previously unselected package libgoogle-gson-java. Preparing to unpack .../273-libgoogle-gson-java_2.10.1-1_all.deb ... Unpacking libgoogle-gson-java (2.10.1-1) ... Selecting previously unselected package libaopalliance-java. Preparing to unpack .../274-libaopalliance-java_20070526-7_all.deb ... Unpacking libaopalliance-java (20070526-7) ... Selecting previously unselected package libguice-java. Preparing to unpack .../275-libguice-java_4.2.3-2_all.deb ... Unpacking libguice-java (4.2.3-2) ... Selecting previously unselected package libjatl-java. Preparing to unpack .../276-libjatl-java_0.2.3-1.1_all.deb ... Unpacking libjatl-java (0.2.3-1.1) ... Selecting previously unselected package libjcifs-java. Preparing to unpack .../277-libjcifs-java_1.3.19-2_all.deb ... Unpacking libjcifs-java (1.3.19-2) ... Selecting previously unselected package libeclipse-jdt-annotation-java. Preparing to unpack .../278-libeclipse-jdt-annotation-java_2.2.700+eclipse4.26-2_all.deb ... Unpacking libeclipse-jdt-annotation-java (2.2.700+eclipse4.26-2) ... Selecting previously unselected package libjavaewah-java. Preparing to unpack .../279-libjavaewah-java_1.2.3-1_all.deb ... Unpacking libjavaewah-java (1.2.3-1) ... Selecting previously unselected package libel-api-java. Preparing to unpack .../280-libel-api-java_3.0.0-3_all.deb ... Unpacking libel-api-java (3.0.0-3) ... Selecting previously unselected package libwebsocket-api-java. Preparing to unpack .../281-libwebsocket-api-java_1.1-2_all.deb ... Unpacking libwebsocket-api-java (1.1-2) ... Selecting previously unselected package libjetty9-java. Preparing to unpack .../282-libjetty9-java_9.4.54-1_all.deb ... Unpacking libjetty9-java (9.4.54-1) ... Selecting previously unselected package libjgit-java. Preparing to unpack .../283-libjgit-java_4.11.9-2_all.deb ... Unpacking libjgit-java (4.11.9-2) ... Selecting previously unselected package libjs-jquery. Preparing to unpack .../284-libjs-jquery_3.6.1+dfsg+~3.5.14-1_all.deb ... Unpacking libjs-jquery (3.6.1+dfsg+~3.5.14-1) ... Selecting previously unselected package libcommons-lang3-java. Preparing to unpack .../285-libcommons-lang3-java_3.14.0-1_all.deb ... Unpacking libcommons-lang3-java (3.14.0-1) ... Selecting previously unselected package libplexus-utils2-java. Preparing to unpack .../286-libplexus-utils2-java_3.4.2-1_all.deb ... Unpacking libplexus-utils2-java (3.4.2-1) ... Selecting previously unselected package libwagon-provider-api-java. Preparing to unpack .../287-libwagon-provider-api-java_3.5.3-1_all.deb ... Unpacking libwagon-provider-api-java (3.5.3-1) ... Selecting previously unselected package libmaven-resolver-java. Preparing to unpack .../288-libmaven-resolver-java_1.6.3-1_all.deb ... Unpacking libmaven-resolver-java (1.6.3-1) ... Selecting previously unselected package libgeronimo-annotation-1.3-spec-java. Preparing to unpack .../289-libgeronimo-annotation-1.3-spec-java_1.3-1_all.deb ... Unpacking libgeronimo-annotation-1.3-spec-java (1.3-1) ... Selecting previously unselected package libmaven-parent-java. Preparing to unpack .../290-libmaven-parent-java_35-1_all.deb ... Unpacking libmaven-parent-java (35-1) ... Selecting previously unselected package libmaven-shared-utils-java. Preparing to unpack .../291-libmaven-shared-utils-java_3.3.4-1_all.deb ... Unpacking libmaven-shared-utils-java (3.3.4-1) ... Selecting previously unselected package libplexus-cipher-java. Preparing to unpack .../292-libplexus-cipher-java_2.0-1_all.deb ... Unpacking libplexus-cipher-java (2.0-1) ... Selecting previously unselected package libplexus-classworlds-java. Preparing to unpack .../293-libplexus-classworlds-java_2.7.0-1_all.deb ... Unpacking libplexus-classworlds-java (2.7.0-1) ... Selecting previously unselected package libplexus-component-annotations-java. Preparing to unpack .../294-libplexus-component-annotations-java_2.1.1-1_all.deb ... Unpacking libplexus-component-annotations-java (2.1.1-1) ... Selecting previously unselected package libplexus-interpolation-java. Preparing to unpack .../295-libplexus-interpolation-java_1.26-1_all.deb ... Unpacking libplexus-interpolation-java (1.26-1) ... Selecting previously unselected package libplexus-sec-dispatcher-java. Preparing to unpack .../296-libplexus-sec-dispatcher-java_2.0-3_all.deb ... Unpacking libplexus-sec-dispatcher-java (2.0-3) ... Selecting previously unselected package libgeronimo-interceptor-3.0-spec-java. Preparing to unpack .../297-libgeronimo-interceptor-3.0-spec-java_1.0.1-4_all.deb ... Unpacking libgeronimo-interceptor-3.0-spec-java (1.0.1-4) ... Selecting previously unselected package libcdi-api-java. Preparing to unpack .../298-libcdi-api-java_1.2-3_all.deb ... Unpacking libcdi-api-java (1.2-3) ... Selecting previously unselected package libsisu-inject-java. Preparing to unpack .../299-libsisu-inject-java_0.3.4-2_all.deb ... Unpacking libsisu-inject-java (0.3.4-2) ... Selecting previously unselected package libsisu-plexus-java. Preparing to unpack .../300-libsisu-plexus-java_0.3.4-3_all.deb ... Unpacking libsisu-plexus-java (0.3.4-3) ... Selecting previously unselected package libmaven3-core-java. Preparing to unpack .../301-libmaven3-core-java_3.8.7-2_all.deb ... Unpacking libmaven3-core-java (3.8.7-2) ... Selecting previously unselected package libplexus-container-default-java. Preparing to unpack .../302-libplexus-container-default-java_2.1.1-1_all.deb ... Unpacking libplexus-container-default-java (2.1.1-1) ... Selecting previously unselected package libpolyglot-maven-java. Preparing to unpack .../303-libpolyglot-maven-java_0.8~tobrien+git20120905-10_all.deb ... Unpacking libpolyglot-maven-java (0.8~tobrien+git20120905-10) ... Selecting previously unselected package librhino-java. Preparing to unpack .../304-librhino-java_1.7.14-2.1_all.deb ... Unpacking librhino-java (1.7.14-2.1) ... Selecting previously unselected package libsimple-http-java. Preparing to unpack .../305-libsimple-http-java_4.1.21-1.1_all.deb ... Unpacking libsimple-http-java (4.1.21-1.1) ... Selecting previously unselected package libwagon-file-java. Preparing to unpack .../306-libwagon-file-java_3.5.3-1_all.deb ... Unpacking libwagon-file-java (3.5.3-1) ... Selecting previously unselected package libjsoup-java. Preparing to unpack .../307-libjsoup-java_1.15.3-1_all.deb ... Unpacking libjsoup-java (1.15.3-1) ... Selecting previously unselected package libwagon-http-java. Preparing to unpack .../308-libwagon-http-java_3.5.3-1_all.deb ... Unpacking libwagon-http-java (3.5.3-1) ... Selecting previously unselected package libjcommander-java. Preparing to unpack .../309-libjcommander-java_1.71-4_all.deb ... Unpacking libjcommander-java (1.71-4) ... Selecting previously unselected package testng. Preparing to unpack .../310-testng_6.9.12-4_all.deb ... Unpacking testng (6.9.12-4) ... Selecting previously unselected package libgradle-plugins-java. Preparing to unpack .../311-libgradle-plugins-java_4.4.1-20_all.deb ... Unpacking libgradle-plugins-java (4.4.1-20) ... Selecting previously unselected package gradle. Preparing to unpack .../312-gradle_4.4.1-20_all.deb ... Unpacking gradle (4.4.1-20) ... Selecting previously unselected package maven-repo-helper. Preparing to unpack .../313-maven-repo-helper_1.11_all.deb ... Unpacking maven-repo-helper (1.11) ... Selecting previously unselected package gradle-debian-helper. Preparing to unpack .../314-gradle-debian-helper_2.4_all.deb ... Unpacking gradle-debian-helper (2.4) ... Selecting previously unselected package jarwrapper. Preparing to unpack .../315-jarwrapper_0.79_all.deb ... Unpacking jarwrapper (0.79) ... Selecting previously unselected package javahelper. Preparing to unpack .../316-javahelper_0.79_all.deb ... Unpacking javahelper (0.79) ... Selecting previously unselected package libbyte-buddy-java. Preparing to unpack .../317-libbyte-buddy-java_1.14.13-1_all.deb ... Unpacking libbyte-buddy-java (1.14.13-1) ... Selecting previously unselected package libcommons-math3-java. Preparing to unpack .../318-libcommons-math3-java_3.6.1-3_all.deb ... Unpacking libcommons-math3-java (3.6.1-3) ... Selecting previously unselected package libjackson2-annotations-java. Preparing to unpack .../319-libjackson2-annotations-java_2.14.0-1_all.deb ... Unpacking libjackson2-annotations-java (2.14.0-1) ... Selecting previously unselected package libjackson2-core-java. Preparing to unpack .../320-libjackson2-core-java_2.14.1-1_all.deb ... Unpacking libjackson2-core-java (2.14.1-1) ... Selecting previously unselected package libjackson2-databind-java. Preparing to unpack .../321-libjackson2-databind-java_2.14.0-1_all.deb ... Unpacking libjackson2-databind-java (2.14.0-1) ... Selecting previously unselected package liblz4-jni. Preparing to unpack .../322-liblz4-jni_1.8.0-4_arm64.deb ... Unpacking liblz4-jni (1.8.0-4) ... Selecting previously unselected package liblz4-java. Preparing to unpack .../323-liblz4-java_1.8.0-4_all.deb ... Unpacking liblz4-java (1.8.0-4) ... Selecting previously unselected package libmockito-java. Preparing to unpack .../324-libmockito-java_2.23.0-2_all.deb ... Unpacking libmockito-java (2.23.0-2) ... Selecting previously unselected package libredberry-pipe-java. Preparing to unpack .../325-libredberry-pipe-java_1.0.0~alpha0-3_all.deb ... Unpacking libredberry-pipe-java (1.0.0~alpha0-3) ... Selecting previously unselected package libtrove3-java. Preparing to unpack .../326-libtrove3-java_3.0.3-5_all.deb ... Unpacking libtrove3-java (3.0.3-5) ... Setting up libjcifs-java (1.3.19-2) ... Setting up libbcprov-java (1.77-1) ... Setting up libksba8:arm64 (1.6.6-1) ... Setting up media-types (10.1.0) ... Setting up libpipeline1:arm64 (1.5.7-2) ... Setting up fastjar (2:0.98-7) ... Setting up libgraphite2-3:arm64 (1.3.14-2) ... Setting up liblcms2-2:arm64 (2.14-2+b1) ... Setting up libpixman-1-0:arm64 (0.42.2-1+b1) ... Setting up libjcommander-java (1.71-4) ... Setting up libjackson2-annotations-java (2.14.0-1) ... Setting up wdiff (1.2.2-6) ... Setting up libsharpyuv0:arm64 (1.3.2-0.4) ... Setting up libslf4j-java (1.7.32-1) ... Setting up libfile-which-perl (1.27-2) ... Setting up libxau6:arm64 (1:1.0.9-1) ... Setting up libplexus-utils2-java (3.4.2-1) ... Setting up libredberry-pipe-java (1.0.0~alpha0-3) ... Setting up libplexus-classworlds-java (2.7.0-1) ... Setting up libqdox-java (1.12.1-3) ... Setting up libicu72:arm64 (72.1-4+b1) ... Setting up liblerc4:arm64 (4.0.0+ds-4+b1) ... Setting up libjsr305-java (0.1~+svn49-11) ... Setting up libsimple-http-java (4.1.21-1.1) ... Setting up bsdextrautils (2.39.3-6) ... Setting up hicolor-icon-theme (0.17-2) ... Setting up java-common (0.75) ... Setting up libdynaloader-functions-perl (0.003-3) ... Setting up libdatrie1:arm64 (0.2.13-3) ... Setting up libjcip-annotations-java (20060626-6) ... Setting up libobjenesis-java (3.3-3) ... Setting up libclass-method-modifiers-perl (2.15-1) ... Setting up libaopalliance-java (20070526-7) ... Setting up libcommons-cli-java (1.6.0-1) ... Setting up libio-pty-perl (1:1.20-1) ... Setting up libmagic-mgc (1:5.45-2+b1) ... Setting up liblogback-java (1:1.2.11-5) ... Setting up libclone-perl:arm64 (0.46-1+b1) ... Setting up libminlog-java (1.3.0-1.1) ... Setting up libarchive-zip-perl (1.68-1) ... Setting up libglib2.0-0:arm64 (2.78.4-1) ... No schema files found: doing nothing. Setting up libglvnd0:arm64 (1.7.0-1) ... Setting up libgoogle-gson-java (2.10.1-1) ... Setting up libhtml-tagset-perl (3.24-1) ... Setting up unzip (6.0-28) ... Setting up libdebhelper-perl (13.15.3) ... Setting up libbrotli1:arm64 (1.1.0-2+b3) ... Setting up liblwp-mediatypes-perl (6.04-2) ... Setting up libgdk-pixbuf2.0-common (2.42.10+dfsg-3) ... Setting up libasm-java (9.7-1) ... Setting up x11-common (1:7.7+23) ... invoke-rc.d: could not determine current runlevel Setting up X socket directories... /tmp/.X11-unix /tmp/.ICE-unix. Setting up libtry-tiny-perl (0.31-2) ... Setting up libsensors-config (1:3.6.0-9) ... Setting up libmagic1:arm64 (1:5.45-2+b1) ... Setting up libdeflate0:arm64 (1.20-1) ... Setting up perl-openssl-defaults:arm64 (7+b1) ... Setting up libdd-plist-java (1.20-1.1) ... Setting up gettext-base (0.21-14+b1) ... Setting up m4 (1.4.19-4) ... Setting up libel-api-java (3.0.0-3) ... Setting up libencode-locale-perl (1.05-3) ... Setting up libplexus-component-annotations-java (2.1.1-1) ... Setting up libnpth0:arm64 (1.6-3+b1) ... Setting up file (1:5.45-2+b1) ... Setting up libpolyglot-maven-java (0.8~tobrien+git20120905-10) ... Setting up libfelix-gogo-runtime-java (0.16.2-1.1) ... Setting up libassuan0:arm64 (2.5.6-1) ... Setting up libjzlib-java (1.1.3-3) ... Setting up libjbig0:arm64 (2.1-6.1+b1) ... Setting up libsasl2-modules-db:arm64 (2.1.28+dfsg1-4+b1) ... Setting up tzdata (2024a-1) ... Current default time zone: 'Etc/UTC' Local time is now: Thu May 22 05:25:28 UTC 2025. Universal Time is now: Thu May 22 05:25:28 UTC 2025. Run 'dpkg-reconfigure tzdata' if you wish to change it. Setting up libgeronimo-annotation-1.3-spec-java (1.3-1) ... Setting up libgeronimo-interceptor-3.0-spec-java (1.0.1-4) ... Setting up libcommons-collections3-java (3.2.2-3) ... Setting up libasound2-data (1.2.10-3) ... Setting up libjsch-java (0.1.55-1) ... Setting up libreflectasm-java (1.11.9+dfsg-4) ... Setting up librhino-java (1.7.14-2.1) ... Setting up autotools-dev (20220109.1) ... Setting up libz3-4:arm64 (4.8.12-3.1+b2) ... Setting up libbsf-java (1:2.4.0-8) ... Setting up libosgi-annotation-java (8.1.0-1) ... Setting up libjformatstring-java (0.10~20131207-2.1) ... Setting up libjavaewah-java (1.2.3-1) ... Setting up libjpeg62-turbo:arm64 (1:2.1.5-2+b2) ... Setting up libjaxen-java (1.1.6-4) ... Setting up libx11-data (2:1.8.7-1) ... Setting up libnspr4:arm64 (2:4.35-1.1+b1) ... Setting up gnupg-l10n (2.2.40-1.1) ... Setting up libeclipse-jdt-annotation-java (2.2.700+eclipse4.26-2) ... Setting up libjansi-java (2.4.1-2) ... Setting up libapache-pom-java (29-2) ... Setting up libavahi-common-data:arm64 (0.8-13+b1) ... Setting up libxpp3-java (1.1.4c-3) ... Setting up libatinject-jsr330-api-java (1.0+ds1-5) ... Setting up libdbus-1-3:arm64 (1.14.10-4) ... Setting up libwebsocket-api-java (1.1-2) ... Setting up libfribidi0:arm64 (1.0.13-3+b1) ... Setting up libplexus-interpolation-java (1.26-1) ... Setting up fonts-dejavu-mono (2.37-8) ... Setting up libpng16-16:arm64 (1.6.43-1) ... Setting up libxml-commons-resolver1.1-java (1.2-11) ... Setting up libkryo-java (2.20-7) ... Setting up libxz-java (1.9-1) ... Setting up libio-html-perl (1.004-3) ... Setting up libjna-jni (5.14.0-1) ... Setting up autopoint (0.21-14) ... Setting up binfmt-support (2.2.2-7) ... invoke-rc.d: could not determine current runlevel invoke-rc.d: policy-rc.d denied execution of start. Setting up libb-hooks-op-check-perl:arm64 (0.22-2+b2) ... Setting up fonts-dejavu-core (2.37-8) ... Setting up libfelix-framework-java (4.6.1-2.1) ... Setting up libipc-run-perl (20231003.0-2) ... Setting up libpcsclite1:arm64 (2.0.1-1+b1) ... Setting up libsensors5:arm64 (1:3.6.0-9) ... Setting up libhamcrest-java (2.2-2) ... Setting up libglapi-mesa:arm64 (23.3.5-1) ... Setting up libbsh-java (2.0b4-20) ... Setting up libjsp-api-java (2.3.4-3) ... Setting up libsasl2-2:arm64 (2.1.28+dfsg1-4+b1) ... Setting up libvulkan1:arm64 (1.3.275.0-1) ... Setting up autoconf (2.71-3) ... Setting up libwebp7:arm64 (1.3.2-0.4) ... Setting up libtimedate-perl (2.3300-2) ... Setting up libgif7:arm64 (5.2.2-1) ... Setting up libjarjar-java (1.4+svn142-12) ... Setting up libtrove3-java (3.0.3-5) ... Setting up sensible-utils (0.0.22) ... Setting up libxshmfence1:arm64 (1.3-1) ... Setting up libjsoup-java (1.15.3-1) ... Setting up at-spi2-common (2.50.0-1) ... Setting up libtiff6:arm64 (4.5.1+git230720-4) ... Setting up libuchardet0:arm64 (0.0.8-1+b1) ... Setting up libxml-commons-external-java (1.4.01-6) ... Setting up libjna-java (5.14.0-1) ... Setting up libxbean-reflect-java (4.5-8) ... Setting up libasound2:arm64 (1.2.10-3) ... Setting up libservlet-api-java (4.0.1-2) ... Setting up librole-tiny-perl (2.002004-1) ... Setting up libjackson2-core-java (2.14.1-1) ... Setting up libsub-override-perl (0.10-1) ... Setting up libthai-data (0.1.29-2) ... Setting up netbase (6.4) ... Setting up libcommons-math3-java (3.6.1-3) ... Setting up libsub-quote-perl (2.006008-1) ... Setting up libnative-platform-jni (0.14-6) ... Setting up libclass-xsaccessor-perl (1.19-4+b2) ... Setting up libgtk2.0-common (2.24.33-3) ... Setting up libatk1.0-0:arm64 (2.50.0-1+b1) ... Setting up liblz4-jni (1.8.0-4) ... Setting up libhttpcore-java (4.4.16-1) ... Setting up libbcpg-java (1.77-1) ... Setting up libjs-jquery (3.6.1+dfsg+~3.5.14-1) ... Setting up libxerces2-java (2.12.2-1) ... Setting up libfile-dirlist-perl (0.05-3) ... Setting up libfile-homedir-perl (1.006-2) ... Setting up libantlr-java (2.7.7+dfsg-13) ... Setting up libyaml-snake-java (1.33-2) ... Setting up openssl (3.1.5-1) ... Setting up libbsd0:arm64 (0.12.2-1) ... Setting up libdrm-common (2.4.120-2) ... Setting up libcdi-api-java (1.2-3) ... Setting up libelf1:arm64 (0.190-1+b1) ... Setting up readline-common (8.2-3) ... Setting up libhawtjni-runtime-java (1.18-1) ... Setting up libxml2:arm64 (2.9.14+dfsg-1.3+b2) ... Setting up liburi-perl (5.28-1) ... Setting up libfile-touch-perl (0.12-2) ... Setting up dctrl-tools (2.24-3) ... Setting up libjatl-java (0.2.3-1.1) ... Setting up libnet-ssleay-perl:arm64 (1.94-1) ... Setting up automake (1:1.16.5-1.3) ... update-alternatives: using /usr/bin/automake-1.16 to provide /usr/bin/automake (automake) in auto mode Setting up pinentry-curses (1.2.1-3) ... Setting up libdom4j-java (2.1.4-1) ... Setting up libfile-stripnondeterminism-perl (1.13.1-1) ... Setting up libwagon-provider-api-java (3.5.3-1) ... Setting up libnative-platform-java (0.14-6) ... Setting up libosgi-core-java (8.0.0-2) ... Setting up libhttp-date-perl (6.06-1) ... Setting up libxstream-java (1.4.20-1) ... Setting up libnekohtml-java (1.9.22.noko2-0.1) ... Setting up libxdmcp6:arm64 (1:1.1.2-3) ... Setting up liblz4-java (1.8.0-4) ... Setting up libxcb1:arm64 (1.15-1) ... Setting up gettext (0.21-14+b1) ... Setting up libjetty9-java (9.4.54-1) ... Setting up libxcb-xfixes0:arm64 (1.15-1) ... Setting up java-wrappers (0.4) ... Setting up libfile-listing-perl (6.16-1) ... Setting up libosgi-compendium-java (7.0.0-1) ... Setting up jarwrapper (0.79) ... Setting up libtool (2.4.7-7) ... Setting up libxcb-render0:arm64 (1.15-1) ... Setting up fontconfig-config (2.15.0-1.1) ... Setting up libxcb-glx0:arm64 (1.15-1) ... Setting up libmaven-parent-java (35-1) ... Setting up libedit2:arm64 (3.1-20230828-1) ... Setting up libreadline8:arm64 (8.2-3+b1) ... Setting up libcommons-parent-java (56-1) ... Setting up libavahi-common3:arm64 (0.8-13+b1) ... Setting up libcommons-logging-java (1.3.0-1) ... Setting up libnet-http-perl (6.23-1) ... Setting up libsisu-inject-java (0.3.4-2) ... Setting up libnss3:arm64 (2:3.99-1) ... Setting up libxcb-shm0:arm64 (1.15-1) ... Setting up libdevel-callchecker-perl:arm64 (0.008-2+b1) ... Setting up libcommons-lang-java (2.6-10) ... Setting up libldap-2.5-0:arm64 (2.5.13+dfsg-5+b3) ... Setting up libjackson2-databind-java (2.14.0-1) ... Setting up libplexus-cipher-java (2.0-1) ... Setting up intltool-debian (0.35.0+20060710.6) ... Setting up libxcb-present0:arm64 (1.15-1) ... Setting up dh-autoreconf (20) ... Setting up patchutils (0.4.2-1) ... Setting up libthai0:arm64 (0.1.29-2) ... Setting up ca-certificates (20240203) ... Updating certificates in /etc/ssl/certs... 146 added, 0 removed; done. Setting up libsisu-plexus-java (0.3.4-3) ... Setting up libbcel-java (6.5.0-2) ... Setting up libfreetype6:arm64 (2.13.2+dfsg-1+b1) ... Setting up libxcb-sync1:arm64 (1.15-1) ... Setting up testng (6.9.12-4) ... Setting up shared-mime-info (2.4-1) ... Setting up libcommons-lang3-java (3.14.0-1) ... Setting up libxcb-dri2-0:arm64 (1.15-1) ... Setting up dh-strip-nondeterminism (1.13.1-1) ... Setting up libwww-robotrules-perl (6.02-1) ... Setting up libfelix-resolver-java (1.16.0-1) ... Setting up libdrm2:arm64 (2.4.120-2) ... Setting up dwz (0.15-1) ... Setting up libjansi-native-java (1.8-2) ... Setting up groff-base (1.23.0-3) ... Setting up libxcb-randr0:arm64 (1.15-1) ... Setting up libhtml-parser-perl:arm64 (3.81-1+b1) ... Setting up gpgconf (2.2.40-1.1+b1) ... Setting up libjansi1-java (1.18-3) ... Setting up libplexus-sec-dispatcher-java (2.0-3) ... Setting up libx11-6:arm64 (2:1.8.7-1) ... Setting up libharfbuzz0b:arm64 (8.3.0-2) ... Setting up libgdk-pixbuf-2.0-0:arm64 (2.42.10+dfsg-3+b1) ... Setting up libfontconfig1:arm64 (2.15.0-1.1) ... Setting up ca-certificates-java (20240118) ... No JRE found. Skipping Java certificates setup. Setting up libwagon-file-java (3.5.3-1) ... Setting up libcommons-codec-java (1.16.0-1) ... Setting up libjline2-java (2.14.6-5) ... Setting up libllvm17:arm64 (1:17.0.6-5) ... Setting up libxcomposite1:arm64 (1:0.4.5-1) ... Setting up libavahi-client3:arm64 (0.8-13+b1) ... Setting up libio-socket-ssl-perl (2.085-1) ... Setting up gpg (2.2.40-1.1+b1) ... Setting up gnupg-utils (2.2.40-1.1+b1) ... Setting up libhttp-message-perl (6.45-1) ... Setting up libdrm-amdgpu1:arm64 (2.4.120-2) ... Setting up libxcb-dri3-0:arm64 (1.15-1) ... Setting up gtk-update-icon-cache (3.24.41-1) ... Setting up libx11-xcb1:arm64 (2:1.8.7-1) ... Setting up libhttp-negotiate-perl (6.01-2) ... Setting up fontconfig (2.15.0-1.1) ... Regenerating fonts cache... done. Setting up libdrm-nouveau2:arm64 (2.4.120-2) ... Setting up libfindbugs-java (3.1.0~preview2-3) ... Setting up libxdamage1:arm64 (1:1.1.6-1) ... Setting up gpg-agent (2.2.40-1.1+b1) ... Setting up libxrender1:arm64 (1:0.9.10-1.1) ... Setting up libcommons-compress-java (1.25.0-1) ... Setting up libhttp-cookies-perl (6.11-1) ... Setting up libcommons-io-java (2.16.0-1) ... Setting up libdrm-radeon1:arm64 (2.4.120-2) ... Setting up po-debconf (1.0.21+nmu1) ... Setting up libhtml-tree-perl (5.07-3) ... Setting up libpython3.11-stdlib:arm64 (3.11.8-1) ... Setting up libparams-classify-perl:arm64 (0.015-2+b2) ... Setting up gpgsm (2.2.40-1.1+b1) ... Setting up libpango-1.0-0:arm64 (1.52.0+ds-1) ... Setting up libgl1-mesa-dri:arm64 (23.3.5-1) ... Setting up libxext6:arm64 (2:1.3.4-1+b1) ... Setting up man-db (2.12.0-3) ... Not building database; man-db/auto-update is not 'true'. Setting up libcairo2:arm64 (1.18.0-1+b1) ... Setting up libxxf86vm1:arm64 (1:1.1.4-1+b2) ... Setting up dirmngr (2.2.40-1.1+b1) ... Setting up libmaven-resolver-java (1.6.3-1) ... Setting up adwaita-icon-theme (46.0-1) ... update-alternatives: using /usr/share/icons/Adwaita/cursor.theme to provide /usr/share/icons/default/index.theme (x-cursor-theme) in auto mode Setting up libmodule-runtime-perl (0.016-2) ... Setting up libxfixes3:arm64 (1:6.0.0-2) ... Setting up libxinerama1:arm64 (2:1.1.4-3) ... Setting up libxrandr2:arm64 (2:1.5.4-1) ... Setting up gpg-wks-server (2.2.40-1.1+b1) ... Setting up libcups2:arm64 (2.4.7-1+b1) ... Setting up libhttpclient-java (4.5.14-1) ... Setting up libwagon-http-java (3.5.3-1) ... Setting up libmaven-shared-utils-java (3.3.4-1) ... Setting up libpangoft2-1.0-0:arm64 (1.52.0+ds-1) ... Setting up libpangocairo-1.0-0:arm64 (1.52.0+ds-1) ... Setting up libpython3-stdlib:arm64 (3.11.6-1) ... Setting up python3.11 (3.11.8-1) ... Setting up libjgit-java (4.11.9-2) ... Setting up libglx-mesa0:arm64 (23.3.5-1) ... Setting up libxi6:arm64 (2:1.8.1-1) ... Setting up gpg-wks-client (2.2.40-1.1+b1) ... Setting up libglx0:arm64 (1.7.0-1) ... Setting up libimport-into-perl (1.002005-2) ... Setting up libxtst6:arm64 (2:1.2.3-1.1) ... Setting up libmoo-perl (2.005005-1) ... Setting up libxcursor1:arm64 (1:1.2.1-1) ... Setting up debhelper (13.15.3) ... Setting up python3 (3.11.6-1) ... Setting up libgl1:arm64 (1.7.0-1) ... Setting up openjdk-17-jre-headless:arm64 (17.0.10+7-1) ... update-alternatives: using /usr/lib/jvm/java-17-openjdk-arm64/bin/java to provide /usr/bin/java (java) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-arm64/bin/jpackage to provide /usr/bin/jpackage (jpackage) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-arm64/bin/keytool to provide /usr/bin/keytool (keytool) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-arm64/bin/rmiregistry to provide /usr/bin/rmiregistry (rmiregistry) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-arm64/lib/jexec to provide /usr/bin/jexec (jexec) in auto mode Setting up gnupg (2.2.40-1.1) ... Setting up libgtk2.0-0:arm64 (2.24.33-3) ... Setting up liblwp-protocol-https-perl (6.14-1) ... Setting up liberror-prone-java (2.18.0-1) ... Setting up libwww-perl (6.77-1) ... Setting up devscripts (2.23.7) ... Setting up libguava-java (32.0.1-1) ... Setting up javahelper (0.79) ... Setting up libplexus-container-default-java (2.1.1-1) ... Setting up libguice-java (4.2.3-2) ... Setting up libmaven3-core-java (3.8.7-2) ... Setting up libbyte-buddy-java (1.14.13-1) ... Setting up libmockito-java (2.23.0-2) ... Processing triggers for libc-bin (2.37-15) ... Processing triggers for ca-certificates-java (20240118) ... Adding debian:ACCVRAIZ1.pem Adding debian:AC_RAIZ_FNMT-RCM.pem Adding debian:AC_RAIZ_FNMT-RCM_SERVIDORES_SEGUROS.pem Adding debian:ANF_Secure_Server_Root_CA.pem Adding debian:Actalis_Authentication_Root_CA.pem Adding debian:AffirmTrust_Commercial.pem Adding debian:AffirmTrust_Networking.pem Adding debian:AffirmTrust_Premium.pem Adding debian:AffirmTrust_Premium_ECC.pem Adding debian:Amazon_Root_CA_1.pem Adding debian:Amazon_Root_CA_2.pem Adding debian:Amazon_Root_CA_3.pem Adding debian:Amazon_Root_CA_4.pem Adding debian:Atos_TrustedRoot_2011.pem Adding debian:Atos_TrustedRoot_Root_CA_ECC_TLS_2021.pem Adding debian:Atos_TrustedRoot_Root_CA_RSA_TLS_2021.pem Adding debian:Autoridad_de_Certificacion_Firmaprofesional_CIF_A62634068.pem Adding debian:BJCA_Global_Root_CA1.pem Adding debian:BJCA_Global_Root_CA2.pem Adding debian:Baltimore_CyberTrust_Root.pem Adding debian:Buypass_Class_2_Root_CA.pem Adding debian:Buypass_Class_3_Root_CA.pem Adding debian:CA_Disig_Root_R2.pem Adding debian:CFCA_EV_ROOT.pem Adding debian:COMODO_Certification_Authority.pem Adding debian:COMODO_ECC_Certification_Authority.pem Adding debian:COMODO_RSA_Certification_Authority.pem Adding debian:Certainly_Root_E1.pem Adding debian:Certainly_Root_R1.pem Adding debian:Certigna.pem Adding debian:Certigna_Root_CA.pem Adding debian:Certum_EC-384_CA.pem Adding debian:Certum_Trusted_Network_CA.pem Adding debian:Certum_Trusted_Network_CA_2.pem Adding debian:Certum_Trusted_Root_CA.pem Adding debian:CommScope_Public_Trust_ECC_Root-01.pem Adding debian:CommScope_Public_Trust_ECC_Root-02.pem Adding debian:CommScope_Public_Trust_RSA_Root-01.pem Adding debian:CommScope_Public_Trust_RSA_Root-02.pem Adding debian:Comodo_AAA_Services_root.pem Adding debian:D-TRUST_BR_Root_CA_1_2020.pem Adding debian:D-TRUST_EV_Root_CA_1_2020.pem Adding debian:D-TRUST_Root_Class_3_CA_2_2009.pem Adding debian:D-TRUST_Root_Class_3_CA_2_EV_2009.pem Adding debian:DigiCert_Assured_ID_Root_CA.pem Adding debian:DigiCert_Assured_ID_Root_G2.pem Adding debian:DigiCert_Assured_ID_Root_G3.pem Adding debian:DigiCert_Global_Root_CA.pem Adding debian:DigiCert_Global_Root_G2.pem Adding debian:DigiCert_Global_Root_G3.pem Adding debian:DigiCert_High_Assurance_EV_Root_CA.pem Adding debian:DigiCert_TLS_ECC_P384_Root_G5.pem Adding debian:DigiCert_TLS_RSA4096_Root_G5.pem Adding debian:DigiCert_Trusted_Root_G4.pem Adding debian:Entrust.net_Premium_2048_Secure_Server_CA.pem Adding debian:Entrust_Root_Certification_Authority.pem Adding debian:Entrust_Root_Certification_Authority_-_EC1.pem Adding debian:Entrust_Root_Certification_Authority_-_G2.pem Adding debian:Entrust_Root_Certification_Authority_-_G4.pem Adding debian:GDCA_TrustAUTH_R5_ROOT.pem Adding debian:GLOBALTRUST_2020.pem Adding debian:GTS_Root_R1.pem Adding debian:GTS_Root_R2.pem Adding debian:GTS_Root_R3.pem Adding debian:GTS_Root_R4.pem Adding debian:GlobalSign_ECC_Root_CA_-_R4.pem Adding debian:GlobalSign_ECC_Root_CA_-_R5.pem Adding debian:GlobalSign_Root_CA.pem Adding debian:GlobalSign_Root_CA_-_R3.pem Adding debian:GlobalSign_Root_CA_-_R6.pem Adding debian:GlobalSign_Root_E46.pem Adding debian:GlobalSign_Root_R46.pem Adding debian:Go_Daddy_Class_2_CA.pem Adding debian:Go_Daddy_Root_Certificate_Authority_-_G2.pem Adding debian:HARICA_TLS_ECC_Root_CA_2021.pem Adding debian:HARICA_TLS_RSA_Root_CA_2021.pem Adding debian:Hellenic_Academic_and_Research_Institutions_ECC_RootCA_2015.pem Adding debian:Hellenic_Academic_and_Research_Institutions_RootCA_2015.pem Adding debian:HiPKI_Root_CA_-_G1.pem Adding debian:Hongkong_Post_Root_CA_3.pem Adding debian:ISRG_Root_X1.pem Adding debian:ISRG_Root_X2.pem Adding debian:IdenTrust_Commercial_Root_CA_1.pem Adding debian:IdenTrust_Public_Sector_Root_CA_1.pem Adding debian:Izenpe.com.pem Adding debian:Microsec_e-Szigno_Root_CA_2009.pem Adding debian:Microsoft_ECC_Root_Certificate_Authority_2017.pem Adding debian:Microsoft_RSA_Root_Certificate_Authority_2017.pem Adding debian:NAVER_Global_Root_Certification_Authority.pem Adding debian:NetLock_Arany_=Class_Gold=_Főtanúsítvány.pem Adding debian:OISTE_WISeKey_Global_Root_GB_CA.pem Adding debian:OISTE_WISeKey_Global_Root_GC_CA.pem Adding debian:QuoVadis_Root_CA_1_G3.pem Adding debian:QuoVadis_Root_CA_2.pem Adding debian:QuoVadis_Root_CA_2_G3.pem Adding debian:QuoVadis_Root_CA_3.pem Adding debian:QuoVadis_Root_CA_3_G3.pem Adding debian:SSL.com_EV_Root_Certification_Authority_ECC.pem Adding debian:SSL.com_EV_Root_Certification_Authority_RSA_R2.pem Adding debian:SSL.com_Root_Certification_Authority_ECC.pem Adding debian:SSL.com_Root_Certification_Authority_RSA.pem Adding debian:SSL.com_TLS_ECC_Root_CA_2022.pem Adding debian:SSL.com_TLS_RSA_Root_CA_2022.pem Adding debian:SZAFIR_ROOT_CA2.pem Adding debian:Sectigo_Public_Server_Authentication_Root_E46.pem Adding debian:Sectigo_Public_Server_Authentication_Root_R46.pem Adding debian:SecureSign_RootCA11.pem Adding debian:SecureTrust_CA.pem Adding debian:Secure_Global_CA.pem Adding debian:Security_Communication_ECC_RootCA1.pem Adding debian:Security_Communication_RootCA2.pem Adding debian:Security_Communication_RootCA3.pem Adding debian:Security_Communication_Root_CA.pem Adding debian:Starfield_Class_2_CA.pem Adding debian:Starfield_Root_Certificate_Authority_-_G2.pem Adding debian:Starfield_Services_Root_Certificate_Authority_-_G2.pem Adding debian:SwissSign_Gold_CA_-_G2.pem Adding debian:SwissSign_Silver_CA_-_G2.pem Adding debian:T-TeleSec_GlobalRoot_Class_2.pem Adding debian:T-TeleSec_GlobalRoot_Class_3.pem Adding debian:TUBITAK_Kamu_SM_SSL_Kok_Sertifikasi_-_Surum_1.pem Adding debian:TWCA_Global_Root_CA.pem Adding debian:TWCA_Root_Certification_Authority.pem Adding debian:TeliaSonera_Root_CA_v1.pem Adding debian:Telia_Root_CA_v2.pem Adding debian:TrustAsia_Global_Root_CA_G3.pem Adding debian:TrustAsia_Global_Root_CA_G4.pem Adding debian:Trustwave_Global_Certification_Authority.pem Adding debian:Trustwave_Global_ECC_P256_Certification_Authority.pem Adding debian:Trustwave_Global_ECC_P384_Certification_Authority.pem Adding debian:TunTrust_Root_CA.pem Adding debian:UCA_Extended_Validation_Root.pem Adding debian:UCA_Global_G2_Root.pem Adding debian:USERTrust_ECC_Certification_Authority.pem Adding debian:USERTrust_RSA_Certification_Authority.pem Adding debian:XRamp_Global_CA_Root.pem Adding debian:certSIGN_ROOT_CA.pem Adding debian:certSIGN_Root_CA_G2.pem Adding debian:e-Szigno_Root_CA_2017.pem Adding debian:ePKI_Root_Certification_Authority.pem Adding debian:emSign_ECC_Root_CA_-_C3.pem Adding debian:emSign_ECC_Root_CA_-_G3.pem Adding debian:emSign_Root_CA_-_C1.pem Adding debian:emSign_Root_CA_-_G1.pem Adding debian:vTrus_ECC_Root_CA.pem Adding debian:vTrus_Root_CA.pem done. Setting up maven-repo-helper (1.11) ... Setting up antlr (2.7.7+dfsg-13) ... Setting up openjdk-17-jdk-headless:arm64 (17.0.10+7-1) ... update-alternatives: using /usr/lib/jvm/java-17-openjdk-arm64/bin/jar to provide /usr/bin/jar (jar) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-arm64/bin/jarsigner to provide /usr/bin/jarsigner (jarsigner) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-arm64/bin/javac to provide /usr/bin/javac (javac) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-arm64/bin/javadoc to provide /usr/bin/javadoc (javadoc) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-arm64/bin/javap to provide /usr/bin/javap (javap) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-arm64/bin/jcmd to provide /usr/bin/jcmd (jcmd) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-arm64/bin/jdb to provide /usr/bin/jdb (jdb) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-arm64/bin/jdeprscan to provide /usr/bin/jdeprscan (jdeprscan) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-arm64/bin/jdeps to provide /usr/bin/jdeps (jdeps) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-arm64/bin/jfr to provide /usr/bin/jfr (jfr) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-arm64/bin/jimage to provide /usr/bin/jimage (jimage) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-arm64/bin/jinfo to provide /usr/bin/jinfo (jinfo) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-arm64/bin/jlink to provide /usr/bin/jlink (jlink) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-arm64/bin/jmap to provide /usr/bin/jmap (jmap) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-arm64/bin/jmod to provide /usr/bin/jmod (jmod) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-arm64/bin/jps to provide /usr/bin/jps (jps) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-arm64/bin/jrunscript to provide /usr/bin/jrunscript (jrunscript) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-arm64/bin/jshell to provide /usr/bin/jshell (jshell) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-arm64/bin/jstack to provide /usr/bin/jstack (jstack) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-arm64/bin/jstat to provide /usr/bin/jstat (jstat) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-arm64/bin/jstatd to provide /usr/bin/jstatd (jstatd) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-arm64/bin/serialver to provide /usr/bin/serialver (serialver) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-arm64/bin/jhsdb to provide /usr/bin/jhsdb (jhsdb) in auto mode Setting up ivy (2.5.2-1) ... Setting up ant (1.10.14-1) ... Setting up junit4 (4.13.2-4) ... Setting up groovy (2.4.21-10) ... update-alternatives: using /usr/share/groovy/bin/groovy to provide /usr/bin/groovy (groovy) in auto mode update-alternatives: using /usr/share/groovy/bin/groovyc to provide /usr/bin/groovyc (groovyc) in auto mode update-alternatives: using /usr/share/groovy/bin/grape to provide /usr/bin/grape (grape) in auto mode update-alternatives: using /usr/share/groovy/bin/startGroovy to provide /usr/bin/startGroovy (startGroovy) in auto mode update-alternatives: using /usr/share/groovy/bin/groovysh to provide /usr/bin/groovysh (groovysh) in auto mode update-alternatives: using /usr/share/groovy/bin/java2groovy to provide /usr/bin/java2groovy (java2groovy) in auto mode update-alternatives: using /usr/share/groovy/bin/groovyConsole to provide /usr/bin/groovyConsole (groovyConsole) in auto mode update-alternatives: using /usr/share/groovy/bin/groovydoc to provide /usr/bin/groovydoc (groovydoc) in auto mode Setting up default-jre-headless (2:1.17-75) ... Setting up openjdk-17-jre:arm64 (17.0.10+7-1) ... Setting up default-jre (2:1.17-75) ... Setting up openjdk-17-jdk:arm64 (17.0.10+7-1) ... update-alternatives: using /usr/lib/jvm/java-17-openjdk-arm64/bin/jconsole to provide /usr/bin/jconsole (jconsole) in auto mode Setting up ant-optional (1.10.14-1) ... Setting up bnd (5.0.1-5) ... Setting up default-jdk-headless (2:1.17-75) ... Setting up libgradle-core-java (4.4.1-20) ... Setting up libgradle-plugins-java (4.4.1-20) ... Setting up gradle (4.4.1-20) ... Setting up default-jdk (2:1.17-75) ... Setting up gradle-debian-helper (2.4) ... Processing triggers for ca-certificates (20240203) ... Updating certificates in /etc/ssl/certs... 0 added, 0 removed; done. Running hooks in /etc/ca-certificates/update.d... done. Processing triggers for ca-certificates-java (20240118) ... done. Reading package lists... Building dependency tree... Reading state information... Reading extended state information... Initializing package states... Writing extended state information... Building tag database... -> Finished parsing the build-deps I: Building the package I: user script /srv/workspace/pbuilder/1445111/tmp/hooks/A99_set_merged_usr starting Not re-configuring usrmerge for trixie I: user script /srv/workspace/pbuilder/1445111/tmp/hooks/A99_set_merged_usr finished hostname: Name or service not known I: Running cd /build/reproducible-path/milib-2.2.0+dfsg/ && env PATH="/usr/sbin:/usr/bin:/sbin:/bin:/usr/games:/i/capture/the/path" HOME="/nonexistent/second-build" dpkg-buildpackage -us -uc -b && env PATH="/usr/sbin:/usr/bin:/sbin:/bin:/usr/games:/i/capture/the/path" HOME="/nonexistent/second-build" dpkg-genchanges -S > ../milib_2.2.0+dfsg-1_source.changes dpkg-buildpackage: info: source package milib dpkg-buildpackage: info: source version 2.2.0+dfsg-1 dpkg-buildpackage: info: source distribution unstable dpkg-buildpackage: info: source changed by Pierre Gruet dpkg-source --before-build . dpkg-buildpackage: info: host architecture arm64 debian/rules clean dh clean --with javahelper --with maven_repo_helper debian/rules override_dh_auto_clean make[1]: Entering directory '/build/reproducible-path/milib-2.2.0+dfsg' dh_auto_clean # Clearing the build.gradle file we provide rm build.gradle rm: cannot remove 'build.gradle': No such file or directory make[1]: [debian/rules:11: override_dh_auto_clean] Error 1 (ignored) make[1]: Leaving directory '/build/reproducible-path/milib-2.2.0+dfsg' jh_clean dh_clean debian/rules binary dh binary --with javahelper --with maven_repo_helper dh_update_autotools_config dh_autoreconf debian/rules override_dh_auto_configure make[1]: Entering directory '/build/reproducible-path/milib-2.2.0+dfsg' # Adding the upstream version number (without +dfsg) to the build.gradle file # we got by patching build.gradle.kts sed "s/\(^group.*\)/\1\nversion = '2.2.0+dfsg'/ ; s/\+dfsg[[:digit:]]*//" build.gradle.kts > build.gradle dh_auto_configure make[1]: Leaving directory '/build/reproducible-path/milib-2.2.0+dfsg' jh_linkjars dh_auto_build mkdir -p .gradle/init.d cp /usr/share/gradle-debian-helper/init.gradle .gradle/init.d/ gradle --info --console plain --offline --stacktrace --no-daemon --refresh-dependencies --gradle-user-home .gradle -Duser.home=. -Duser.name=debian -Ddebian.package=milib -Dfile.encoding=UTF-8 --parallel --max-workers=12 jar openjdk version "17.0.10" 2024-01-16 OpenJDK Runtime Environment (build 17.0.10+7-Debian-1) OpenJDK 64-Bit Server VM (build 17.0.10+7-Debian-1, mixed mode, sharing) Initialized native services in: /build/reproducible-path/milib-2.2.0+dfsg/.gradle/native To honour the JVM settings for this build a new JVM will be forked. Please consider using the daemon: https://docs.gradle.org/4.4.1/userguide/gradle_daemon.html. Starting process 'Gradle build daemon'. Working directory: /build/reproducible-path/milib-2.2.0+dfsg/.gradle/daemon/4.4.1 Command: /usr/lib/jvm/java-17-openjdk-arm64/bin/java --add-opens java.base/java.lang=ALL-UNNAMED -Xbootclasspath/a:/usr/share/java/gradle-helper-hook.jar:/usr/share/java/maven-repo-helper.jar -Dfile.encoding=UTF-8 -Duser.country=US -Duser.language=en -Duser.variant -cp /usr/share/gradle/lib/gradle-launcher-4.4.1.jar org.gradle.launcher.daemon.bootstrap.GradleDaemon 4.4.1 Successfully started process 'Gradle build daemon' An attempt to start the daemon took 3.758 secs. The client will now receive all logging from the daemon (pid: 1484867). The daemon log file: /build/reproducible-path/milib-2.2.0+dfsg/.gradle/daemon/4.4.1/daemon-1484867.out.log Daemon will be stopped at the end of the build stopping after processing Closing daemon's stdin at end of input. The daemon will no longer process any standard input. Using 12 worker leases. Creating new cache for fileHashes, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/caches/4.4.1/fileHashes/fileHashes.bin, access org.gradle.cache.internal.DefaultCacheAccess@1d3ef73c Creating new cache for resourceHashesCache, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/caches/4.4.1/fileHashes/resourceHashesCache.bin, access org.gradle.cache.internal.DefaultCacheAccess@1d3ef73c Creating new cache for fileHashes, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/4.4.1/fileHashes/fileHashes.bin, access org.gradle.cache.internal.DefaultCacheAccess@45e6513c Starting Build Compiling initialization script '/build/reproducible-path/milib-2.2.0+dfsg/.gradle/init.d/init.gradle' using SubsetScriptTransformer. Creating new cache for metadata-1.1/results, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/caches/transforms-1/metadata-1.1/results.bin, access org.gradle.cache.internal.DefaultCacheAccess@55ffd08c Compiling initialization script '/build/reproducible-path/milib-2.2.0+dfsg/.gradle/init.d/init.gradle' using BuildScriptTransformer. Settings evaluated using settings file '/build/reproducible-path/milib-2.2.0+dfsg/settings.gradle'. Settings file not found (/build/reproducible-path/milib-2.2.0+dfsg/settings.gradle) Root project name not defined in settings.gradle, defaulting to 'milib' instead of the name of the root directory 'milib-2.2.0+dfsg' Projects loaded. Root project using build file '/build/reproducible-path/milib-2.2.0+dfsg/build.gradle'. Included projects: [root project 'milib'] Keep-alive timer started Adding Debian repository to project 'milib' Parallel execution is an incubating feature. Evaluating root project 'milib' using build file '/build/reproducible-path/milib-2.2.0+dfsg/build.gradle'. Compiling build file '/build/reproducible-path/milib-2.2.0+dfsg/build.gradle' using SubsetScriptTransformer. Compiling build file '/build/reproducible-path/milib-2.2.0+dfsg/build.gradle' using BuildScriptTransformer. Adding Maven pom generation to project 'milib' Linking the generated javadoc to the system JDK API documentation All projects evaluated. Selected primary task 'jar' from project : Creating new cache for annotation-processors, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/4.4.1/fileContent/annotation-processors.bin, access org.gradle.cache.internal.DefaultCacheAccess@14ef0b40 Tasks to be executed: [task ':compileJava', task ':processResources', task ':classes', task ':debianMavenPom', task ':jar'] Creating new cache for resourceHashesCache, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/4.4.1/fileHashes/resourceHashesCache.bin, access org.gradle.cache.internal.DefaultCacheAccess@45e6513c Creating new cache for taskHistory, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/4.4.1/taskHistory/taskHistory.bin, access org.gradle.cache.internal.DefaultCacheAccess@2e143dc3 Creating new cache for outputFiles, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/buildOutputCleanup/outputFiles.bin, access org.gradle.cache.internal.DefaultCacheAccess@11f6f22c :compileJava (Thread[Task worker for ':',5,main]) started. :compileJava Putting task artifact state for task ':compileJava' into context took 0.012 secs. Creating new cache for metadata-2.36/module-metadata, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/caches/modules-2/metadata-2.36/module-metadata.bin, access org.gradle.cache.internal.DefaultCacheAccess@698ddae4 Loading the Maven rules... Replacing org.apache.commons:commons-math3:jar:3.6.1 -> org.apache.commons:commons-math3:jar:debian Replacing cc.redberry:pipe:jar:1.3.0 -> cc.redberry:pipe:jar:1.0.0-alpha0 Replacing com.fasterxml.jackson:jackson-bom:jar:2.14.0 -> com.fasterxml.jackson:jackson-bom:jar:debian Passing through com.fasterxml.jackson:jackson-parent:jar:debian Passing through com.fasterxml:oss-parent:jar:debian Passing through com.fasterxml.jackson.core:jackson-databind:jar:2.x Passing through com.fasterxml.jackson:jackson-base:jar:debian Passing through com.fasterxml.jackson:jackson-bom:jar:debian Replacing org.apache.commons:commons-compress:jar:1.21 -> org.apache.commons:commons-compress:jar:debian Passing through org.apache.commons:commons-parent:jar:debian Passing through org.apache:apache:jar:debian Replacing commons-io:commons-io:jar:2.11.0 -> commons-io:commons-io:jar:debian Replacing org.lz4:lz4-java:jar:1.8.0 -> org.lz4:lz4-java:jar:debian Replacing com.beust:jcommander:jar:1.72 -> com.beust:jcommander:jar:debian Replacing net.sf.trove4j:trove4j:jar:3.0.3 -> net.sf.trove4j:trove4j:jar:debian Replacing com.google.guava:guava:jar:31.1-jre -> com.google.guava:guava:jar:debian Passing through com.google.guava:guava-parent:jar:debian Passing through com.fasterxml.jackson.core:jackson-annotations:jar:2.x Passing through com.fasterxml.jackson.core:jackson-core:jar:2.x Passing through org.jsr-305:jsr305:jar:0.x Passing through com.google.errorprone:error_prone_annotations:jar:debian Passing through com.google.errorprone:error_prone_parent:jar:debian Malformed jar [jackson-databind-2.x.jar] found on classpath. Gradle 5.0 will no longer allow malformed jars on a classpath. at org.gradle.api.internal.changedetection.state.AbstractClasspathSnapshotBuilder$JarHasher.hashMalformedZip(AbstractClasspathSnapshotBuilder.java:120) at org.gradle.api.internal.changedetection.state.AbstractClasspathSnapshotBuilder$JarHasher.hashJarContents(AbstractClasspathSnapshotBuilder.java:115) at org.gradle.api.internal.changedetection.state.AbstractClasspathSnapshotBuilder$JarHasher.hash(AbstractClasspathSnapshotBuilder.java:93) at org.gradle.api.internal.changedetection.state.ResourceSnapshotterCacheService.hashFile(ResourceSnapshotterCacheService.java:44) at org.gradle.api.internal.changedetection.state.AbstractClasspathSnapshotBuilder.visitJar(AbstractClasspathSnapshotBuilder.java:83) at org.gradle.api.internal.changedetection.state.AbstractClasspathSnapshotBuilder.visitFileSnapshot(AbstractClasspathSnapshotBuilder.java:76) at org.gradle.api.internal.changedetection.state.AbstractFileCollectionSnapshotter$FileCollectionVisitorImpl.visitCollection(AbstractFileCollectionSnapshotter.java:77) at org.gradle.api.internal.file.AbstractFileCollection.visitRootElements(AbstractFileCollection.java:234) at org.gradle.api.internal.file.CompositeFileCollection.visitRootElements(CompositeFileCollection.java:185) at org.gradle.api.internal.changedetection.state.AbstractFileCollectionSnapshotter.snapshot(AbstractFileCollectionSnapshotter.java:53) at org.gradle.api.internal.changedetection.state.DefaultCompileClasspathSnapshotter.snapshot(DefaultCompileClasspathSnapshotter.java:38) at org.gradle.api.internal.changedetection.state.CacheBackedTaskHistoryRepository.snapshotTaskFiles(CacheBackedTaskHistoryRepository.java:331) at org.gradle.api.internal.changedetection.state.CacheBackedTaskHistoryRepository.createExecution(CacheBackedTaskHistoryRepository.java:154) at org.gradle.api.internal.changedetection.state.CacheBackedTaskHistoryRepository.access$100(CacheBackedTaskHistoryRepository.java:61) at org.gradle.api.internal.changedetection.state.CacheBackedTaskHistoryRepository$1.getCurrentExecution(CacheBackedTaskHistoryRepository.java:114) at org.gradle.api.internal.changedetection.changes.DefaultTaskArtifactStateRepository$TaskArtifactStateImpl.getStates(DefaultTaskArtifactStateRepository.java:201) at org.gradle.api.internal.changedetection.changes.DefaultTaskArtifactStateRepository$TaskArtifactStateImpl.isUpToDate(DefaultTaskArtifactStateRepository.java:86) at org.gradle.api.internal.tasks.execution.SkipUpToDateTaskExecuter.execute(SkipUpToDateTaskExecuter.java:53) at org.gradle.api.internal.tasks.execution.ResolveTaskOutputCachingStateExecuter.execute(ResolveTaskOutputCachingStateExecuter.java:54) at org.gradle.api.internal.tasks.execution.ValidatingTaskExecuter.execute(ValidatingTaskExecuter.java:60) at org.gradle.api.internal.tasks.execution.SkipEmptySourceFilesTaskExecuter.execute(SkipEmptySourceFilesTaskExecuter.java:97) at org.gradle.api.internal.tasks.execution.CleanupStaleOutputsExecuter.execute(CleanupStaleOutputsExecuter.java:87) at org.gradle.api.internal.tasks.execution.ResolveTaskArtifactStateTaskExecuter.execute(ResolveTaskArtifactStateTaskExecuter.java:52) at org.gradle.api.internal.tasks.execution.SkipTaskWithNoActionsExecuter.execute(SkipTaskWithNoActionsExecuter.java:52) at org.gradle.api.internal.tasks.execution.SkipOnlyIfTaskExecuter.execute(SkipOnlyIfTaskExecuter.java:54) at org.gradle.api.internal.tasks.execution.ExecuteAtMostOnceTaskExecuter.execute(ExecuteAtMostOnceTaskExecuter.java:43) at org.gradle.api.internal.tasks.execution.CatchExceptionTaskExecuter.execute(CatchExceptionTaskExecuter.java:34) at org.gradle.execution.taskgraph.DefaultTaskGraphExecuter$EventFiringTaskWorker$1.run(DefaultTaskGraphExecuter.java:248) at org.gradle.internal.progress.DefaultBuildOperationExecutor$RunnableBuildOperationWorker.execute(DefaultBuildOperationExecutor.java:336) at org.gradle.internal.progress.DefaultBuildOperationExecutor$RunnableBuildOperationWorker.execute(DefaultBuildOperationExecutor.java:328) at org.gradle.internal.progress.DefaultBuildOperationExecutor.execute(DefaultBuildOperationExecutor.java:199) at org.gradle.internal.progress.DefaultBuildOperationExecutor.run(DefaultBuildOperationExecutor.java:110) at org.gradle.execution.taskgraph.DefaultTaskGraphExecuter$EventFiringTaskWorker.execute(DefaultTaskGraphExecuter.java:241) at org.gradle.execution.taskgraph.DefaultTaskGraphExecuter$EventFiringTaskWorker.execute(DefaultTaskGraphExecuter.java:230) at org.gradle.execution.taskgraph.DefaultTaskPlanExecutor$TaskExecutorWorker.processTask(DefaultTaskPlanExecutor.java:123) at org.gradle.execution.taskgraph.DefaultTaskPlanExecutor$TaskExecutorWorker.access$200(DefaultTaskPlanExecutor.java:79) at org.gradle.execution.taskgraph.DefaultTaskPlanExecutor$TaskExecutorWorker$1.execute(DefaultTaskPlanExecutor.java:104) at org.gradle.execution.taskgraph.DefaultTaskPlanExecutor$TaskExecutorWorker$1.execute(DefaultTaskPlanExecutor.java:98) at org.gradle.execution.taskgraph.DefaultTaskExecutionPlan.execute(DefaultTaskExecutionPlan.java:626) at org.gradle.execution.taskgraph.DefaultTaskExecutionPlan.executeWithTask(DefaultTaskExecutionPlan.java:581) at org.gradle.execution.taskgraph.DefaultTaskPlanExecutor$TaskExecutorWorker.run(DefaultTaskPlanExecutor.java:98) at org.gradle.internal.concurrent.ExecutorPolicy$CatchAndRecordFailures.onExecute(ExecutorPolicy.java:63) at org.gradle.internal.concurrent.ManagedExecutorImpl$1.run(ManagedExecutorImpl.java:46) at java.base/java.util.concurrent.ThreadPoolExecutor.runWorker(ThreadPoolExecutor.java:1136) at java.base/java.util.concurrent.ThreadPoolExecutor$Worker.run(ThreadPoolExecutor.java:635) at org.gradle.internal.concurrent.ThreadFactoryImpl$ManagedThreadRunnable.run(ThreadFactoryImpl.java:55) at java.base/java.lang.Thread.run(Thread.java:840) Up-to-date check for task ':compileJava' took 7.009 secs. It is not up-to-date because: No history is available. All input files are considered out-of-date for incremental task ':compileJava'. Compiling with JDK Java compiler API. Note: Some input files use or override a deprecated API. Note: Recompile with -Xlint:deprecation for details. Note: Some input files use unchecked or unsafe operations. Note: Recompile with -Xlint:unchecked for details. :compileJava (Thread[Task worker for ':',5,main]) completed. Took 29.778 secs. :processResources (Thread[Task worker for ':',5,main]) started. :processResources Putting task artifact state for task ':processResources' into context took 0.0 secs. Up-to-date check for task ':processResources' took 0.046 secs. It is not up-to-date because: No history is available. :processResources (Thread[Task worker for ':',5,main]) completed. Took 0.131 secs. :classes (Thread[Task worker for ':',5,main]) started. :classes Skipping task ':classes' as it has no actions. :classes (Thread[Task worker for ':',5,main]) completed. Took 0.0 secs. :debianMavenPom (Thread[Task worker for ':',5,main]) started. :debianMavenPom Putting task artifact state for task ':debianMavenPom' into context took 0.0 secs. Up-to-date check for task ':debianMavenPom' took 0.0 secs. It is not up-to-date because: No history is available. Generating pom file /build/reproducible-path/milib-2.2.0+dfsg/build/debian/milib.pom :debianMavenPom (Thread[Task worker for ':',5,main]) completed. Took 0.306 secs. :jar (Thread[Task worker for ':',5,main]) started. :jar Putting task artifact state for task ':jar' into context took 0.0 secs. Up-to-date check for task ':jar' took 0.078 secs. It is not up-to-date because: No history is available. :jar (Thread[Task worker for ':',5,main]) completed. Took 0.848 secs. BUILD SUCCESSFUL in 47s 4 actionable tasks: 4 executed dh_auto_test mkdir -p .gradle/init.d cp /usr/share/gradle-debian-helper/init.gradle .gradle/init.d/ gradle --info --console plain --offline --stacktrace --no-daemon --refresh-dependencies --gradle-user-home .gradle -Duser.home=. -Duser.name=debian -Ddebian.package=milib -Dfile.encoding=UTF-8 --parallel --max-workers=12 test openjdk version "17.0.10" 2024-01-16 OpenJDK Runtime Environment (build 17.0.10+7-Debian-1) OpenJDK 64-Bit Server VM (build 17.0.10+7-Debian-1, mixed mode, sharing) Initialized native services in: /build/reproducible-path/milib-2.2.0+dfsg/.gradle/native To honour the JVM settings for this build a new JVM will be forked. Please consider using the daemon: https://docs.gradle.org/4.4.1/userguide/gradle_daemon.html. Starting process 'Gradle build daemon'. Working directory: /build/reproducible-path/milib-2.2.0+dfsg/.gradle/daemon/4.4.1 Command: /usr/lib/jvm/java-17-openjdk-arm64/bin/java --add-opens java.base/java.lang=ALL-UNNAMED -Xbootclasspath/a:/usr/share/java/gradle-helper-hook.jar:/usr/share/java/maven-repo-helper.jar -Dfile.encoding=UTF-8 -Duser.country=US -Duser.language=en -Duser.variant -cp /usr/share/gradle/lib/gradle-launcher-4.4.1.jar org.gradle.launcher.daemon.bootstrap.GradleDaemon 4.4.1 Successfully started process 'Gradle build daemon' An attempt to start the daemon took 4.069 secs. The client will now receive all logging from the daemon (pid: 1492228). The daemon log file: /build/reproducible-path/milib-2.2.0+dfsg/.gradle/daemon/4.4.1/daemon-1492228.out.log Daemon will be stopped at the end of the build stopping after processing Closing daemon's stdin at end of input. The daemon will no longer process any standard input. Using 12 worker leases. Creating new cache for fileHashes, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/caches/4.4.1/fileHashes/fileHashes.bin, access org.gradle.cache.internal.DefaultCacheAccess@64f442d7 Creating new cache for resourceHashesCache, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/caches/4.4.1/fileHashes/resourceHashesCache.bin, access org.gradle.cache.internal.DefaultCacheAccess@64f442d7 Creating new cache for fileHashes, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/4.4.1/fileHashes/fileHashes.bin, access org.gradle.cache.internal.DefaultCacheAccess@2877a290 Starting Build Creating new cache for metadata-1.1/results, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/caches/transforms-1/metadata-1.1/results.bin, access org.gradle.cache.internal.DefaultCacheAccess@1fd96408 Settings evaluated using settings file '/build/reproducible-path/milib-2.2.0+dfsg/settings.gradle'. Settings file not found (/build/reproducible-path/milib-2.2.0+dfsg/settings.gradle) Root project name not defined in settings.gradle, defaulting to 'milib' instead of the name of the root directory 'milib-2.2.0+dfsg' Projects loaded. Root project using build file '/build/reproducible-path/milib-2.2.0+dfsg/build.gradle'. Included projects: [root project 'milib'] Keep-alive timer started Adding Debian repository to project 'milib' Parallel execution is an incubating feature. Evaluating root project 'milib' using build file '/build/reproducible-path/milib-2.2.0+dfsg/build.gradle'. Adding Maven pom generation to project 'milib' Linking the generated javadoc to the system JDK API documentation All projects evaluated. Selected primary task 'test' from project : Creating new cache for annotation-processors, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/4.4.1/fileContent/annotation-processors.bin, access org.gradle.cache.internal.DefaultCacheAccess@25bebf75 Tasks to be executed: [task ':compileJava', task ':processResources', task ':classes', task ':compileTestJava', task ':processTestResources', task ':testClasses', task ':test'] Creating new cache for resourceHashesCache, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/4.4.1/fileHashes/resourceHashesCache.bin, access org.gradle.cache.internal.DefaultCacheAccess@2877a290 Creating new cache for taskHistory, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/4.4.1/taskHistory/taskHistory.bin, access org.gradle.cache.internal.DefaultCacheAccess@1dd5e269 Creating new cache for outputFiles, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/buildOutputCleanup/outputFiles.bin, access org.gradle.cache.internal.DefaultCacheAccess@618c0078 :compileJava (Thread[Task worker for ':',5,main]) started. :compileJava Putting task artifact state for task ':compileJava' into context took 0.019 secs. Creating new cache for metadata-2.36/module-metadata, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/caches/modules-2/metadata-2.36/module-metadata.bin, access org.gradle.cache.internal.DefaultCacheAccess@6f710262 Loading the Maven rules... Replacing org.apache.commons:commons-math3:jar:3.6.1 -> org.apache.commons:commons-math3:jar:debian Replacing cc.redberry:pipe:jar:1.3.0 -> cc.redberry:pipe:jar:1.0.0-alpha0 Replacing com.fasterxml.jackson:jackson-bom:jar:2.14.0 -> com.fasterxml.jackson:jackson-bom:jar:debian Passing through com.fasterxml.jackson:jackson-parent:jar:debian Passing through com.fasterxml:oss-parent:jar:debian Passing through com.fasterxml.jackson.core:jackson-databind:jar:2.x Passing through com.fasterxml.jackson:jackson-base:jar:debian Passing through com.fasterxml.jackson:jackson-bom:jar:debian Replacing org.apache.commons:commons-compress:jar:1.21 -> org.apache.commons:commons-compress:jar:debian Passing through org.apache.commons:commons-parent:jar:debian Passing through org.apache:apache:jar:debian Replacing commons-io:commons-io:jar:2.11.0 -> commons-io:commons-io:jar:debian Replacing org.lz4:lz4-java:jar:1.8.0 -> org.lz4:lz4-java:jar:debian Replacing com.beust:jcommander:jar:1.72 -> com.beust:jcommander:jar:debian Replacing net.sf.trove4j:trove4j:jar:3.0.3 -> net.sf.trove4j:trove4j:jar:debian Replacing com.google.guava:guava:jar:31.1-jre -> com.google.guava:guava:jar:debian Passing through com.google.guava:guava-parent:jar:debian Passing through com.fasterxml.jackson.core:jackson-annotations:jar:2.x Passing through com.fasterxml.jackson.core:jackson-core:jar:2.x Passing through org.jsr-305:jsr305:jar:0.x Passing through com.google.errorprone:error_prone_annotations:jar:debian Passing through com.google.errorprone:error_prone_parent:jar:debian Skipping task ':compileJava' as it is up-to-date (took 2.295 secs). :compileJava UP-TO-DATE :compileJava (Thread[Task worker for ':',5,main]) completed. Took 2.401 secs. :processResources (Thread[Task worker for ':',5,main]) started. :processResources Putting task artifact state for task ':processResources' into context took 0.0 secs. Skipping task ':processResources' as it is up-to-date (took 0.021 secs). :processResources UP-TO-DATE :processResources (Thread[Task worker for ':',5,main]) completed. Took 0.029 secs. :classes (Thread[Task worker for ':',5,main]) started. :classes Skipping task ':classes' as it has no actions. :classes UP-TO-DATE :classes (Thread[Task worker for ':',5,main]) completed. Took 0.008 secs. :compileTestJava (Thread[Task worker for ':',5,main]) started. :compileTestJava Putting task artifact state for task ':compileTestJava' into context took 0.0 secs. Replacing junit:junit:jar:4.13.2 -> junit:junit:jar:4.x Replacing org.mockito:mockito-all:jar:1.10.19 -> org.mockito:mockito-all:jar:debian org.mockito:mockito-all:debian is relocated to org.mockito:mockito-core:debian. Please update your dependencies. Passing through org.hamcrest:hamcrest:jar:debian Passing through org.mockito:mockito-core:jar:debian Passing through net.bytebuddy:byte-buddy:jar:debian Passing through net.bytebuddy:byte-buddy-parent:jar:debian Passing through net.bytebuddy:byte-buddy-agent:jar:debian Passing through org.objenesis:objenesis:jar:debian Passing through org.objenesis:objenesis-parent:jar:debian Passing through net.bytebuddy:byte-buddy-dep:jar:debian Passing through org.ow2.asm:asm:jar:debian Passing through org.ow2.asm:asm-commons:jar:debian Up-to-date check for task ':compileTestJava' took 5.05 secs. It is not up-to-date because: No history is available. All input files are considered out-of-date for incremental task ':compileTestJava'. Compiling with JDK Java compiler API. Note: Some input files use or override a deprecated API. Note: Recompile with -Xlint:deprecation for details. Note: Some input files use unchecked or unsafe operations. Note: Recompile with -Xlint:unchecked for details. :compileTestJava (Thread[Task worker for ':',5,main]) completed. Took 16.95 secs. :processTestResources (Thread[Task worker for ':',5,main]) started. :processTestResources Putting task artifact state for task ':processTestResources' into context took 0.0 secs. Up-to-date check for task ':processTestResources' took 0.016 secs. It is not up-to-date because: No history is available. :processTestResources (Thread[Task worker for ':',5,main]) completed. Took 0.098 secs. :testClasses (Thread[Task worker for ':',5,main]) started. :testClasses Skipping task ':testClasses' as it has no actions. :testClasses (Thread[Task worker for ':',5,main]) completed. Took 0.0 secs. :test (Thread[Task worker for ':',5,main]) started. :test Putting task artifact state for task ':test' into context took 0.0 secs. Up-to-date check for task ':test' took 1.52 secs. It is not up-to-date because: No history is available. Starting process 'Gradle Test Executor 1'. Working directory: /build/reproducible-path/milib-2.2.0+dfsg Command: /usr/lib/jvm/java-17-openjdk-arm64/bin/java -Dorg.gradle.native=false @/tmp/gradle-worker-classpath4854001954492065124txt -Xms1024m -Xmx2048m -Dfile.encoding=UTF-8 -Duser.country=US -Duser.language=en -Duser.variant -ea worker.org.gradle.process.internal.worker.GradleWorkerMain 'Gradle Test Executor 1' Successfully started process 'Gradle Test Executor 1' Gradle Test Executor 1 started executing tests. com.milaboratory.test.TestUtil > testLT STANDARD_OUT Short tests. No system env properties. com.milaboratory.primitivio.blocks.PrimitivOBlocksTest > benchmark1 SKIPPED com.milaboratory.primitivio.blocks.PrimitivOBlocksTest > test1 STANDARD_OUT ================== High compression: false Concurrency: 4 File size: 5608636 Write time: 688.57ms O. Stats: Wall clock time: 690.36ms Total CPU time: 702.06ms User wait time: 501.52ms Serialization time: 421.07ms (59.98%) Checksum calculation time: 204.02ms (29.06%) Compression time: 23.6ms (3.36%) Total IO delay: 251.35ms Concurrency overhead: 180.27ms Uncompressed size: 18.44MiB (~2.08KiB per object) Output size: 5.35MiB (~617B per object; compression = 29.01%) IO speed: 21.31MiB/s Concurrency adjusted uncompressed speed: 44.11MiB/s Actual uncompressed speed: 26.72MiB/s Actual speed: 7.75MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 617B Blocks: 62 (~88.34KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 1: Wall clock time: 325.95ms Total CPU time: 207.04ms Serialization time: 155.1ms (74.92%) Checksum calculation time: 11.2ms (5.41%) Compression time: 36.66ms (17.71%) Total IO delay: 184.18ms Input size: 5.35MiB Decompressed size: 18.44MiB (compression = 29.01%) IO speed: 29.07MiB/s Concurrency adjusted uncompressed speed: 190.07MiB/s Actual uncompressed speed: 56.73MiB/s Actual speed: 16.46MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 617B Blocks: 62 (~88.34KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 2: Wall clock time: 577.48ms Total CPU time: 283.01ms Serialization time: 175.85ms (62.14%) Checksum calculation time: 16.39ms (5.79%) Compression time: 79.77ms (28.19%) Total IO delay: 365.22ms Input size: 10.7MiB Decompressed size: 36.87MiB (compression = 29.01%) IO speed: 29.31MiB/s Concurrency adjusted uncompressed speed: 227.62MiB/s Actual uncompressed speed: 63.91MiB/s Actual speed: 18.54MiB/s Objects: 18158 Average object size uncompressed: 2.08KiB Average object size compressed: 617B Blocks: 124 (~88.34KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 ================== High compression: false Concurrency: 4 File size: 5588298 Write time: 213.58ms O. Stats: Wall clock time: 214.04ms Total CPU time: 147.45ms User wait time: 189.72ms Serialization time: 43.4ms (29.43%) Checksum calculation time: 5.15ms (3.49%) Compression time: 89.83ms (60.92%) Total IO delay: 100.53ms Concurrency overhead: 36.72ms Uncompressed size: 18.44MiB (~2.08KiB per object) Output size: 5.33MiB (~615B per object; compression = 28.91%) IO speed: 53.29MiB/s Concurrency adjusted uncompressed speed: 188.13MiB/s Actual uncompressed speed: 86.15MiB/s Actual speed: 24.9MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 615B Blocks: 20 (~272.87KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 1: Wall clock time: 147.62ms Total CPU time: 97.29ms Serialization time: 38.45ms (39.52%) Checksum calculation time: 5.04ms (5.18%) Compression time: 52.84ms (54.32%) Total IO delay: 94.88ms Input size: 5.33MiB Decompressed size: 18.44MiB (compression = 28.91%) IO speed: 56.7MiB/s Concurrency adjusted uncompressed speed: 384.1MiB/s Actual uncompressed speed: 125.42MiB/s Actual speed: 36.25MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 615B Blocks: 20 (~272.87KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 2: Wall clock time: 351.5ms Total CPU time: 173.66ms Serialization time: 63.63ms (36.64%) Checksum calculation time: 18.06ms (10.4%) Compression time: 86.13ms (49.6%) Total IO delay: 208.68ms Input size: 10.66MiB Decompressed size: 36.87MiB (compression = 28.91%) IO speed: 51.24MiB/s Concurrency adjusted uncompressed speed: 388.15MiB/s Actual uncompressed speed: 105.05MiB/s Actual speed: 30.37MiB/s Objects: 18158 Average object size uncompressed: 2.08KiB Average object size compressed: 615B Blocks: 40 (~272.87KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 ================== High compression: false Concurrency: 1 File size: 5608636 Write time: 265.82ms O. Stats: Wall clock time: 270.63ms Total CPU time: 53.31ms User wait time: 251.36ms Serialization time: 21.25ms (39.86%) Checksum calculation time: 5.03ms (9.44%) Compression time: 24.14ms (45.27%) Total IO delay: 143.06ms Concurrency overhead: 24.66ms Uncompressed size: 18.44MiB (~2.08KiB per object) Output size: 5.35MiB (~617B per object; compression = 29.01%) IO speed: 37.4MiB/s Concurrency adjusted uncompressed speed: 83.42MiB/s Actual uncompressed speed: 68.28MiB/s Actual speed: 19.81MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 617B Blocks: 62 (~88.34KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Checksum ok! I. Stats 1: Wall clock time: 141.4ms Total CPU time: 68.05ms Serialization time: 22.93ms (33.7%) Checksum calculation time: 4.94ms (7.25%) Compression time: 36.16ms (53.13%) Total IO delay: 136.75ms Input size: 5.35MiB Decompressed size: 18.44MiB (compression = 29.01%) IO speed: 39.33MiB/s Concurrency adjusted uncompressed speed: 90.38MiB/s Actual uncompressed speed: 130.76MiB/s Actual speed: 37.93MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 617B Blocks: 62 (~88.34KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 2: Wall clock time: 283.58ms Total CPU time: 142.72ms Serialization time: 50.34ms (35.27%) Checksum calculation time: 9.94ms (6.97%) Compression time: 74.09ms (51.91%) Total IO delay: 255.18ms Input size: 10.7MiB Decompressed size: 36.87MiB (compression = 29.01%) IO speed: 41.95MiB/s Concurrency adjusted uncompressed speed: 92.88MiB/s Actual uncompressed speed: 130.3MiB/s Actual speed: 37.8MiB/s Objects: 18158 Average object size uncompressed: 2.08KiB Average object size compressed: 617B Blocks: 124 (~88.34KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 ================== High compression: false Concurrency: 1 File size: 5588298 Write time: 136.33ms O. Stats: Wall clock time: 138.19ms Total CPU time: 90.02ms User wait time: 118.71ms Serialization time: 43.14ms (47.93%) Checksum calculation time: 6.35ms (7.05%) Compression time: 34.57ms (38.41%) Total IO delay: 28.37ms Concurrency overhead: 2.3ms Uncompressed size: 18.44MiB (~2.08KiB per object) Output size: 5.33MiB (~615B per object; compression = 28.91%) IO speed: 190.34MiB/s Concurrency adjusted uncompressed speed: 153.64MiB/s Actual uncompressed speed: 133.6MiB/s Actual speed: 38.62MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 615B Blocks: 20 (~272.87KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Checksum ok! I. Stats 1: Wall clock time: 143.04ms Total CPU time: 95.87ms Serialization time: 53.35ms (55.65%) Checksum calculation time: 4.94ms (5.15%) Compression time: 36.96ms (38.56%) Total IO delay: 105.82ms Input size: 5.33MiB Decompressed size: 18.44MiB (compression = 28.91%) IO speed: 50.76MiB/s Concurrency adjusted uncompressed speed: 91.73MiB/s Actual uncompressed speed: 128.93MiB/s Actual speed: 37.27MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 615B Blocks: 20 (~272.87KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 2: Wall clock time: 383.71ms Total CPU time: 283.49ms Serialization time: 161.87ms (57.1%) Checksum calculation time: 9.91ms (3.49%) Compression time: 110.41ms (38.95%) Total IO delay: 202.35ms Input size: 10.66MiB Decompressed size: 36.87MiB (compression = 28.91%) IO speed: 52.77MiB/s Concurrency adjusted uncompressed speed: 76.03MiB/s Actual uncompressed speed: 96.28MiB/s Actual speed: 27.83MiB/s Objects: 18158 Average object size uncompressed: 2.08KiB Average object size compressed: 615B Blocks: 40 (~272.87KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Pending / IO / Serde: 2 / 0 / 1 ================== High compression: true Concurrency: 4 File size: 4156299 Write time: 2.02s O. Stats: Wall clock time: 2.02s Total CPU time: 4.83s User wait time: 1.9s Serialization time: 33.75ms (0.7%) Checksum calculation time: 5.02ms (0.1%) Compression time: 4.78s (99.04%) Total IO delay: 228.34ms Concurrency overhead: 107.73ms Uncompressed size: 18.44MiB (~2.08KiB per object) Output size: 3.96MiB (~457B per object; compression = 21.5%) IO speed: 17.38MiB/s Concurrency adjusted uncompressed speed: 13.45MiB/s Actual uncompressed speed: 9.14MiB/s Actual speed: 1.97MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 457B Blocks: 62 (~65.47KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 1: Wall clock time: 137.9ms Total CPU time: 57.88ms Serialization time: 19.37ms (33.46%) Checksum calculation time: 4.93ms (8.51%) Compression time: 31.59ms (54.58%) Total IO delay: 126.34ms Input size: 3.96MiB Decompressed size: 18.44MiB (compression = 21.5%) IO speed: 31.46MiB/s Concurrency adjusted uncompressed speed: 400.8MiB/s Actual uncompressed speed: 134.58MiB/s Actual speed: 28.93MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 457B Blocks: 62 (~65.47KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 2: Wall clock time: 271.36ms Total CPU time: 106.26ms Serialization time: 32.56ms (30.64%) Checksum calculation time: 9.93ms (9.34%) Compression time: 60.43ms (56.87%) Total IO delay: 240.44ms Input size: 7.93MiB Decompressed size: 36.87MiB (compression = 21.5%) IO speed: 33.03MiB/s Concurrency adjusted uncompressed speed: 428.77MiB/s Actual uncompressed speed: 136.07MiB/s Actual speed: 29.25MiB/s Objects: 18158 Average object size uncompressed: 2.08KiB Average object size compressed: 457B Blocks: 124 (~65.47KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Pending / IO / Serde: 2 / 0 / 2 ================== High compression: true Concurrency: 4 File size: 4098671 Write time: 3.93s O. Stats: Wall clock time: 3.93s Total CPU time: 6.48s User wait time: 3.6s Serialization time: 19.73ms (0.3%) Checksum calculation time: 4.93ms (0.08%) Compression time: 6.46s (99.59%) Total IO delay: 96.61ms Concurrency overhead: 30.44ms Uncompressed size: 18.44MiB (~2.08KiB per object) Output size: 3.91MiB (~451B per object; compression = 21.2%) IO speed: 40.72MiB/s Concurrency adjusted uncompressed speed: 11.01MiB/s Actual uncompressed speed: 4.69MiB/s Actual speed: 1018.47KiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 451B Blocks: 20 (~200.13KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Pending / IO / Serde: 2 / 1 / 0 I. Stats 1: Wall clock time: 146.47ms Total CPU time: 47.28ms Serialization time: 10.79ms (22.82%) Checksum calculation time: 5.16ms (10.92%) Compression time: 30.53ms (64.58%) Total IO delay: 139.31ms Input size: 3.91MiB Decompressed size: 18.44MiB (compression = 21.2%) IO speed: 28.12MiB/s Concurrency adjusted uncompressed speed: 400.8MiB/s Actual uncompressed speed: 126.28MiB/s Actual speed: 26.77MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 451B Blocks: 20 (~200.13KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 2: Wall clock time: 362.97ms Total CPU time: 104.1ms Serialization time: 33.39ms (32.07%) Checksum calculation time: 10.1ms (9.7%) Compression time: 59.2ms (56.86%) Total IO delay: 287.33ms Input size: 7.82MiB Decompressed size: 36.87MiB (compression = 21.2%) IO speed: 27.24MiB/s Concurrency adjusted uncompressed speed: 380.14MiB/s Actual uncompressed speed: 101.86MiB/s Actual speed: 21.6MiB/s Objects: 18158 Average object size uncompressed: 2.08KiB Average object size compressed: 451B Blocks: 40 (~200.13KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 ================== High compression: true Concurrency: 1 File size: 4156299 Write time: 4.8s O. Stats: Wall clock time: 4.8s Total CPU time: 4.72s User wait time: 4.79s Serialization time: 19.5ms (0.41%) Checksum calculation time: 5.01ms (0.11%) Compression time: 4.69s (99.44%) Total IO delay: 43.43ms Concurrency overhead: 10.85ms Uncompressed size: 18.44MiB (~2.08KiB per object) Output size: 3.96MiB (~457B per object; compression = 21.5%) IO speed: 92.18MiB/s Concurrency adjusted uncompressed speed: 3.86MiB/s Actual uncompressed speed: 3.84MiB/s Actual speed: 845.07KiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 457B Blocks: 62 (~65.47KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Checksum ok! I. Stats 1: Wall clock time: 94.13ms Total CPU time: 46.87ms Serialization time: 11.9ms (25.39%) Checksum calculation time: 4.97ms (10.6%) Compression time: 28.97ms (61.81%) Total IO delay: 85.78ms Input size: 3.96MiB Decompressed size: 18.44MiB (compression = 21.5%) IO speed: 46.63MiB/s Concurrency adjusted uncompressed speed: 139.67MiB/s Actual uncompressed speed: 196.14MiB/s Actual speed: 42.17MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 457B Blocks: 62 (~65.47KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 2: Wall clock time: 205.29ms Total CPU time: 93.9ms Serialization time: 23.86ms (25.41%) Checksum calculation time: 9.96ms (10.6%) Compression time: 58.03ms (61.8%) Total IO delay: 174.02ms Input size: 7.93MiB Decompressed size: 36.87MiB (compression = 21.5%) IO speed: 45.56MiB/s Concurrency adjusted uncompressed speed: 138.1MiB/s Actual uncompressed speed: 179.87MiB/s Actual speed: 38.67MiB/s Objects: 18158 Average object size uncompressed: 2.08KiB Average object size compressed: 457B Blocks: 124 (~65.47KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 ================== High compression: true Concurrency: 1 File size: 4098671 Write time: 4.46s O. Stats: Wall clock time: 4.46s Total CPU time: 4.39s User wait time: 4.41s Serialization time: 20.63ms (0.47%) Checksum calculation time: 5.01ms (0.11%) Compression time: 4.37s (99.37%) Total IO delay: 13.9ms Concurrency overhead: 609.08us Uncompressed size: 18.44MiB (~2.08KiB per object) Output size: 3.91MiB (~451B per object; compression = 21.2%) IO speed: 300.68MiB/s Concurrency adjusted uncompressed speed: 4.18MiB/s Actual uncompressed speed: 4.14MiB/s Actual speed: 898.25KiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 451B Blocks: 20 (~200.13KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Checksum ok! I. Stats 1: Wall clock time: 167.58ms Total CPU time: 66.65ms Serialization time: 10.52ms (15.79%) Checksum calculation time: 25.06ms (37.6%) Compression time: 30.55ms (45.83%) Total IO delay: 142.91ms Input size: 3.91MiB Decompressed size: 18.44MiB (compression = 21.2%) IO speed: 27.53MiB/s Concurrency adjusted uncompressed speed: 88.21MiB/s Actual uncompressed speed: 110.4MiB/s Actual speed: 23.41MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 451B Blocks: 20 (~200.13KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 2: Wall clock time: 362.55ms Total CPU time: 130.08ms Serialization time: 20.84ms (16.02%) Checksum calculation time: 46.92ms (36.07%) Compression time: 61.13ms (46.99%) Total IO delay: 301.82ms Input size: 7.82MiB Decompressed size: 36.87MiB (compression = 21.2%) IO speed: 25.97MiB/s Concurrency adjusted uncompressed speed: 85.55MiB/s Actual uncompressed speed: 101.86MiB/s Actual speed: 21.6MiB/s Objects: 18158 Average object size uncompressed: 2.08KiB Average object size compressed: 451B Blocks: 40 (~200.13KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 com.milaboratory.primitivio.blocks.PrimitivOBlocksTest > bigBlocks STANDARD_OUT Pending / IO / Serde / Objs: 1 / 1 / 0 / 4000 Pending / IO / Serde / Objs: 1 / 1 / 2 / 8000 Pending / IO / Serde / Objs: 0 / 1 / 1 / 17000 O. Stats: Wall clock time: 7.16s Total CPU time: 7.7s User wait time: 44.88us Serialization time: 1.87s (24.32%) Checksum calculation time: 2.3s (29.82%) Compression time: 1.86s (24.19%) Total IO delay: 5.07s Concurrency overhead: 40.43ms Uncompressed size: 1.86GiB (~97.66KiB per object) Output size: 1.86GiB (~97.66KiB per object; compression = 100%) IO speed: 376.44MiB/s Concurrency adjusted uncompressed speed: 1.14GiB/s Actual uncompressed speed: 266.59MiB/s Actual speed: 266.59MiB/s Objects: 20000 Average object size uncompressed: 97.66KiB Average object size compressed: 97.66KiB Blocks: 20 (~95.37MiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 com.milaboratory.core.RangeTest > test23e14 STANDARD_OUT 1000001 1010100 1000111 1000011 1000010 com.milaboratory.core.alignment.AlignerCustomTest > testSemiLocal0 STANDARD_OUT 29.0 2 c----cccTTgaa---tgTtaGTa-----taacta--tct 27 0 cAGTTccc--gaaACCtgCta--aGCTCTtaactaCTtct 35 29.0 2 c----cccTTgaa---tgTtaGTa-----taacta--tct 27 0 cAGTTccc--gaaACCtgCta--aGCTCTtaactaCTtct 35 com.milaboratory.core.alignment.AlignerTest > testCalculateScore1 STANDARD_OUT 1.04us 1.10us 1.04us com.milaboratory.core.alignment.AlignmentHelperTest > test1 STANDARD_OUT 0 GAGGTGCAGCTGGTGGAGTCTGGGGGAGGC 29 |||||||||||||||||||||||||||||| 0 GAGGTGCAGCTGGTGGAGTCTGGGGGAGGC 29 30 TTGGT-ACAGCCTGGGGGGTCCCTGAGACT 58 |||| | |||||||||||||| |||||| 30 CTGGTCA-AGCCTGGGGGGTCCATGAGACA 58 59 CTCCTGTGCAGCCTCTGGATTCACCTTCAG 88 |||||||||||||||||||||| ||||||| 59 CTCCTGTGCAGCCTCTGGATTCCCCTTCAG 88 89 TAGC-TATAGCATGAACTGGGTCCGCCAGG 117 || | ||||||||||||||||||||||||| 89 TA-CTTATAGCATGAACTGGGTCCGCCAGG 117 118 CTCCAGGGAAGGGGCTGGAGTGGGTTTCAT 147 ||||||||||||||||||||||||| |||| 118 CTCCAGGGAAGGGGCTGGAGTGGGTCTCAT 147 148 ACATTAGTAGTAGTAGTAG-TACCATATAC 176 |||||||||| ||||||| || |||||| 148 CCATTAGTAGTGGTAGTAGTTA-CATATAT 176 177 TACGCAGACTCTGTGAAGGGCCGATTCACC 206 ||||||||||| |||||||||||||||||| 177 TACGCAGACTCCGTGAAGGGCCGATTCACC 206 207 ATCTCCAGAGACAATGCCAAGAACTCACTG 236 |||||||||||||| ||||||||||||||| 207 ATCTCCAGAGACAACGCCAAGAACTCACTG 236 237 TATCTGCAAATGAACAGCCTGAGAGACGAG 266 ||||||||||||||||||||||||| |||| 237 TATCTGCAAATGAACAGCCTGAGAGCCGAG 266 267 GACACGGCTGTGTATTACTGTGC 289 ||||||||||||||||||||||| 267 GACACGGCTGTGTATTACTGTGC 289 com.milaboratory.core.alignment.AlignmentIteratorTest > test1 STANDARD_OUT 0 -ATT-AGACA-- 7 ||| || | 0 AATTGGGA-ATT 10 I0AI3GSA3GDC6I8TI8T com.milaboratory.core.alignment.AlignmentTest > testInvert STANDARD_OUT 8 AGACACAGATACA 20 ||||||| ||||| 0 AGACACATATACA 12 0 AGACACATATACA 12 ||||||| ||||| 8 AGACACAGATACA 20 0 GATACATTAGACACAGATACA--- 20 ||||||| ||||| 0 --------AGACACATATACACAG 15 0 --------AGACACATATACACAG 15 ||||||| ||||| 0 GATACATTAGACACAGATACA--- 20 0 GATACATTAGA---CACAGATACA 20 ||||||||||| |||||||||| 5 GATACATTAGAGACCACAGATACA 28 5 GATACATTAGAGACCACAGATACA 28 ||||||||||| |||||||||| 0 GATACATTAGA---CACAGATACA 20 0 GATAC-----ATTAGA---CACAGATACA 20 ||||| |||||| |||||||||| 0 GATACGATACATTAGAGACCACAGATACA 28 0 GATACGATACATTAGAGACCACAGATACA 28 ||||| |||||| |||||||||| 0 GATAC-----ATTAGA---CACAGATACA 20 com.milaboratory.core.alignment.AlignmentTrimmerTest > testRandom1 STANDARD_OUT lTrimmed = 1714 rTrimmed = 1732 lTrimmed = 2760 rTrimmed = 2787 com.milaboratory.core.alignment.BandedAffineAlignerTest > test11 STANDARD_OUT 0 --------------------- -1 0 ATAAAAAAAAAAACGAGCTAG 20 0 --------------------- -1 0 ATAAAAAAAAAAACGAGCTAG 20 com.milaboratory.core.alignment.BandedAffineAlignerTest > test23 STANDARD_OUT 0 atgcggggatgc 11 0 atgcggggatgc 11 com.milaboratory.core.alignment.BandedAffineAlignerTest > test1 STANDARD_OUT 0 at-----------cgagctagTTTTTTTTTTT 20 0 atAAAAAAAAAAAcgagctag----------- 20 0 at-----------cgagctagTTTTTTTTTTT 20 0 atAAAAAAAAAAAcgagctag----------- 20 com.milaboratory.core.alignment.BandedAffineAlignerTest > test2 STANDARD_OUT 0 atgcGGGGatgc 11 0 atgcTA--atgc 9 0 atgcGGGGatgc----------- 11 0 atgcTA--atgcTTTTTTTTTTT 20 com.milaboratory.core.alignment.BandedAffineAlignerTest > test3 STANDARD_OUT 0 cgtaGGGGcgta 11 11 cgta--ATcgta 20 0 -----------cgtaGGGGcgta 11 0 TTTTTTTTTTTcgtaAT--cgta 20 com.milaboratory.core.alignment.BandedAffineAlignerTest > test4 STANDARD_OUT 0 atgcggggat-gTTTTT 15 0 atgcggggatAg----- 11 0 atgcggggat-gTTTTTTT 17 0 atgcggggatAg------- 11 com.milaboratory.core.alignment.BandedAffineAlignerTest > test5 STANDARD_OUT 7 g-taggggcgta 17 0 gAtaggggcgta 11 0 TTTTTTTg-taggggcgta 17 0 -------gAtaggggcgta 11 com.milaboratory.core.alignment.BandedAffineAlignerTest > test6 STANDARD_OUT 0 0 0 0 com.milaboratory.core.alignment.BandedAffineAlignerTest > semiGlobalLeft1 STANDARD_OUT 0 gCccTtgtgatgacccagactccagcctccgtgGAGgCaGctgtgggaggcacagtcaccatcaagtgccaggccagtcagagcattagcaacctcttaGCCTGGTATCAGCAGAAACCAGGGCAGCCTCCCAAGCTCCTGATCTATTATGCATCCGATCTGGcatctggggtctcatcaaggttcaaaggcagtggatctgggacagagtAcactctcaccatcagTggcgtgcagtgtgccgatgctgccacttactac 260 1 gAccCtgtgatgacccagactccagcctccgtgTCTgAaCctgtgggaggcacagtcaccatcaagtgccaggccagtcagagcattagcaacctctta-------------------------------------------------------------NNNcatctggggtctcatcaaggttcaaaggcagtggatctgggacagagtTcactctcaccatcagCggcgtgcagtgtgccgatgctgccacttactac 200 com.milaboratory.core.alignment.BandedLinearAlignerTest > testCase1 STANDARD_OUT GCGTGAAGACTGCAGGCATTGAGTACGTTACTAGTCCAGTGGGGCCCAACCGTAACATTGCGTGTGACTGGTTGCTTAGCGGGTGACGGCGTTTCAGGTTACGCCCTCTGTGCATCACCGATAGCGTTGTTTGAGCTTTCTAACGTCTCAAACCTGCTTGCGCCCTACGGTTTCTCTATATATACACGAAAGGGGCTGGTCGCAACCTCGCAATTCTATCCCTCCAACCTCCCTCGAATTTTT AAAGCGTGAAGACTTGCAGGCATTGGTACGTTATTAGTCCAGTGGGGCCACAACCGTAACATTGCGTGTGACTGGTGCTTAGCGGGTGACGGCGTTCAGGTTACGCCCTCTGTGCATCACCGATTAGCGTTGTCTGAGCTTTCTAACGTCTCAAACCTGCTTGCGCCCTACGGTTTCTCTATAGTATCACGAAAGGGTCTGGTCGCAACCTCGCAATTCTATCCCTCCAACCTCCCTTGAATTTTTCTA com.milaboratory.core.alignment.BandedLinearAlignerTest > testGlobal1 STANDARD_OUT 1 AATTGACA 8 |||||| 0 TATTGACT 7 com.milaboratory.core.alignment.BandedLinearAlignerTest > testGlobal2 STANDARD_OUT 1 AATTGACAG 9 |||||| | 0 TATTGAC-G 7 com.milaboratory.core.alignment.BandedLinearAlignerTest > testGlobal3 STANDARD_OUT 0 TATTGACT 7 |||||| 1 AATTGACA 8 com.milaboratory.core.alignment.BandedLinearAlignerTest > testGlobal4 STANDARD_OUT 0 TATTGAC-G 7 |||||| | 1 AATTGACAG 9 com.milaboratory.core.alignment.MultiAlignmentHelperTest > test1 STANDARD_OUT 8 AGACACAGATACA 20 ||||||| ||||| 0 AGACACATATACA 12 0 GATACATTAGACACAGATACA--- 20 ||||||| ||||| 0 --------AGACACATATACACAG 15 0 GATACATTAGA---CACAGATACA 20 ||||||||||| |||||||||| 5 GATACATTAGAGACCACAGATACA 28 0 GATAC-----ATTAGA---CACAGATACA 20 ||||| |||||| |||||||||| 0 GATACGATACATTAGAGACCACAGATACA 28 Quality 78778 878777 7778887878 Subject 0 GATAC-----ATTAGA---CACAGATACA--- 20 Query0 0 aga---cacaTataca 12 Query1 0 -------------aga---cacaTatacaCAG 15 Query2 5 gatac-----attagaGACcacagataca 28 Query3 0 gatacGATACattagaGACcacagataca 28 Quality 78778 Subject 0 GATAC 4 Query1 0 ----- 0 Query2 5 gatac 9 Query3 0 gatac 4 Quality Subject 5 ----- 5 Query1 0 ----- 0 Query2 10 ----- 10 Query3 5 GATAC 9 Quality 87877 Subject 5 ATTAG 9 Query0 0 ag 1 Query1 0 ---ag 1 Query2 10 attag 14 Query3 10 attag 14 Quality 7 7 Subject 10 A---C 11 Query0 2 a---c 3 Query1 2 a---c 3 Query2 15 aGACc 19 Query3 15 aGACc 19 Quality 77888 Subject 12 ACAGA 16 Query0 4 acaTa 8 Query1 4 acaTa 8 Query2 20 acaga 24 Query3 20 acaga 24 Quality 7878 Subject 17 TACA- 20 Query0 9 taca 12 Query1 9 tacaC 13 Query2 25 taca 28 Query3 25 taca 28 Quality Subject 21 -- 21 Query1 14 AG 15 0 GATAC-----ATTAGA---CACAGATACA--- 20 0 ...---....T..... 12 0 -------------...---....T.....CAG 15 5 .....-----......GAC.......... 28 0 .....GATAC......GAC.......... 28 787788787777778887878 0 GATACATTAGACACAGATACA 20 com.milaboratory.core.alignment.MultiAlignmentHelperTest > test2 STANDARD_OUT 15 TATAGGGAGAACTCCGATCGACATCG 40 ||||||||| ||||||||||||||| 0 TATAGGGAG--CTCCGATCGACATCG 23 56 CGATCC--CGGTGACAAAGCGTTCGGACC 82 |||||| ||||||||||||||||||||| 0 CGATCCTTCGGTGACAAAGCGTTCGGACC 28 36 CATCGGGTATCGCCCTGGTACG 57 |||| ||||||||||||||||| 0 CATCAGGTATCGCCCTGGTACG 21 0 AACGATGGGCGCAAATATAGGGAGAACTCCGATCGACATCGGGTATCGCCCTGGTACGATCC--CGGTGACAAAGCGTTCGGACCTGTCTGGACGCTAGAACGC 101 0 tatagggag--ctccgatcgacatcg 23 0 cgatccTTcggtgacaaagcgttcggacc 28 0 catcAggtatcgccctggtacg 21 com.milaboratory.core.alignment.batch.SimpleBatchAlignerTest > test1 STANDARD_OUT 4 hits. com.milaboratory.core.alignment.blast.BlastAlignerExtTest > test16SMicrobial1 SKIPPED com.milaboratory.core.alignment.blast.BlastAlignerExtTest > test1 SKIPPED com.milaboratory.core.alignment.blast.BlastAlignerTest > test1 SKIPPED com.milaboratory.core.alignment.blast.BlastAlignerTest > simpleRandomTestT1 SKIPPED com.milaboratory.core.alignment.blast.BlastAlignerTest > simpleRandomTestT2 SKIPPED com.milaboratory.core.alignment.blast.BlastAlignerTest > simpleRandomTestT3 SKIPPED com.milaboratory.core.alignment.blast.BlastDBBuilderTest > test1 SKIPPED com.milaboratory.core.alignment.kaligner1.KAlignerTest > testRandomCorrectness STANDARD_OUT C=1182;I=0;M=0;ScE=0;R=0.0 AlignmentTime = 238.40us C=1642;I=1;M=0;ScE=0;R=0.0 AlignmentTime = 199.36us C=2048;I=0;M=0;ScE=0;R=0.0 AlignmentTime = 149.94us C=2142;I=0;M=0;ScE=0;R=8.333333333333333E-7 AlignmentTime = 137.51us com.milaboratory.core.alignment.kaligner1.KAlignerTest > testRandom1 STANDARD_OUT ##teamcity[buildStatisticValue key='kmFound' value='0.9449'] ##teamcity[buildStatisticValue key='kmWrong' value='1.0E-4'] ##teamcity[buildStatisticValue key='kmFalse' value='0.0058'] com.milaboratory.core.alignment.kaligner1.KAlignerTest > testRandomCorrectnessConcurrent STANDARD_OUT C=2996;I=0;M=0;ScE=0;R=0.0 AlignmentTime = 137.86us C=2999;I=0;M=0;ScE=0;R=0.0 AlignmentTime = 126.18us C=2999;I=0;M=0;ScE=0;R=0.0 AlignmentTime = 145.25us C=2994;I=0;M=2;ScE=1;R=0.0 AlignmentTime = 427.35us com.milaboratory.core.alignment.kaligner1.KMapperTest > testBestOffset2 STANDARD_OUT -205 com.milaboratory.core.alignment.kaligner2.KMapper2Test > test11112 STANDARD_OUT ID: 0 Score: 1856 Cluster 0: Q 27 -> T 15 - -12 Q 30 -> T 18 - -12 Q 39 -> T 28 - -11 Q 42 -> T 31 - -11 Q 45 -> T 34 - -11 Q 48 -> T 37 - -11 Q 51 -> T 40 - -11 Cluster 1: Q 84 -> T 50 - -34 Q 87 -> T 53 - -34 Q 90 -> T 56 - -34 Q 93 -> T 59 - -34 Q 96 -> T 62 - -34 Q 99 -> T 65 - -34 Q 111 -> T 79 - -32 Q 114 -> T 82 - -32 Q 117 -> T 85 - -32 Cluster 2: Q 150 -> T 92 - -58 Q 153 -> T 95 - -58 Q 156 -> T 98 - -58 Q 159 -> T 101 - -58 Q 168 -> T 111 - -57 Cluster 3: Q 198 -> T 120 - -78 Q 201 -> T 123 - -78 Q 204 -> T 126 - -78 Q 207 -> T 129 - -78 Q 216 -> T 139 - -77 Q 219 -> T 142 - -77 Q 222 -> T 145 - -77 Q 231 -> T 153 - -78 Q 234 -> T 156 - -78 Q 237 -> T 159 - -78 Q 240 -> T 162 - -78 Cluster 4: Q 246 -> T 178 - -68 Q 249 -> T 181 - -68 Q 252 -> T 184 - -68 Q 255 -> T 187 - -68 Q 258 -> T 190 - -68 Q 261 -> T 193 - -68 Q 262 -> T 194 - -68 com.milaboratory.core.alignment.kaligner2.KMapper2Test > test1111 STANDARD_OUT ID: 0 Score: 1212 Cluster 0: Q 9 -> T 15 - 6 Q 12 -> T 18 - 6 Q 15 -> T 21 - 6 Q 18 -> T 24 - 6 Q 21 -> T 27 - 6 Q 24 -> T 30 - 6 Q 27 -> T 33 - 6 Q 30 -> T 36 - 6 Cluster 1: Q 57 -> T 48 - -9 Q 60 -> T 51 - -9 Q 69 -> T 61 - -8 Q 72 -> T 64 - -8 Q 81 -> T 72 - -9 Q 84 -> T 75 - -9 Q 87 -> T 78 - -9 Cluster 2: Q 123 -> T 89 - -34 Q 126 -> T 92 - -34 Q 129 -> T 95 - -34 Q 132 -> T 98 - -34 Q 135 -> T 101 - -34 Q 150 -> T 116 - -34 Q 168 -> T 132 - -36 Q 171 -> T 135 - -36 Q 174 -> T 138 - -36 Q 177 -> T 141 - -36 Q 183 -> T 147 - -36 com.milaboratory.core.alignment.kaligner2.KMapper2Test > testRandom1 STANDARD_OUT noHits: 281 noHits2: 0 noHits3: 0 wrongTopHit: 45 wrongTopHitS: 30 noCorrectHitInList: 21 Timings: DescriptiveStatistics: n: 100000 min: 6760.0 max: 4.1978228E8 mean: 160726.40360001527 std dev: 2504209.2887564567 median: 66040.0 skewness: 107.53070658831126 kurtosis: 14057.258059288413 Clusters basicSize DescriptiveStatistics: n: 99674 min: 1.0 max: 7.0 mean: 2.8609065553705095 std dev: 1.0986277435883456 median: 3.0 skewness: 0.29507202074971917 kurtosis: -0.6692534652494913 Top Delta DescriptiveStatistics: n: 99698 min: -32.0 max: 0.0 mean: -0.0012236955605935006 std dev: 0.14725559496467125 median: 0.0 skewness: -152.70570566762015 kurtosis: 27448.10243244401 com.milaboratory.core.alignment.kaligner2.OffsetPacksAccumulatorTest > testScoreCorrection2 SKIPPED com.milaboratory.core.alignment.kaligner2.KAligner2Test > testBoundaries STANDARD_OUT 4965 com.milaboratory.core.alignment.kaligner2.KAligner2Test > caseJ1 STANDARD_OUT 52 0 TGATGCTTTTGATATCTGGGGCCAAGGGACAATGGTCACCGTCTCTTCAGGA 51 ||||||||||||||||||||||||||||||||||||||||||||||||||| 55 TGATGCTTTTGATATCTGGGGCCAAGGGACAATGGTCACCGTCTCTTCAGGG 106 [S51:A->G] (0->52) (55->107) com.milaboratory.core.alignment.kaligner2.KAligner2Test > testCase0 SKIPPED com.milaboratory.core.alignment.kaligner2.KAligner2Test > testSimpleRandomTest STANDARD_OUT Time per query: 583.33us Processed queries: 71 Bad percent: 0.0 False positive percent: 0.5479290638072233 Scoring error percent: 1.4084507042253522 com.milaboratory.core.merger.MergerParametersTest > test2 STANDARD_OUT { "qualityMergingAlgorithm": "SumSubtraction", "partsLayout": "Collinear", "minimalOverlap": 15, "maxQuality": 50, "minimalIdentity": 0.8, "identityType": "Unweighted" } com.milaboratory.core.motif.BitapPatternTest > ttt STANDARD_OUT 0 ATTWCCGACA 9 ||| |||| 20 ATTT--GACA 27 [S3:W->T,D4:C,D5:C] 24 -26 com.milaboratory.core.mutations.MutationTest > exportRegexps STANDARD_OUT S([\QAGCTNRYSWKMBDHV\E])(\d+)([\QAGCTNRYSWKMBDHV\E])|D([\QAGCTNRYSWKMBDHV\E])(\d+)|I(\d+)([\QAGCTNRYSWKMBDHV\E]) S([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E])(\d+)([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E])|D([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E])(\d+)|I(\d+)([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E]) com.milaboratory.core.mutations.MutationsTest > testCanonical1 STANDARD_OUT TCTCTGGTGAATACGGTTTTTAGATGCTCATTTAGATTCTAGATGCGAGATTCTTCAACCCCTCACCGGGACAAATCTTTGTACGCAAATTCGTTGTTCCGATATCGAGTTAATCTCGGCTCCGAATATCTACATATTGCCTCGATGATAGCTACTGGCGCTTGTAGGAAAGGAAAGCTGTCCAGGATGATTCGAATAAGTCTTTTTGCTGAACATTAGACAAACCACTACTTTGGCCCTACGCCTTGGGCCAGGAATGTTTTCGCCCTAGCCTTGTTAGATACCGGGACGCAAGGTAAGAGGGTTTTGGACGACGTGAAATGTCGCCATGCGCCTATTTTGAAAATTGTTCCTAACCTCCGATTCACGCACCACCAGGCCAACACATATGAGATCATCCACTCAAGCGGCGCACAGTGCGAAAAATATTCCGACTCCTTATCCATGGTCGTAGTTGTAGAAAGGCAGATTCTTAGCTCGCTGATCACGAACCAATCCACCGCGGGAGTAGACTAGCGTTTGAAATCGTGAGTAACACTTTTCTCCTTGTTAGTTAAAGCGAAGTTTCGGACCATGTGTAATGCGAGTCTGCCCCATGAGCGGTGCACTTTTTAAAACTGTAACCTAACTAGGGTTTTTGTGGGCGCTTGGGTTCCCGGCTTAAAACTGCTTCTTTGACTTTGTTCCAGGCAAGTCCCCAGATAGTTGGTATAAAGCTCCCGCCTTCGGCTGCCTTATATGGTACCCTAAATATAGTCGCGA TCTCTGGTGAAACGGTTTTAGATGCTCATTTAATCAGATGGGGATTTTCAACCCCTCACCGGGACAATCTTTGTCGCGAATTTGTTGTTCCGATATCGAGTTAATCTCGGCTCCGAATATCTATCATATTGCCTCGATGAAGCTACTGGCGCTTGTAGGAAAGGAAAGCTGTCCAGGATGATTCGAATATGTCTTTTTGTCGATCATTAACAAACCACTACTTTGGCCCTACGCCTTGGGCCAGGAATGTTTTCTCCCTAGCTTGTTAGATACCGGGACGCAGCGTAAGAGGGTTTTGGACGACGTGAGTCGCCATGCGCCATTTGAAAATTGTTCCTAACCCCGATCACGCACCACCAGGCCAACACATATGGGATTACCACTCAAGCGGCGCACATGCAGAAAAATATTCCGATCCCTATCCATGGTTGTAGTCTTTAGTGGATGCAGATCTAGCTCGCTGTCACGTACCACATCGCACCGTGGGAGTAGACTACGTTGAAATCGTGAGTAACACTTTTCCTCCTTTTAGTTAAAGCGAAGTTTTCGGACCAATGTGTGATGCGAGTCTTGCCCATGGCGGTGCACTTTTTAAAACTGTACCTACTGAGGTTTTTGGGCGCTTGGGTTCCCGGCAAAACTGCTTCTTTGACTTTGTTCCAGAAGTCCCAATAGTTGGTATAAATGCTCCCGCCTTCGGCTGCCTTATATGGTACCCTAAATATAGTCGCGA TCTCTGGGAAACGGTTTTAGATGCTCATTTAATCAGTGGGGATTTTCACCCCTCACGGGAAACTTTGTCGCGAATTCGTTTTCCGATATCGGGTTAATCTCGGCTCGAATATCTATCAATTGCCTCGATGAAGCTACTGGCGCTTAGTAGGGAAGGAAAGCTGTCCAGGATGATTCGAATATGTCTTTTTTCGATCCATAACAAACCACACTTGCCTACGCCTTGGGCCAGTATGTTTTCTCCCTAGTTGTTAGATACCGGACGCAGCGTAAAAGGGTTTTGACGATCGTGAGTCGCCATGCGCCATTTAAAATTGTTCCTAACCCCGAATTCACCGCACCATCAGGCCGATACATATGGGATTACCACTCAATGGCGCCATGCAGAAAAAATTCCGATCCCTATCCATGGTGTAGTCTTTAGTGGAGCGGGATCTAGCTCGCTGTCACGTTCACATCGCACCGTGGTAGTAGACTACGTTGAAATCGTAGTAACACTTTTCCTCCTTTTAGTTAAGCGAAGTTTCGGACCAATGTGTGATGCGAGTCTTGCCCATGCGGTGCCTTTTTAAGACGTACCTACTGAGTTTTTGGGCGCTTGGTTCCCGGCAAACTGCTTCTTTGACTTTGTTCCAGGAGTCCCAATGGTTGTATAATGCTCCCGCCTTCCGTCTTGCTTATATGGTTCCCTAAATATAGTCGCGA 0 TCTCTGG-GAA-ACGG-TTTTAGATGCTCATTTA-A-TC-AG-TG-GGGATT-TTC-ACCCCTCA-CGGG--AAA-CTTTGT-CGCGAATTCGTT-TTCCGATATCGGGTTAATCTCGGCT-CGAATATCTATCA-ATTGCCTCGATGA-AGCTACTGGCGCTTAGTAGGGAAGGAAAGCTGTCCAGGATGATTCGAATATGTCTTTTTTC-GATCCA-TA-ACAAACCAC-AC-TT-G-CCTACGCCTTGGGCCA-GTATGTTTTCTCCCTAG--TTGTTAGATACC-GGACGC-AGCGTAAAAGGGTTTT-GACGATCGTG--A-GTCGCCATGCGCC-A-TTT-AAAATTGTTCCTAACC-CCGAATTCACCGCACCATCAGGCCGATACATATGGGATTA-CCACTCAA-TGGCGC-CA-TGCAGAAAAA-ATTCCGA-TCCCTATCCATGGT-GTAGTCTTTAG-TGGAGCGGGA-TC-TAGCTCGCTG-TCACG-TTCACATCGCACCGTGGTAGTAGACTA-CG-TTGAAATCGT-AGTAACACTTTTCCTCCTT-TTAGTT-AAGCGAAGTTTCGGACCAATGTGTGATGCGAGTCTTG-CCCAT--GCGGTGC-CTTTTTAAGAC-GT-ACCT-ACT-GAG-TTTT-TGGGCGCTT-GGTTCCCGGC---AAACTGCTTCTTTGACTTTGTTCCAGG--AGT-CCCA-ATGGTT-GTATAATGCTCCCGCCTTCCGTCTTG-CTTATATGGTTCCCTAAATATAGTCGCGA 703 ||||||| ||| |||| ||||||||||||||||| | || || || | |||| ||| |||||||| |||| ||| |||||| ||| |||||||| ||||||||||| ||||||||||||| |||||||||| || ||||||||||||| |||||||||||||| ||||| ||||||||||||||||||||||||||||| |||||||| | || || || ||||||||| || || | |||||||||||||||| | |||||||| |||||| |||||||||||| |||||| || |||| |||||||| ||||| |||| | ||||||||||||| | ||| |||||||||||||||| ||| ||||| ||||||| |||||| | ||||||| ||| | |||||||| ||||| || ||| |||||| ||||||| ||| |||||||||| ||||| | ||| | || || || |||||||||| ||||| || ||| ||||| || ||||||||| || |||||||||| |||||||||||| |||||| |||||| ||||||||||||||||| |||||| ||||||||| || ||||| ||||||| |||||||| || || |||| ||| | | |||| ||||||||| |||||||||| ||||||||||||||||||||||||||| ||| |||| || ||| |||||| ||||||||||| || | || |||||||||| |||||||||||||||||| 0 TCTCTGGTGAATACGGTTTTTAGATGCTCATTTAGATTCTAGATGCGAGATTCTTCAACCCCTCACCGGGACAAATCTTTGTACGCAAATTCGTTGTTCCGATATCGAGTTAATCTCGGCTCCGAATATCTA-CATATTGCCTCGATGATAGCTACTGGCGCTT-GTAGGAAAGGAAAGCTGTCCAGGATGATTCGAATAAGTCTTTTTGCTGA-ACATTAGACAAACCACTACTTTGGCCCTACGCCTTGGGCCAGGAATGTTTTCGCCCTAGCCTTGTTAGATACCGGGACGCAAG-GTAAGAGGGTTTTGGACGA-CGTGAAATGTCGCCATGCGCCTATTTTGAAAATTGTTCCTAACCTCCG-ATTCA-CGCACCACCAGGCCAACACATATGAGATCATCCACTCAAGCGGCGCACAGTGC-GAAAAATATTCCGACTCCTTATCCATGGTCGTAGT-TGTAGAAAG-GC-AGATTCTTAGCTCGCTGATCACGAACCA-ATC-CACCGCGGGAGTAGACTAGCGTTTGAAATCGTGAGTAACACTTTT-CTCCTTGTTAGTTAAAGCGAAGTTTCGGACC-ATGTGTAATGCGAGTC-TGCCCCATGAGCGGTGCACTTTTTAAAACTGTAACCTAACTAGGGTTTTTGTGGGCGCTTGGGTTCCCGGCTTAAAACTGCTTCTTTGACTTTGTTCCAGGCAAGTCCCCAGATAGTTGGTATAAAGCTCCCGCCTT-CGGC-TGCCTTATATGGTACCCTAAATATAGTCGCGA 761 [I16:T,D17:T,I65:C,D66:C,I70:A,I70:C,D71:C,D73:A,I121:C,D122:C,D211:A,S213:C->A,I214:C,I236:C,D237:C,I253:G,D254:G,I271:C,D272:C,I308:G,D309:G,I318:A,S320:A->T,D321:T,I337:T,D339:T,I363:T,D364:T,I406:G,S406:G->C,D407:C,D448:T,S449:C->T,I450:C,I460:A,I460:A,S461:A->G,D462:A,D463:G,I489:A,D490:A,I518:T,D520:T,I555:A,D556:A,I591:C,D593:C,I597:G,I597:A,D598:A,D599:G,I621:A,D622:A,I626:A,D627:A,I630:A,S630:A->G,D632:G,I634:T,D637:T,I649:G,D651:G,I660:T,I660:T,S660:T->A,D661:T,D662:A,D689:G,D690:C,S691:A->G,I692:C,I692:A,I695:C,D698:C,I707:G,D708:G,D730:T,S731:G->T,S732:C->G,I733:C] 0 TCTCTGGTGAATACGG-TTTTTAGATGCTCATTTAGATTCTAGATGCGAGATTCTTCAACCCCTCA-CCGGG--ACAAATCTTTGTACGCAAATTCGTTGTTCCGATATCGAGTTAATCTCGGCT-CCGAATATCTACATATTGCCTCGATGATAGCTACTGGCGCTTGTAGGAAAGGAAAGCTGTCCAGGATGATTCGAATAAGTCTTTTTGCTGAAC-ATTAGACAAACCACTACTTTGG-CCCTACGCCTTGGGCCA-GGAATGTTTTCGCCCTAG-CCTTGTTAGATACCGGGACGCAAGGTAAGAGGGTTTT-GGACGACGTG-AAATGTCGCCATGCGCCTA-TTTTGAAAATTGTTCCTAACCTCCGA-TTCACGCACCACCAGGCCAACACATATGAGATCATCCACTCAA-GCGGCGCACAGTGCGAAAAATATTCCGACTCCTTATCCATGGTC-GTAGTTGTAG--AAAGGCAGATTCTTAGCTCGCTGATCACG-AACCAATCCACCGCGGGAGTAGACTAGCG-TTTGAAATCGTGAGTAACACTTTTCTCCTTGTTAGTT-AAAGCGAAGTTTCGGACCATGTGTAATGCGAGTCTG-CCCCAT--GAGCGGTGCACTTTTTAAAACTGT-AACCT-AACT-AGGG-TTTTTGTGGGCGCTT-GGGTTCCCGGC--TTAAAACTGCTTCTTTGACTTTGTTCCAGGCA--AGT-CCCCAGATAGTT-GGTATAAAGCTCCCGCCTTCGGCTGC-CTTATATGGTACCCTAAATATAGTCGCGA 761 |||||||||||||||| | ||||||||||||||||||||||||||||||||||||||||||||||| | ||| | | ||||||||||||||||||||||||||||||||||||||||||||||| | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| | |||||||||||||||||||||| | ||||||||||||||| | |||||||||||||||| | ||||||||||||||||||||||||||||||||||| | |||||||| || ||||||||||||||| || ||||||||||||||||||||||| | ||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||| |||||||||| | ||||||||||||||||||||||||| | ||||||||||||||||||||||||||| || |||||||||||||||||||||||||||||||||| | |||||||||||||||||||||||||||||||||| || ||| | ||||||||||||||||||||| | ||| | || | | ||| ||||||||||| || |||||||| |||||||||||||||||||||||||| ||| ||| |||||||| | ||||||||||||||||||||| ||||||||||||||||||||||||||||| 0 TCTCTGGTGAATACGGTT-TTTAGATGCTCATTTAGATTCTAGATGCGAGATTCTTCAACCCCTCACC-GGGACA-A-ATCTTTGTACGCAAATTCGTTGTTCCGATATCGAGTTAATCTCGGCTCC-GAATATCTACATATTGCCTCGATGATAGCTACTGGCGCTTGTAGGAAAGGAAAGCTGTCCAGGATGATTCGAATAAGTCTTTTTGCTG-AACATTAGACAAACCACTACTTTGGCC-CTACGCCTTGGGCCAGG-AATGTTTTCGCCCTAGCC-TTGTTAGATACCGGGACGCAAGGTAAGAGGGTTTTGG-ACGACGTGAAAT-GTCGCCATGCGCCTATTT-TGAAAATTGTTCCTAACCTCCGATT-CACGCACCACCAGGCCAACACATATGAGATCATCCACTCAAGC-GGCGCACAGTGCGAAAAATATTCCGACTCCTTATCCATGG-TCGTAGTTGTAGAAAG--GCAGATTCTTAGCTCGCTGATCACGAA-CCAATCCACCGCGGGAGTAGACTAGCGTTT-GAAATCGTGAGTAACACTTTTCTCCTTGTTAGTTAA-AGCGAAGTTTCGGACCATGTGTAATGCGAGTCTGCCC-CATGAG--CGGTGCACTTTTTAAAACTGTAA-CCTAA-CTAGG-GTTTT-TGTGGGCGCTTGGG-TTCCCGGCTTA--AAACTGCTTCTTTGACTTTGTTCCAG--GCAAGTCCCC-AGATAGTTGG-TATAAAGCTCCCGCCTTCGGC-TGCCTTATATGGTACCCTAAATATAGTCGCGA 761 com.milaboratory.core.mutations.MutationsUtilTest > test1111 STANDARD_OUT S([\QAGCTNRYSWKMBDHV\E])(\d+)([\QAGCTNRYSWKMBDHV\E])|D([\QAGCTNRYSWKMBDHV\E])(\d+)|I(\d+)([\QAGCTNRYSWKMBDHV\E]) S([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E])(\d+)([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E])|D([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E])(\d+)|I(\d+)([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E]) com.milaboratory.core.mutations.MutationsUtilTest > nt2AAWithMappingManual1 STANDARD_OUT [I2C::SM0I, I2G::I1A, I2C::I1A, SG2C:SM0I:I1A] com.milaboratory.core.mutations.MutationsUtilTest > nt2AAWithMappingManual2 STANDARD_OUT [S0:T->N,D13:V,S14:S->Y,S15:P->R,S16:W->P,S17:Y->G,S18:D->T,S19:P->I,S20:G->P,S21:D->A,S22:K->T,S23:A->K,S24:F->R,S25:G->S,S26:P->D,I27:S] [-1, -1, 9, 15] com.milaboratory.core.mutations.MutationsUtilTest > nt2AAWithMappingManual3 STANDARD_OUT 0 CAGGTTCAGCTGGTGCAGTCTGGAGCTGAGGTGAAGAAGCCTGGGGCCTCAGTGAAGGTCTCCTGCAAGGCTTCTGGTTACACCTTTACCAGCTACGGTATCAGCTGGGTGCGACAGGCCCCTGGACAAGGGCTTGAGTGGATGGGATGGATCAGCGCTTACAATGGTAACACAAACTATGCACAGAAGCTCCAGGGCAGAGTCACCATGACCACAGACACATCCACGAGCACAGCCTACATGGAGCTGAGGAGCCTGAGATCTGACGACACGGCCGTGTATTACTGTGCGAGAGA 295 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||| ||||| ||||||||||||||||||||||||||||| ||||||||| ||||||||| ||||||||||||||||||| || ||||| ||| || |||||||||||||| 0 CAGGTTCAGCTGGTGCAGTCTGGAGCTGAGGTGAAGAAGCCTGGGGCCTCAGTGAAGGTCTCCTGCAAGGCTTCTGGTTACACCTTTACCAGCTACGGTATCAGCTGGGTGCGACAGGCCCCTGGACAAGGGCTTGAGTGGATGGGATGGATCAGCGCTTACAATGGTAACACATTCTATGCAGAGAAGTTCCAGGGCAGAGTCACCATGACCACAGACGCATCCACGACCACAGCCTATATGGAGCTGAGGAGCCTGACATTTGACG-----GCCACATACTACTGTGCGAGAGA 290 [S58:N->F,S61:Q->E,S63:L->F,S73:T->A,S76:S->T,S86:R->T,S87:S->F,S89:D->G,D90:T,D91:A,S92:V->H,S93:Y->I,S94:Y->L,S95:C->L,S96:A->C,S97:R->E,S98:_->R] QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYGISWVRQAPGQGLEWMGWISAYNGNTFYAEKFQGRVTMTTDASTTTAYMELRSLTFDGHILLCER QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYGISWVRQAPGQGLEWMGWISAYNGNTFYAEKFQGRVTMTTDASTTTAYMELRSLTFDGHILLCER [S58:N->F,S61:Q->E,S63:L->F,S73:T->A,S76:S->T,S86:R->T,S87:S->F,S89:D->G,D90:T,D91:A,S92:V->H,S93:Y->I,S94:Y->L,S95:C->L,S96:A->C,S97:R->E,S98:_->R] [0, 0, 1, 2, 3, 4, -1, 5, 6, 7, 7, 8, 8, 8, 10, 10, 11, 12] com.milaboratory.core.mutations.MutationsUtilTest > nt2AAWithMappingManual4 STANDARD_OUT [S3:S->M,D4:D,S5:_->I] com.milaboratory.core.sequence.AminoAcidAlphabetTest > testCalculateMatches SKIPPED com.milaboratory.core.sequence.AminoAcidSequenceTest > testName STANDARD_OUT 3 com.milaboratory.core.sequence.AminoAcidSequenceTest > testConvertPositionSync1 STANDARD_OUT FromCenter 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 FromLeftWithoutIncompleteCodon 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 FromLeftWithIncompleteCodon 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 FromRightWithoutIncompleteCodon 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 FromRightWithIncompleteCodon 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 com.milaboratory.core.sequence.GeneticCodeTest > generateExtendedGeneticCode SKIPPED com.milaboratory.core.sequence.NucleotideAlphabetTest > testCalculateIntersections SKIPPED com.milaboratory.core.sequence.ShortSequenceSetTest > test1 STANDARD_OUT 99952 elements with 366.13KiB in raw nucleotide entropy serialized into 273.19KiB com.milaboratory.core.sequence.quality.QualityAggregatorTest > test1 STANDARD_OUT 33 com.milaboratory.core.sequence.quality.QualityAggregatorTest > test2 STANDARD_OUT 666 com.milaboratory.core.sequence.quality.QualityAggregatorTest > test3 STANDARD_OUT 2468 com.milaboratory.core.sequence.quality.QualityTrimmerTest > testParametersSerialization0 STANDARD_OUT { "averageQualityThreshold": 7.0, "windowSize": 6 } com.milaboratory.core.tree.PrimerGenerator > generate SKIPPED com.milaboratory.core.tree.SequenceTreeMapTest > testCase9 STANDARD_OUT Hit 1 0 ac-gacTtgactg 11 0 acTgac-tgactg 11 Hit 2 0 ac-gactTgactg 11 0 acTgact-gactg 11 com.milaboratory.core.tree.SequenceTreeMapTest > optimalityAndScopeTest STANDARD_OUT --NW alignments-- CASSLAPGATN-KLFF CASS-APGATNEKLFF CASSLAPGATN-KLFF CASSLAPG-TNEKLFF CASSLAPGATN-KLfF CASSLAPG-TNEKLyF --STM alignments-- CASSLAPGATN-KLFF CASS-APGATNEKLFF CASSLAPGATN-KLFF CASSLAPG-TNEKLFF CASSlAPGATN-KLFF CASSa-PGATNEKLFF CASSLAPGaTN-KLFF CASSLAPGt-NEKLFF CASSlAPGATN-KLFF CA-SsAPGATNEKLFF CASSlAPGATN-KLFF CAS-sAPGATNEKLFF CASSLAPGATNk-LFF CASS-APGATNeKLFF CASSLAPGaTN-KLFF CASSLAP-gTNEKLFF CASSLAPGATNk-LFF CASSLAPG-TNeKLFF CASSLAPGATN-KLfF CASSLAPG-TNEKLyF ------------------ com.milaboratory.core.io.sequence.fasta.RandomAccessFastaReaderTest > test1nt STANDARD_ERROR Indexing milib_6ef1666f627b9f53f5f4df0a240fe4c8692a0bde10959051597648344231.fasta: 0% Indexing milib_6ef1666f627b9f53f5f4df0a240fe4c8692a0bde10959051597648344231.fasta: done com.milaboratory.core.io.sequence.fasta.RandomAccessFastaReaderTest > test1 STANDARD_ERROR Indexing milib_6ef1666f627b9f53f5f4df0a240fe4c8692a0bde10959051597648344231.fasta: 0% Indexing milib_6ef1666f627b9f53f5f4df0a240fe4c8692a0bde10959051597648344231.fasta: done com.milaboratory.core.io.sequence.fasta.RandomAccessFastaReaderTest > test2 STANDARD_ERROR Indexing milib_04afe8412b82e9e8442bd03b750217e2f8d271a92227644790321736533.tmp: 0% Indexing milib_04afe8412b82e9e8442bd03b750217e2f8d271a92227644790321736533.tmp: done com.milaboratory.core.io.util.IOUtilTest > test111 STANDARD_OUT 3 3 -2147483648 -9223372036854775808 com.milaboratory.util.AtomicEnumHistogramTest > test1 STANDARD_OUT {"labels":["A","B","C","null"],"hist":[1,2,0,1]} com.milaboratory.util.ByteStringTest > testSpeed1 STANDARD_OUT Time per hash: 455ns Addition to hash set (per operation): 1.55us Hash set removal (per operation): 769ns b com.milaboratory.util.CacheTest > test1 STANDARD_OUT Cache misses:400 Cache hits:800 com.milaboratory.util.IntCombinationsTest > test1 STANDARD_OUT [0, 1] [0, 2] [1, 2] com.milaboratory.util.JsonOverriderTest > test1 STANDARD_OUT WARNING: unnecessary override -Ob= with the same value. com.milaboratory.util.NSequenceWithQualityPrintHelperTest > test1 SKIPPED com.milaboratory.util.RemoveActionTest > test1 STANDARD_OUT /tmp/milib_e2def23cb6761c464645a49eb5f1d06271fea0058938250171665864382 com.milaboratory.util.RemoveActionTest > test2 STANDARD_OUT /tmp/milib_42660c8d715be215e311f96fcca1980c022ad6046473520542888299112.tmp com.milaboratory.util.sorting.HashSorterTest > testSingleton STANDARD_OUT /tmp/milib_4ec936d93ac66faafab4fb4b89daed62dfadf74c17171953031183930842 timeInCollate: 5.41s timeInCollatorInit: 3.9s timeAwaitingO: 41.57ms timeAwaitingI: 1.35s timeInFinalSorting1: 0ns timeInFinalSorting2: 128.87ms timeInFinalSorting3: 61.15ms /26S (5|27|32): objs=50000 size=3.17MiB com.milaboratory.util.sorting.HashSorterTest > test1 STANDARD_OUT /tmp/milib_9d38e4b3b2fb0ae9cf0f1b39aa60d0826f1c4bbb5485263907075222117 timeInCollate: 23.25s timeInCollatorInit: 1.52s timeAwaitingO: 1.64s timeAwaitingI: 7.1s timeInFinalSorting1: 1.81s timeInFinalSorting2: 3.52s timeInFinalSorting3: 701.91ms /0N (5|27|32): objs=159065 size=7.82MiB /1N (5|27|32): objs=155366 size=7.68MiB /2N (5|27|32): objs=156689 size=7.59MiB /3N (5|27|32): objs=158501 size=7.32MiB /4N (5|27|32): objs=162714 size=7.95MiB /5N (5|27|32): objs=165744 size=8.4MiB /6N (5|27|32): objs=159730 size=8.03MiB /7N (5|27|32): objs=147659 size=7.15MiB /8N (5|27|32): objs=154111 size=7.25MiB /9N (5|27|32): objs=146449 size=7.09MiB /10N (5|27|32): objs=159399 size=7.51MiB /11N (5|27|32): objs=152641 size=7.35MiB /12N (5|27|32): objs=154975 size=7.43MiB /13N (5|27|32): objs=152099 size=7.28MiB /14N (5|27|32): objs=156407 size=7.5MiB /15N (5|27|32): objs=157380 size=7.82MiB /16N (5|27|32): objs=161337 size=7.76MiB /17N (5|27|32): objs=148088 size=7.22MiB /18N (5|27|32): objs=158296 size=7.66MiB /19N (5|27|32): objs=165619 size=7.9MiB /20N (5|27|32): objs=161902 size=8.12MiB /21N (5|27|32): objs=150180 size=7.21MiB /22N (5|27|32): objs=160058 size=7.75MiB /23N (5|27|32): objs=153231 size=7.4MiB /24N (5|27|32): objs=157903 size=7.66MiB /25N (5|27|32): objs=151715 size=7.47MiB /26N (5|27|32): objs=161356 size=7.93MiB /27N (5|27|32): objs=152599 size=7.4MiB /28N (5|27|32): objs=152698 size=7.48MiB /29N (5|27|32): objs=159207 size=7.91MiB /30N (5|27|32): objs=156548 size=7.54MiB /31N (5|27|32): objs=150334 size=7.4MiB /0/0N (2|25|36): objs=39170 size=801.67KiB /0/1N (2|25|36): objs=40881 size=1MiB /0/2N (2|25|36): objs=40692 size=966.98KiB /0/3N (2|25|36): objs=7254 size=35.17KiB /0/4S (2|25|36): objs=155 size=252B /0/5S (2|25|36): objs=134 size=172B /0/6S (2|25|36): objs=142 size=187B /0/8S (2|25|36): objs=164 size=350B /0/9N (2|25|36): objs=728 size=2.94KiB /0/10S (2|25|36): objs=162 size=104B /0/11N (2|25|36): objs=5782 size=29.73KiB /0/12S (2|25|36): objs=156 size=286B /0/13N (2|25|36): objs=1233 size=4.95KiB /0/14S (2|25|36): objs=159 size=103B /0/15N (2|25|36): objs=1135 size=4.5KiB /0/16S (2|25|36): objs=155 size=241B /0/17N (2|25|36): objs=1341 size=5.49KiB /0/18S (2|25|36): objs=143 size=184B /0/19N (2|25|36): objs=2727 size=11.5KiB /0/20S (2|25|36): objs=163 size=207B /0/21N (2|25|36): objs=1197 size=4.84KiB /0/22S (2|25|36): objs=137 size=91B /0/24S (2|25|36): objs=149 size=158B /0/25N (2|25|36): objs=459 size=1.59KiB /0/26S (2|25|36): objs=154 size=285B /0/27N (2|25|36): objs=4770 size=22.14KiB /0/28S (2|25|36): objs=160 size=167B /0/29N (2|25|36): objs=1167 size=4.96KiB /0/30S (2|25|36): objs=138 size=120B /0/31S (2|25|36): objs=167 size=150B /0/32S (2|25|36): objs=138 size=316B /0/33N (2|25|36): objs=483 size=1.75KiB /0/34S (2|25|36): objs=173 size=95B /0/35N (2|25|36): objs=7297 size=39.18KiB /1/0N (2|25|36): objs=40130 size=834.59KiB /1/1N (2|25|36): objs=39000 size=899.72KiB /1/2N (2|25|36): objs=9177 size=54.24KiB /1/3S (2|25|36): objs=148 size=115B /1/4N (2|25|36): objs=22416 size=224.02KiB /1/5S (2|25|36): objs=151 size=157B /1/6N (2|25|36): objs=3841 size=17.9KiB /1/7S (2|25|36): objs=143 size=150B /1/8N (2|25|36): objs=2679 size=11.4KiB /1/9S (2|25|36): objs=166 size=279B /1/10N (2|25|36): objs=2013 size=8.38KiB /1/11N (2|25|36): objs=1373 size=5.86KiB /1/12S (2|25|36): objs=147 size=281B /1/13S (2|25|36): objs=161 size=212B /1/14S (2|25|36): objs=161 size=94B /1/15N (2|25|36): objs=3628 size=15.46KiB /1/16S (2|25|36): objs=164 size=167B /1/17N (2|25|36): objs=1387 size=5.64KiB /1/18S (2|25|36): objs=171 size=356B /1/19N (2|25|36): objs=888 size=3.22KiB /1/20S (2|25|36): objs=134 size=197B /1/21N (2|25|36): objs=6124 size=29.84KiB /1/22S (2|25|36): objs=157 size=160B /1/23N (2|25|36): objs=8827 size=48.13KiB /1/24S (2|25|36): objs=141 size=201B /1/25N (2|25|36): objs=2764 size=12.34KiB /1/26S (2|25|36): objs=169 size=142B /1/27N (2|25|36): objs=1176 size=4.74KiB /1/28S (2|25|36): objs=154 size=253B /1/29N (2|25|36): objs=1680 size=7.04KiB /1/30S (2|25|36): objs=132 size=85B /1/31N (2|25|36): objs=3281 size=14.65KiB /1/32S (2|25|36): objs=140 size=303B /1/33S (2|25|36): objs=171 size=164B /1/34S (2|25|36): objs=134 size=275B /1/35N (2|25|36): objs=2238 size=9.79KiB /2/0N (2|25|36): objs=39501 size=892.65KiB /2/1N (2|25|36): objs=37322 size=710.56KiB /2/2N (2|25|36): objs=40674 size=895.59KiB /2/3N (2|25|36): objs=4329 size=20.43KiB /2/4S (2|25|36): objs=159 size=141B /2/5N (2|25|36): objs=3832 size=16.56KiB /2/6S (2|25|36): objs=167 size=252B /2/7N (2|25|36): objs=500 size=1.66KiB /2/8S (2|25|36): objs=140 size=229B /2/9N (2|25|36): objs=1477 size=6.07KiB /2/10S (2|25|36): objs=163 size=299B /2/11N (2|25|36): objs=2285 size=9.77KiB /2/12S (2|25|36): objs=144 size=129B /2/13N (2|25|36): objs=3824 size=16.72KiB /2/14S (2|25|36): objs=152 size=163B /2/15N (2|25|36): objs=3785 size=16.89KiB /2/16S (2|25|36): objs=162 size=295B /2/17N (2|25|36): objs=468 size=1.61KiB /2/18S (2|25|36): objs=139 size=106B /2/19N (2|25|36): objs=5153 size=23.44KiB /2/20S (2|25|36): objs=149 size=107B /2/21N (2|25|36): objs=3509 size=16.76KiB /2/22S (2|25|36): objs=129 size=247B /2/24S (2|25|36): objs=139 size=230B /2/26S (2|25|36): objs=168 size=107B /2/27N (2|25|36): objs=1330 size=5.44KiB /2/28S (2|25|36): objs=164 size=343B /2/29N (2|25|36): objs=1232 size=4.82KiB /2/30S (2|25|36): objs=151 size=217B /2/31N (2|25|36): objs=1845 size=7.49KiB /2/32S (2|25|36): objs=136 size=175B /2/33N (2|25|36): objs=298 size=953B /2/34S (2|25|36): objs=140 size=234B /2/35N (2|25|36): objs=2923 size=13.53KiB /3/0N (2|25|36): objs=21107 size=192.41KiB /3/1S (2|25|36): objs=154 size=125B /3/2N (2|25|36): objs=18448 size=130.02KiB /3/3N (2|25|36): objs=29197 size=331.85KiB /3/4S (2|25|36): objs=161 size=135B /3/5N (2|25|36): objs=11318 size=69.46KiB /3/6N (2|25|36): objs=38415 size=714.35KiB /3/7N (2|25|36): objs=10699 size=59.67KiB /3/8S (2|25|36): objs=154 size=263B /3/9N (2|25|36): objs=928 size=3.49KiB /3/10S (2|25|36): objs=160 size=159B /3/11N (2|25|36): objs=743 size=2.67KiB /3/12S (2|25|36): objs=141 size=215B /3/13N (2|25|36): objs=903 size=3.44KiB /3/14S (2|25|36): objs=152 size=268B /3/15N (2|25|36): objs=2021 size=8.16KiB /3/16S (2|25|36): objs=141 size=269B /3/17N (2|25|36): objs=1840 size=7.59KiB /3/18S (2|25|36): objs=134 size=200B /3/19N (2|25|36): objs=1387 size=5.65KiB /3/20S (2|25|36): objs=136 size=175B /3/21S (2|25|36): objs=144 size=300B /3/22S (2|25|36): objs=167 size=313B /3/23N (2|25|36): objs=1964 size=8.18KiB /3/24S (2|25|36): objs=145 size=188B /3/25N (2|25|36): objs=6103 size=28.76KiB /3/26S (2|25|36): objs=161 size=292B /3/28S (2|25|36): objs=167 size=96B /3/29N (2|25|36): objs=1874 size=7.68KiB /3/30S (2|25|36): objs=151 size=206B /3/31N (2|25|36): objs=2435 size=10.5KiB /3/32S (2|25|36): objs=154 size=209B /3/33N (2|25|36): objs=1393 size=5.4KiB /3/34S (2|25|36): objs=133 size=87B /3/35N (2|25|36): objs=5171 size=24.95KiB /4/0N (2|25|36): objs=42384 size=978.46KiB /4/1N (2|25|36): objs=41030 size=848.88KiB /4/2N (2|25|36): objs=39022 size=874.13KiB /4/3N (2|25|36): objs=14407 size=88.29KiB /4/4S (2|25|36): objs=154 size=255B /4/5N (2|25|36): objs=2572 size=12.28KiB /4/6S (2|25|36): objs=154 size=340B /4/7N (2|25|36): objs=1394 size=5.83KiB /4/8S (2|25|36): objs=161 size=209B /4/9N (2|25|36): objs=450 size=1.52KiB /4/10S (2|25|36): objs=151 size=246B /4/11N (2|25|36): objs=620 size=2.34KiB /4/12S (2|25|36): objs=143 size=84B /4/13N (2|25|36): objs=3180 size=14.3KiB /4/14S (2|25|36): objs=159 size=175B /4/16S (2|25|36): objs=156 size=280B /4/17S (2|25|36): objs=171 size=137B /4/18S (2|25|36): objs=166 size=162B /4/19N (2|25|36): objs=1621 size=6.28KiB /4/20S (2|25|36): objs=145 size=202B /4/21N (2|25|36): objs=3658 size=16.55KiB /4/22S (2|25|36): objs=158 size=274B /4/23N (2|25|36): objs=1239 size=4.76KiB /4/24S (2|25|36): objs=150 size=208B /4/25N (2|25|36): objs=1083 size=4.32KiB /4/26S (2|25|36): objs=147 size=331B /4/27N (2|25|36): objs=907 size=3.61KiB /4/28S (2|25|36): objs=165 size=285B /4/30S (2|25|36): objs=165 size=272B /4/31N (2|25|36): objs=302 size=811B /4/32S (2|25|36): objs=170 size=343B /4/33N (2|25|36): objs=4160 size=17.7KiB /4/34S (2|25|36): objs=147 size=297B /4/35N (2|25|36): objs=2023 size=8.44KiB /5/0N (2|25|36): objs=23801 size=247.19KiB /5/1S (2|25|36): objs=160 size=348B /5/2N (2|25|36): objs=19264 size=151.68KiB /5/3N (2|25|36): objs=41994 size=1.06MiB /5/4N (2|25|36): objs=3227 size=13.66KiB /5/5S (2|25|36): objs=154 size=226B /5/6N (2|25|36): objs=16616 size=119.35KiB /5/7S (2|25|36): objs=149 size=326B /5/8N (2|25|36): objs=14088 size=95.2KiB /5/9S (2|25|36): objs=150 size=110B /5/10N (2|25|36): objs=929 size=3.73KiB /5/11S (2|25|36): objs=144 size=258B /5/12N (2|25|36): objs=2077 size=8.7KiB /5/13S (2|25|36): objs=169 size=170B /5/14N (2|25|36): objs=2606 size=11.29KiB /5/15S (2|25|36): objs=157 size=173B /5/17N (2|25|36): objs=7305 size=41.13KiB /5/18S (2|25|36): objs=145 size=247B /5/19N (2|25|36): objs=947 size=3.72KiB /5/20S (2|25|36): objs=165 size=123B /5/21N (2|25|36): objs=4468 size=20.6KiB /5/22S (2|25|36): objs=164 size=240B /5/23N (2|25|36): objs=1424 size=5.54KiB /5/24S (2|25|36): objs=161 size=307B /5/25N (2|25|36): objs=6790 size=34.67KiB /5/26S (2|25|36): objs=180 size=131B /5/27S (2|25|36): objs=140 size=149B /5/28S (2|25|36): objs=151 size=87B /5/29N (2|25|36): objs=7438 size=46.97KiB /5/30S (2|25|36): objs=167 size=108B /5/32S (2|25|36): objs=147 size=161B /5/33N (2|25|36): objs=3893 size=19.17KiB /5/34S (2|25|36): objs=151 size=245B /5/35N (2|25|36): objs=6223 size=32.19KiB /6/0N (2|25|36): objs=41221 size=906.56KiB /6/1N (2|25|36): objs=35471 size=717.73KiB /6/2N (2|25|36): objs=36441 size=808.31KiB /6/3S (2|25|36): objs=154 size=149B /6/4N (2|25|36): objs=1188 size=4.87KiB /6/5N (2|25|36): objs=1016 size=3.89KiB /6/6S (2|25|36): objs=154 size=138B /6/7N (2|25|36): objs=2966 size=12.62KiB /6/8S (2|25|36): objs=152 size=169B /6/9N (2|25|36): objs=10873 size=63.44KiB /6/10S (2|25|36): objs=153 size=231B /6/11N (2|25|36): objs=785 size=2.93KiB /6/12S (2|25|36): objs=163 size=117B /6/13S (2|25|36): objs=163 size=157B /6/14S (2|25|36): objs=156 size=191B /6/15N (2|25|36): objs=809 size=3.37KiB /6/16S (2|25|36): objs=140 size=303B /6/17N (2|25|36): objs=1935 size=8.05KiB /6/18S (2|25|36): objs=164 size=308B /6/19N (2|25|36): objs=9030 size=49.28KiB /6/20S (2|25|36): objs=147 size=153B /6/21N (2|25|36): objs=2468 size=10.41KiB /6/22S (2|25|36): objs=144 size=247B /6/23N (2|25|36): objs=2875 size=12.95KiB /6/24S (2|25|36): objs=146 size=88B /6/25N (2|25|36): objs=425 size=1.29KiB /6/26S (2|25|36): objs=138 size=246B /6/27N (2|25|36): objs=297 size=800B /6/28S (2|25|36): objs=160 size=250B /6/29N (2|25|36): objs=6151 size=31.24KiB /6/30S (2|25|36): objs=139 size=287B /6/31N (2|25|36): objs=1093 size=4.56KiB /6/32S (2|25|36): objs=138 size=204B /6/33N (2|25|36): objs=1808 size=7.59KiB /6/34S (2|25|36): objs=160 size=167B /6/35N (2|25|36): objs=307 size=757B /7/0N (2|25|36): objs=37896 size=795.77KiB /7/1N (2|25|36): objs=16780 size=123.59KiB /7/2S (2|25|36): objs=139 size=287B /7/3N (2|25|36): objs=18900 size=149.66KiB /7/4N (2|25|36): objs=38455 size=817.36KiB /7/5N (2|25|36): objs=11219 size=69.45KiB /7/6S (2|25|36): objs=137 size=207B /7/7N (2|25|36): objs=306 size=781B /7/8S (2|25|36): objs=147 size=290B /7/9S (2|25|36): objs=163 size=162B /7/10S (2|25|36): objs=111 size=200B /7/11N (2|25|36): objs=581 size=2.35KiB /7/12S (2|25|36): objs=175 size=324B /7/13N (2|25|36): objs=3186 size=13.4KiB /7/14S (2|25|36): objs=151 size=277B /7/15N (2|25|36): objs=1572 size=6.62KiB /7/16S (2|25|36): objs=160 size=170B /7/17N (2|25|36): objs=486 size=1.56KiB /7/18S (2|25|36): objs=162 size=174B /7/19N (2|25|36): objs=747 size=2.86KiB /7/20S (2|25|36): objs=159 size=160B /7/21N (2|25|36): objs=3018 size=13.25KiB /7/22S (2|25|36): objs=154 size=227B /7/23N (2|25|36): objs=4492 size=19.33KiB /7/24S (2|25|36): objs=137 size=96B /7/25N (2|25|36): objs=310 size=850B /7/26S (2|25|36): objs=150 size=135B /7/27N (2|25|36): objs=767 size=2.92KiB /7/28S (2|25|36): objs=151 size=291B /7/30S (2|25|36): objs=174 size=191B /7/31N (2|25|36): objs=1986 size=8.04KiB /7/32S (2|25|36): objs=155 size=328B /7/33N (2|25|36): objs=3271 size=13.88KiB /7/34S (2|25|36): objs=146 size=237B /7/35N (2|25|36): objs=1116 size=4.26KiB /8/0N (2|25|36): objs=41441 size=846.98KiB /8/1N (2|25|36): objs=36468 size=719.16KiB /8/2N (2|25|36): objs=39615 size=738.26KiB /8/3N (2|25|36): objs=1186 size=4.97KiB /8/4S (2|25|36): objs=149 size=183B /8/5N (2|25|36): objs=2312 size=9.53KiB /8/6S (2|25|36): objs=151 size=168B /8/7N (2|25|36): objs=464 size=1.68KiB /8/8S (2|25|36): objs=157 size=181B /8/9N (2|25|36): objs=1526 size=6.08KiB /8/10S (2|25|36): objs=188 size=214B /8/11N (2|25|36): objs=1835 size=7.66KiB /8/12S (2|25|36): objs=147 size=109B /8/13N (2|25|36): objs=1835 size=7.66KiB /8/14S (2|25|36): objs=141 size=90B /8/15N (2|25|36): objs=3715 size=16.07KiB /8/16S (2|25|36): objs=148 size=103B /8/17N (2|25|36): objs=1332 size=5.36KiB /8/18S (2|25|36): objs=151 size=278B /8/19N (2|25|36): objs=1714 size=7.12KiB /8/20S (2|25|36): objs=168 size=250B /8/22S (2|25|36): objs=151 size=150B /8/23N (2|25|36): objs=3777 size=16.59KiB /8/24S (2|25|36): objs=149 size=229B /8/25S (2|25|36): objs=141 size=256B /8/26S (2|25|36): objs=136 size=84B /8/27N (2|25|36): objs=11293 size=63.85KiB /8/28S (2|25|36): objs=134 size=168B /8/29N (2|25|36): objs=304 size=878B /8/30S (2|25|36): objs=150 size=327B /8/31N (2|25|36): objs=475 size=1.4KiB /8/32S (2|25|36): objs=164 size=321B /8/33N (2|25|36): objs=1937 size=8.27KiB /8/34S (2|25|36): objs=139 size=256B /8/35N (2|25|36): objs=318 size=925B /9/0N (2|25|36): objs=34060 size=563.72KiB /9/1N (2|25|36): objs=37139 size=773.87KiB /9/2N (2|25|36): objs=35901 size=684.11KiB /9/3S (2|25|36): objs=133 size=195B /9/4N (2|25|36): objs=2040 size=8.38KiB /9/5S (2|25|36): objs=155 size=339B /9/6N (2|25|36): objs=1335 size=5.71KiB /9/7N (2|25|36): objs=2058 size=8.63KiB /9/8S (2|25|36): objs=161 size=282B /9/9S (2|25|36): objs=161 size=198B /9/10S (2|25|36): objs=151 size=306B /9/11N (2|25|36): objs=1793 size=7.53KiB /9/12S (2|25|36): objs=137 size=172B /9/13N (2|25|36): objs=658 size=2.22KiB /9/14S (2|25|36): objs=167 size=338B /9/15N (2|25|36): objs=441 size=1.83KiB /9/16S (2|25|36): objs=163 size=348B /9/17N (2|25|36): objs=3326 size=14.84KiB /9/18S (2|25|36): objs=150 size=235B /9/19N (2|25|36): objs=5347 size=25.83KiB /9/20S (2|25|36): objs=146 size=295B /9/21N (2|25|36): objs=4211 size=19.87KiB /9/22S (2|25|36): objs=139 size=187B /9/23S (2|25|36): objs=158 size=235B /9/24S (2|25|36): objs=152 size=308B /9/25N (2|25|36): objs=1837 size=7.29KiB /9/26S (2|25|36): objs=141 size=281B /9/27N (2|25|36): objs=292 size=1.02KiB /9/28S (2|25|36): objs=150 size=334B /9/29N (2|25|36): objs=2424 size=10.44KiB /9/30S (2|25|36): objs=142 size=201B /9/31N (2|25|36): objs=2749 size=11.55KiB /9/32S (2|25|36): objs=160 size=135B /9/33N (2|25|36): objs=1370 size=5.55KiB /9/34S (2|25|36): objs=159 size=273B /9/35N (2|25|36): objs=6743 size=35.43KiB /10/0N (2|25|36): objs=42479 size=829.64KiB /10/1N (2|25|36): objs=40613 size=808.81KiB /10/2N (2|25|36): objs=34941 size=611.68KiB /10/3N (2|25|36): objs=12140 size=72.11KiB /10/4S (2|25|36): objs=148 size=333B /10/5N (2|25|36): objs=2880 size=12.85KiB /10/6S (2|25|36): objs=151 size=205B /10/8S (2|25|36): objs=147 size=289B /10/9N (2|25|36): objs=1061 size=4.16KiB /10/10S (2|25|36): objs=172 size=306B /10/11N (2|25|36): objs=295 size=683B /10/12S (2|25|36): objs=157 size=259B /10/13N (2|25|36): objs=2469 size=10.82KiB /10/14S (2|25|36): objs=157 size=185B /10/16S (2|25|36): objs=142 size=194B /10/17N (2|25|36): objs=1006 size=4.01KiB /10/18S (2|25|36): objs=155 size=140B /10/19N (2|25|36): objs=1531 size=6.22KiB /10/20S (2|25|36): objs=141 size=151B /10/21N (2|25|36): objs=2151 size=9.18KiB /10/22S (2|25|36): objs=143 size=247B /10/23S (2|25|36): objs=148 size=260B /10/24S (2|25|36): objs=169 size=238B /10/25N (2|25|36): objs=3880 size=17.54KiB /10/26S (2|25|36): objs=145 size=276B /10/27N (2|25|36): objs=765 size=2.97KiB /10/28S (2|25|36): objs=142 size=215B /10/29S (2|25|36): objs=166 size=100B /10/30S (2|25|36): objs=154 size=238B /10/31N (2|25|36): objs=2142 size=9.28KiB /10/32S (2|25|36): objs=155 size=207B /10/33N (2|25|36): objs=5712 size=27.14KiB /10/34S (2|25|36): objs=148 size=87B /10/35N (2|25|36): objs=2594 size=11KiB /11/0N (2|25|36): objs=35733 size=636.55KiB /11/1N (2|25|36): objs=41052 size=956.96KiB /11/2N (2|25|36): objs=33229 size=474.17KiB /11/3N (2|25|36): objs=4839 size=23.96KiB /11/4S (2|25|36): objs=155 size=198B /11/5N (2|25|36): objs=2519 size=10.47KiB /11/6S (2|25|36): objs=143 size=240B /11/7N (2|25|36): objs=328 size=1.01KiB /11/8S (2|25|36): objs=146 size=265B /11/9N (2|25|36): objs=299 size=731B /11/10S (2|25|36): objs=164 size=200B /11/11N (2|25|36): objs=3552 size=15.81KiB /11/12S (2|25|36): objs=153 size=225B /11/13N (2|25|36): objs=1376 size=5.68KiB /11/14S (2|25|36): objs=149 size=219B /11/15N (2|25|36): objs=761 size=2.87KiB /11/16S (2|25|36): objs=170 size=90B /11/17N (2|25|36): objs=1182 size=4.75KiB /11/18S (2|25|36): objs=153 size=163B /11/19N (2|25|36): objs=3589 size=17.8KiB /11/20S (2|25|36): objs=148 size=228B /11/21N (2|25|36): objs=1736 size=7.23KiB /11/22S (2|25|36): objs=160 size=217B /11/23N (2|25|36): objs=1262 size=5.16KiB /11/24S (2|25|36): objs=155 size=333B /11/25N (2|25|36): objs=2527 size=10.68KiB /11/26S (2|25|36): objs=163 size=244B /11/27N (2|25|36): objs=1055 size=4.28KiB /11/28S (2|25|36): objs=140 size=271B /11/29N (2|25|36): objs=1178 size=4.79KiB /11/30S (2|25|36): objs=169 size=111B /11/31N (2|25|36): objs=12822 size=71.54KiB /11/32S (2|25|36): objs=176 size=103B /11/33N (2|25|36): objs=793 size=3.08KiB /11/34S (2|25|36): objs=166 size=324B /11/35N (2|25|36): objs=299 size=857B /12/0N (2|25|36): objs=36196 size=651.59KiB /12/1N (2|25|36): objs=39031 size=767.8KiB /12/2N (2|25|36): objs=38158 size=742.8KiB /12/3N (2|25|36): objs=4128 size=19.91KiB /12/4S (2|25|36): objs=133 size=94B /12/5N (2|25|36): objs=2866 size=12.38KiB /12/6S (2|25|36): objs=145 size=152B /12/7N (2|25|36): objs=1322 size=5.42KiB /12/8S (2|25|36): objs=127 size=173B /12/9N (2|25|36): objs=2406 size=10.83KiB /12/10S (2|25|36): objs=153 size=299B /12/11N (2|25|36): objs=3431 size=14.97KiB /12/12S (2|25|36): objs=160 size=115B /12/13N (2|25|36): objs=416 size=1.57KiB /12/14S (2|25|36): objs=170 size=135B /12/15N (2|25|36): objs=926 size=3.56KiB /12/16S (2|25|36): objs=177 size=328B /12/17N (2|25|36): objs=3212 size=13.6KiB /12/18S (2|25|36): objs=149 size=138B /12/19N (2|25|36): objs=1165 size=4.97KiB /12/20S (2|25|36): objs=149 size=104B /12/21N (2|25|36): objs=3024 size=12.78KiB /12/22S (2|25|36): objs=151 size=106B /12/23N (2|25|36): objs=3801 size=16.03KiB /12/24S (2|25|36): objs=149 size=182B /12/25N (2|25|36): objs=1398 size=5.81KiB /12/26S (2|25|36): objs=145 size=197B /12/27N (2|25|36): objs=723 size=2.99KiB /12/28S (2|25|36): objs=160 size=229B /12/29N (2|25|36): objs=5152 size=24.78KiB /12/30S (2|25|36): objs=161 size=218B /12/31N (2|25|36): objs=2462 size=10.34KiB /12/32S (2|25|36): objs=149 size=195B /12/33N (2|25|36): objs=2727 size=12.49KiB /12/34S (2|25|36): objs=153 size=99B /13/0N (2|25|36): objs=33690 size=674.21KiB /13/1N (2|25|36): objs=14484 size=90.51KiB /13/2S (2|25|36): objs=143 size=208B /13/3N (2|25|36): objs=22350 size=205.46KiB /13/4N (2|25|36): objs=39564 size=714.24KiB /13/5N (2|25|36): objs=10109 size=53.97KiB /13/6S (2|25|36): objs=160 size=133B /13/7N (2|25|36): objs=459 size=1.57KiB /13/8S (2|25|36): objs=168 size=178B /13/9N (2|25|36): objs=1630 size=6.67KiB /13/10S (2|25|36): objs=135 size=228B /13/11S (2|25|36): objs=156 size=238B /13/12S (2|25|36): objs=155 size=257B /13/13S (2|25|36): objs=141 size=274B /13/14S (2|25|36): objs=140 size=273B /13/15N (2|25|36): objs=3749 size=17.2KiB /13/16S (2|25|36): objs=165 size=287B /13/17N (2|25|36): objs=3159 size=13.5KiB /13/18S (2|25|36): objs=149 size=297B /13/19N (2|25|36): objs=765 size=2.97KiB /13/20S (2|25|36): objs=155 size=170B /13/21N (2|25|36): objs=1682 size=7.23KiB /13/22S (2|25|36): objs=142 size=222B /13/24S (2|25|36): objs=133 size=201B /13/25N (2|25|36): objs=754 size=2.87KiB /13/26S (2|25|36): objs=143 size=188B /13/27N (2|25|36): objs=4026 size=19.28KiB /13/28S (2|25|36): objs=166 size=185B /13/29N (2|25|36): objs=808 size=3.2KiB /13/30S (2|25|36): objs=165 size=105B /13/31N (2|25|36): objs=620 size=2.26KiB /13/32S (2|25|36): objs=187 size=192B /13/33N (2|25|36): objs=769 size=2.91KiB /13/34S (2|25|36): objs=157 size=304B /13/35N (2|25|36): objs=10721 size=59.54KiB /14/0N (2|25|36): objs=42796 size=971.92KiB /14/1N (2|25|36): objs=36745 size=704.05KiB /14/2N (2|25|36): objs=38268 size=673.8KiB /14/3N (2|25|36): objs=3086 size=13.49KiB /14/4S (2|25|36): objs=152 size=189B /14/6S (2|25|36): objs=170 size=113B /14/7S (2|25|36): objs=130 size=304B /14/8S (2|25|36): objs=158 size=347B /14/9N (2|25|36): objs=2427 size=10.26KiB /14/10S (2|25|36): objs=137 size=123B /14/11N (2|25|36): objs=2427 size=9.94KiB /14/12S (2|25|36): objs=167 size=355B /14/13N (2|25|36): objs=2009 size=8.51KiB /14/14S (2|25|36): objs=172 size=115B /14/15N (2|25|36): objs=3627 size=17KiB /14/16S (2|25|36): objs=174 size=289B /14/17N (2|25|36): objs=1509 size=6.53KiB /14/18S (2|25|36): objs=164 size=225B /14/19N (2|25|36): objs=2739 size=11.4KiB /14/20S (2|25|36): objs=144 size=319B /14/21N (2|25|36): objs=4299 size=19.76KiB /14/22S (2|25|36): objs=152 size=283B /14/23N (2|25|36): objs=4644 size=20.5KiB /14/24S (2|25|36): objs=121 size=241B /14/25N (2|25|36): objs=292 size=699B /14/26S (2|25|36): objs=130 size=109B /14/27S (2|25|36): objs=141 size=143B /14/28S (2|25|36): objs=137 size=250B /14/29N (2|25|36): objs=4651 size=23.14KiB /14/30S (2|25|36): objs=151 size=209B /14/32S (2|25|36): objs=149 size=234B /14/33N (2|25|36): objs=1472 size=6.03KiB /14/34S (2|25|36): objs=151 size=259B /14/35N (2|25|36): objs=2716 size=11.71KiB /15/0N (2|25|36): objs=40153 size=832.55KiB /15/1N (2|25|36): objs=43297 size=1017.35KiB /15/2N (2|25|36): objs=28293 size=450.48KiB /15/3S (2|25|36): objs=152 size=300B /15/4N (2|25|36): objs=4774 size=22.36KiB /15/5S (2|25|36): objs=149 size=297B /15/6N (2|25|36): objs=3336 size=15.67KiB /15/7S (2|25|36): objs=153 size=198B /15/8N (2|25|36): objs=2514 size=11.34KiB /15/9N (2|25|36): objs=1520 size=6.31KiB /15/10S (2|25|36): objs=157 size=321B /15/11N (2|25|36): objs=2766 size=13.06KiB /15/12S (2|25|36): objs=155 size=236B /15/13N (2|25|36): objs=1882 size=7.72KiB /15/14S (2|25|36): objs=140 size=273B /15/15N (2|25|36): objs=640 size=2.1KiB /15/16S (2|25|36): objs=158 size=108B /15/17N (2|25|36): objs=3321 size=14.48KiB /15/18S (2|25|36): objs=154 size=323B /15/19N (2|25|36): objs=2299 size=9.98KiB /15/20S (2|25|36): objs=154 size=318B /15/21S (2|25|36): objs=164 size=263B /15/22S (2|25|36): objs=128 size=222B /15/23N (2|25|36): objs=478 size=1.66KiB /15/24S (2|25|36): objs=151 size=192B /15/25N (2|25|36): objs=481 size=1.6KiB /15/26S (2|25|36): objs=156 size=119B /15/27N (2|25|36): objs=5795 size=30.66KiB /15/28S (2|25|36): objs=158 size=258B /15/29N (2|25|36): objs=3201 size=13.5KiB /15/30S (2|25|36): objs=149 size=244B /15/31N (2|25|36): objs=1644 size=6.84KiB /15/32S (2|25|36): objs=162 size=292B /15/33N (2|25|36): objs=3952 size=16.78KiB /15/34S (2|25|36): objs=165 size=115B /15/35N (2|25|36): objs=4429 size=19.75KiB /16/0N (2|25|36): objs=42645 size=996.83KiB /16/1N (2|25|36): objs=42178 size=990.59KiB /16/2N (2|25|36): objs=37247 size=684.12KiB /16/3N (2|25|36): objs=10588 size=57.33KiB /16/4S (2|25|36): objs=169 size=349B /16/5N (2|25|36): objs=1977 size=8.29KiB /16/6S (2|25|36): objs=170 size=257B /16/7N (2|25|36): objs=318 size=971B /16/8S (2|25|36): objs=146 size=169B /16/9N (2|25|36): objs=6316 size=29.64KiB /16/10S (2|25|36): objs=156 size=203B /16/11N (2|25|36): objs=1970 size=8.39KiB /16/12S (2|25|36): objs=164 size=201B /16/13N (2|25|36): objs=746 size=2.86KiB /16/14S (2|25|36): objs=141 size=194B /16/15N (2|25|36): objs=1853 size=7.74KiB /16/16S (2|25|36): objs=144 size=136B /16/17N (2|25|36): objs=1644 size=6.77KiB /16/18S (2|25|36): objs=172 size=154B /16/19S (2|25|36): objs=146 size=210B /16/20S (2|25|36): objs=163 size=141B /16/21N (2|25|36): objs=4782 size=21.81KiB /16/22S (2|25|36): objs=145 size=133B /16/23N (2|25|36): objs=1018 size=4.1KiB /16/24S (2|25|36): objs=163 size=219B /16/25N (2|25|36): objs=1512 size=6.12KiB /16/26S (2|25|36): objs=175 size=214B /16/28S (2|25|36): objs=156 size=296B /16/30S (2|25|36): objs=136 size=161B /16/31S (2|25|36): objs=142 size=241B /16/32S (2|25|36): objs=148 size=329B /16/33S (2|25|36): objs=142 size=236B /16/34S (2|25|36): objs=151 size=145B /16/35N (2|25|36): objs=3614 size=15.13KiB /17/0N (2|25|36): objs=37927 size=753.31KiB /17/1N (2|25|36): objs=38686 size=832.59KiB /17/2N (2|25|36): objs=35915 size=605.83KiB /17/3N (2|25|36): objs=12261 size=65.34KiB /17/4S (2|25|36): objs=141 size=289B /17/5N (2|25|36): objs=1039 size=4.09KiB /17/6S (2|25|36): objs=175 size=278B /17/7N (2|25|36): objs=1888 size=7.73KiB /17/8S (2|25|36): objs=157 size=231B /17/9N (2|25|36): objs=469 size=1.62KiB /17/10S (2|25|36): objs=147 size=167B /17/11S (2|25|36): objs=161 size=117B /17/12S (2|25|36): objs=177 size=297B /17/13N (2|25|36): objs=1820 size=7.4KiB /17/14S (2|25|36): objs=152 size=98B /17/15N (2|25|36): objs=1334 size=5.37KiB /17/16S (2|25|36): objs=145 size=166B /17/17N (2|25|36): objs=1265 size=5.27KiB /17/18S (2|25|36): objs=153 size=270B /17/19N (2|25|36): objs=927 size=3.75KiB /17/20S (2|25|36): objs=151 size=133B /17/21N (2|25|36): objs=1196 size=4.78KiB /17/22S (2|25|36): objs=157 size=137B /17/23N (2|25|36): objs=1359 size=5.57KiB /17/24S (2|25|36): objs=176 size=141B /17/25N (2|25|36): objs=1588 size=6.56KiB /17/26S (2|25|36): objs=167 size=124B /17/27N (2|25|36): objs=3421 size=14.85KiB /17/28S (2|25|36): objs=141 size=138B /17/29S (2|25|36): objs=171 size=338B /17/30S (2|25|36): objs=167 size=184B /17/31N (2|25|36): objs=753 size=2.97KiB /17/32S (2|25|36): objs=140 size=199B /17/33N (2|25|36): objs=2504 size=10.55KiB /17/34S (2|25|36): objs=160 size=307B /17/35N (2|25|36): objs=898 size=3.57KiB /18/0N (2|25|36): objs=39521 size=860.27KiB /18/1N (2|25|36): objs=41705 size=854.73KiB /18/2N (2|25|36): objs=38800 size=852.64KiB /18/3N (2|25|36): objs=13715 size=80.1KiB /18/4S (2|25|36): objs=154 size=223B /18/5N (2|25|36): objs=595 size=2.09KiB /18/6S (2|25|36): objs=161 size=299B /18/7N (2|25|36): objs=588 size=2.18KiB /18/8S (2|25|36): objs=143 size=314B /18/9N (2|25|36): objs=8260 size=43.92KiB /18/10S (2|25|36): objs=134 size=132B /18/11N (2|25|36): objs=3316 size=14.76KiB /18/12S (2|25|36): objs=144 size=110B /18/13N (2|25|36): objs=308 size=888B /18/14S (2|25|36): objs=157 size=168B /18/15N (2|25|36): objs=1252 size=4.99KiB /18/16S (2|25|36): objs=147 size=150B /18/17N (2|25|36): objs=609 size=2.12KiB /18/18S (2|25|36): objs=129 size=147B /18/20S (2|25|36): objs=147 size=116B /18/21N (2|25|36): objs=2189 size=9.14KiB /18/22S (2|25|36): objs=182 size=221B /18/23N (2|25|36): objs=2284 size=10.62KiB /18/24S (2|25|36): objs=166 size=214B /18/25S (2|25|36): objs=151 size=131B /18/26S (2|25|36): objs=148 size=109B /18/28S (2|25|36): objs=168 size=300B /18/29N (2|25|36): objs=1838 size=7.98KiB /18/30S (2|25|36): objs=145 size=191B /18/31N (2|25|36): objs=320 size=1.1KiB /18/32S (2|25|36): objs=144 size=224B /18/33N (2|25|36): objs=292 size=894B /18/34S (2|25|36): objs=132 size=242B /18/35S (2|25|36): objs=152 size=333B /19/0N (2|25|36): objs=40359 size=780.12KiB /19/1N (2|25|36): objs=40834 size=804.8KiB /19/2N (2|25|36): objs=40850 size=907.15KiB /19/3N (2|25|36): objs=13992 size=97.07KiB /19/4S (2|25|36): objs=171 size=347B /19/5N (2|25|36): objs=616 size=2.44KiB /19/6S (2|25|36): objs=163 size=322B /19/7N (2|25|36): objs=761 size=2.89KiB /19/8S (2|25|36): objs=153 size=280B /19/9N (2|25|36): objs=1717 size=7.02KiB /19/10S (2|25|36): objs=159 size=284B /19/11N (2|25|36): objs=2562 size=10.77KiB /19/12S (2|25|36): objs=146 size=223B /19/13N (2|25|36): objs=740 size=2.74KiB /19/14S (2|25|36): objs=143 size=134B /19/15N (2|25|36): objs=1993 size=8.19KiB /19/16S (2|25|36): objs=168 size=193B /19/17S (2|25|36): objs=146 size=283B /19/18S (2|25|36): objs=145 size=153B /19/19N (2|25|36): objs=734 size=2.84KiB /19/20S (2|25|36): objs=146 size=311B /19/21N (2|25|36): objs=1837 size=7.45KiB /19/22S (2|25|36): objs=163 size=101B /19/23N (2|25|36): objs=3398 size=14.75KiB /19/24S (2|25|36): objs=140 size=236B /19/25N (2|25|36): objs=2261 size=9.19KiB /19/26S (2|25|36): objs=150 size=303B /19/27N (2|25|36): objs=3504 size=17.81KiB /19/28S (2|25|36): objs=148 size=130B /19/29N (2|25|36): objs=449 size=1.42KiB /19/30S (2|25|36): objs=140 size=317B /19/31N (2|25|36): objs=2669 size=11.19KiB /19/32S (2|25|36): objs=154 size=254B /19/33N (2|25|36): objs=2011 size=8.05KiB /19/34S (2|25|36): objs=143 size=317B /19/35N (2|25|36): objs=1754 size=7.07KiB /20/0N (2|25|36): objs=46297 size=1.21MiB /20/1N (2|25|36): objs=37560 size=750.84KiB /20/2N (2|25|36): objs=33356 size=593.63KiB /20/3S (2|25|36): objs=144 size=266B /20/4N (2|25|36): objs=7704 size=39.23KiB /20/5N (2|25|36): objs=15220 size=108.25KiB /20/6S (2|25|36): objs=143 size=269B /20/7N (2|25|36): objs=1345 size=5.64KiB /20/8S (2|25|36): objs=152 size=293B /20/9S (2|25|36): objs=156 size=272B /20/10S (2|25|36): objs=137 size=197B /20/11N (2|25|36): objs=2900 size=13.06KiB /20/12S (2|25|36): objs=172 size=150B /20/13N (2|25|36): objs=311 size=939B /20/14S (2|25|36): objs=156 size=109B /20/15N (2|25|36): objs=1370 size=5.59KiB /20/16S (2|25|36): objs=153 size=129B /20/17N (2|25|36): objs=5567 size=28.66KiB /20/18S (2|25|36): objs=148 size=178B /20/19N (2|25|36): objs=892 size=3.62KiB /20/20S (2|25|36): objs=151 size=126B /20/22S (2|25|36): objs=137 size=251B /20/23N (2|25|36): objs=902 size=3.46KiB /20/24S (2|25|36): objs=146 size=178B /20/25N (2|25|36): objs=835 size=3.08KiB /20/26S (2|25|36): objs=152 size=192B /20/27N (2|25|36): objs=1211 size=5.01KiB /20/28S (2|25|36): objs=141 size=244B /20/29N (2|25|36): objs=1972 size=8.39KiB /20/30S (2|25|36): objs=156 size=334B /20/31N (2|25|36): objs=1008 size=4.3KiB /20/32S (2|25|36): objs=146 size=107B /20/34S (2|25|36): objs=160 size=316B /20/35N (2|25|36): objs=902 size=3.59KiB /21/0N (2|25|36): objs=37737 size=679.47KiB /21/1N (2|25|36): objs=34877 size=580.05KiB /21/2N (2|25|36): objs=36970 size=727.46KiB /21/3N (2|25|36): objs=9255 size=45.93KiB /21/4S (2|25|36): objs=154 size=264B /21/5N (2|25|36): objs=14028 size=86.49KiB /21/6S (2|25|36): objs=165 size=286B /21/7N (2|25|36): objs=750 size=3.15KiB /21/8S (2|25|36): objs=146 size=248B /21/9N (2|25|36): objs=3178 size=14.51KiB /21/10S (2|25|36): objs=171 size=165B /21/11N (2|25|36): objs=902 size=3.48KiB /21/12S (2|25|36): objs=152 size=318B /21/13N (2|25|36): objs=322 size=1.06KiB /21/14S (2|25|36): objs=145 size=170B /21/16S (2|25|36): objs=155 size=177B /21/17S (2|25|36): objs=149 size=133B /21/18S (2|25|36): objs=146 size=87B /21/19N (2|25|36): objs=2109 size=8.67KiB /21/20S (2|25|36): objs=161 size=227B /21/21N (2|25|36): objs=1489 size=6.08KiB /21/22S (2|25|36): objs=153 size=158B /21/23N (2|25|36): objs=878 size=3.39KiB /21/24S (2|25|36): objs=161 size=268B /21/25S (2|25|36): objs=159 size=282B /21/26S (2|25|36): objs=149 size=233B /21/27S (2|25|36): objs=133 size=106B /21/28S (2|25|36): objs=162 size=286B /21/29N (2|25|36): objs=290 size=1008B /21/30S (2|25|36): objs=157 size=205B /21/31N (2|25|36): objs=1222 size=4.93KiB /21/32S (2|25|36): objs=145 size=302B /21/33N (2|25|36): objs=3115 size=16.2KiB /21/34S (2|25|36): objs=138 size=104B /21/35S (2|25|36): objs=157 size=238B /22/0N (2|25|36): objs=43750 size=1MiB /22/1N (2|25|36): objs=39714 size=792.82KiB /22/2N (2|25|36): objs=35905 size=621.11KiB /22/3N (2|25|36): objs=1856 size=7.95KiB /22/4S (2|25|36): objs=160 size=120B /22/5N (2|25|36): objs=555 size=2.16KiB /22/6S (2|25|36): objs=164 size=282B /22/7N (2|25|36): objs=1799 size=7.57KiB /22/8S (2|25|36): objs=145 size=145B /22/9N (2|25|36): objs=6303 size=29.17KiB /22/10S (2|25|36): objs=165 size=183B /22/11N (2|25|36): objs=2755 size=11.83KiB /22/12S (2|25|36): objs=160 size=322B /22/13N (2|25|36): objs=3932 size=16.93KiB /22/14S (2|25|36): objs=155 size=89B /22/15N (2|25|36): objs=601 size=2.36KiB /22/16S (2|25|36): objs=157 size=280B /22/17N (2|25|36): objs=308 size=772B /22/18S (2|25|36): objs=144 size=124B /22/19N (2|25|36): objs=2324 size=9.49KiB /22/20S (2|25|36): objs=148 size=254B /22/21N (2|25|36): objs=6541 size=31.14KiB /22/22S (2|25|36): objs=155 size=188B /22/23N (2|25|36): objs=2409 size=9.82KiB /22/24S (2|25|36): objs=154 size=127B /22/25N (2|25|36): objs=1498 size=6.25KiB /22/26S (2|25|36): objs=149 size=147B /22/27N (2|25|36): objs=1524 size=6.14KiB /22/28S (2|25|36): objs=137 size=302B /22/29N (2|25|36): objs=1516 size=6.1KiB /22/30S (2|25|36): objs=143 size=144B /22/31N (2|25|36): objs=2875 size=12.1KiB /22/32S (2|25|36): objs=168 size=281B /22/34S (2|25|36): objs=164 size=130B /22/35N (2|25|36): objs=1425 size=5.87KiB /23/0N (2|25|36): objs=35217 size=632.25KiB /23/1N (2|25|36): objs=42532 size=990.39KiB /23/2N (2|25|36): objs=23437 size=176.21KiB /23/3S (2|25|36): objs=153 size=153B /23/4N (2|25|36): objs=13042 size=83.95KiB /23/5N (2|25|36): objs=13467 size=84.85KiB /23/6S (2|25|36): objs=154 size=252B /23/8S (2|25|36): objs=155 size=314B /23/9N (2|25|36): objs=3319 size=16.26KiB /23/10S (2|25|36): objs=166 size=183B /23/11N (2|25|36): objs=3600 size=15.06KiB /23/12S (2|25|36): objs=138 size=184B /23/13N (2|25|36): objs=585 size=2.01KiB /23/14S (2|25|36): objs=176 size=211B /23/15S (2|25|36): objs=139 size=306B /23/16S (2|25|36): objs=134 size=324B /23/17N (2|25|36): objs=322 size=935B /23/18S (2|25|36): objs=152 size=195B /23/19N (2|25|36): objs=2023 size=8.21KiB /23/20S (2|25|36): objs=125 size=277B /23/21N (2|25|36): objs=1832 size=7.67KiB /23/22S (2|25|36): objs=161 size=109B /23/23N (2|25|36): objs=2748 size=12.69KiB /23/24S (2|25|36): objs=155 size=133B /23/25N (2|25|36): objs=1205 size=4.89KiB /23/26S (2|25|36): objs=155 size=308B /23/27N (2|25|36): objs=4405 size=19.55KiB /23/28S (2|25|36): objs=147 size=215B /23/29S (2|25|36): objs=153 size=89B /23/30S (2|25|36): objs=147 size=215B /23/31N (2|25|36): objs=637 size=2.33KiB /23/32S (2|25|36): objs=173 size=86B /23/33S (2|25|36): objs=178 size=326B /23/34S (2|25|36): objs=158 size=202B /23/35N (2|25|36): objs=1941 size=8.01KiB /24/0N (2|25|36): objs=38243 size=743.73KiB /24/1N (2|25|36): objs=41931 size=1MiB /24/2N (2|25|36): objs=23278 size=237.27KiB /24/3S (2|25|36): objs=155 size=305B /24/4N (2|25|36): objs=2753 size=11.47KiB /24/5S (2|25|36): objs=172 size=93B /24/6N (2|25|36): objs=577 size=2.2KiB /24/7S (2|25|36): objs=159 size=289B /24/8N (2|25|36): objs=3062 size=13.36KiB /24/9S (2|25|36): objs=169 size=190B /24/10N (2|25|36): objs=2132 size=8.87KiB /24/11S (2|25|36): objs=179 size=227B /24/12N (2|25|36): objs=2023 size=8.44KiB /24/13S (2|25|36): objs=165 size=132B /24/14N (2|25|36): objs=5811 size=28.58KiB /24/15N (2|25|36): objs=5308 size=23.51KiB /24/16S (2|25|36): objs=150 size=347B /24/17N (2|25|36): objs=274 size=794B /24/18S (2|25|36): objs=133 size=283B /24/19N (2|25|36): objs=316 size=903B /24/20S (2|25|36): objs=153 size=97B /24/21N (2|25|36): objs=5054 size=22.75KiB /24/22S (2|25|36): objs=164 size=323B /24/23N (2|25|36): objs=3834 size=17.05KiB /24/24S (2|25|36): objs=160 size=262B /24/25N (2|25|36): objs=3968 size=18.47KiB /24/26S (2|25|36): objs=148 size=160B /24/27N (2|25|36): objs=11459 size=65.09KiB /24/28S (2|25|36): objs=141 size=143B /24/29N (2|25|36): objs=801 size=2.96KiB /24/30S (2|25|36): objs=160 size=152B /24/31N (2|25|36): objs=1333 size=5.4KiB /24/32S (2|25|36): objs=137 size=304B /24/33N (2|25|36): objs=303 size=725B /24/34S (2|25|36): objs=166 size=282B /24/35N (2|25|36): objs=2932 size=12.31KiB /25/0N (2|25|36): objs=37341 size=878.6KiB /25/1N (2|25|36): objs=37997 size=804.17KiB /25/2N (2|25|36): objs=39687 size=927.17KiB /25/3N (2|25|36): objs=15715 size=109.69KiB /25/4S (2|25|36): objs=153 size=200B /25/6S (2|25|36): objs=148 size=211B /25/7N (2|25|36): objs=472 size=1.59KiB /25/8S (2|25|36): objs=160 size=214B /25/9N (2|25|36): objs=750 size=2.78KiB /25/10S (2|25|36): objs=142 size=117B /25/11N (2|25|36): objs=2690 size=11.12KiB /25/12S (2|25|36): objs=157 size=268B /25/13N (2|25|36): objs=934 size=3.83KiB /25/14S (2|25|36): objs=145 size=234B /25/15N (2|25|36): objs=1720 size=7.09KiB /25/16S (2|25|36): objs=150 size=131B /25/17N (2|25|36): objs=598 size=2.23KiB /25/18S (2|25|36): objs=138 size=302B /25/20S (2|25|36): objs=151 size=335B /25/21N (2|25|36): objs=2082 size=8.54KiB /25/22S (2|25|36): objs=135 size=212B /25/23N (2|25|36): objs=2867 size=12.28KiB /25/24S (2|25|36): objs=154 size=298B /25/25N (2|25|36): objs=1049 size=4.11KiB /25/26S (2|25|36): objs=162 size=252B /25/27N (2|25|36): objs=308 size=929B /25/28S (2|25|36): objs=143 size=208B /25/29N (2|25|36): objs=2131 size=8.99KiB /25/30S (2|25|36): objs=153 size=210B /25/31N (2|25|36): objs=1356 size=5.42KiB /25/32S (2|25|36): objs=148 size=135B /25/33N (2|25|36): objs=609 size=2.18KiB /25/34S (2|25|36): objs=131 size=208B /25/35N (2|25|36): objs=1039 size=4.24KiB /26/0N (2|25|36): objs=39281 size=769.89KiB /26/1N (2|25|36): objs=27925 size=306.05KiB /26/2S (2|25|36): objs=133 size=160B /26/3N (2|25|36): objs=11445 size=68.27KiB /26/4N (2|25|36): objs=40682 size=998.92KiB /26/5N (2|25|36): objs=11649 size=68.42KiB /26/6S (2|25|36): objs=146 size=300B /26/7N (2|25|36): objs=3095 size=14.64KiB /26/8S (2|25|36): objs=141 size=100B /26/9N (2|25|36): objs=300 size=886B /26/10S (2|25|36): objs=157 size=245B /26/11N (2|25|36): objs=1499 size=6.29KiB /26/12S (2|25|36): objs=159 size=287B /26/13N (2|25|36): objs=5351 size=23.74KiB /26/14S (2|25|36): objs=185 size=347B /26/15N (2|25|36): objs=331 size=822B /26/16S (2|25|36): objs=171 size=162B /26/17N (2|25|36): objs=2824 size=13.3KiB /26/18S (2|25|36): objs=158 size=278B /26/20S (2|25|36): objs=172 size=211B /26/22S (2|25|36): objs=158 size=169B /26/23N (2|25|36): objs=1974 size=8.17KiB /26/24S (2|25|36): objs=130 size=237B /26/25N (2|25|36): objs=4171 size=18.6KiB /26/26S (2|25|36): objs=163 size=144B /26/27N (2|25|36): objs=3017 size=14.72KiB /26/28S (2|25|36): objs=143 size=94B /26/29N (2|25|36): objs=2380 size=10.76KiB /26/30S (2|25|36): objs=162 size=244B /26/31N (2|25|36): objs=452 size=1.62KiB /26/32S (2|25|36): objs=151 size=267B /26/33N (2|25|36): objs=2343 size=9.94KiB /26/34S (2|25|36): objs=151 size=243B /26/35S (2|25|36): objs=157 size=125B /27/0N (2|25|36): objs=35132 size=655.89KiB /27/1N (2|25|36): objs=40561 size=1.04MiB /27/2N (2|25|36): objs=23289 size=210.32KiB /27/3S (2|25|36): objs=146 size=234B /27/4N (2|25|36): objs=13117 size=76.21KiB /27/5N (2|25|36): objs=3213 size=13.66KiB /27/6S (2|25|36): objs=140 size=151B /27/8S (2|25|36): objs=129 size=258B /27/9N (2|25|36): objs=4515 size=19.87KiB /27/10S (2|25|36): objs=162 size=117B /27/12S (2|25|36): objs=166 size=305B /27/13N (2|25|36): objs=615 size=2.39KiB /27/14S (2|25|36): objs=160 size=232B /27/15N (2|25|36): objs=3369 size=15.6KiB /27/16S (2|25|36): objs=152 size=345B /27/17N (2|25|36): objs=1987 size=8.16KiB /27/18S (2|25|36): objs=141 size=184B /27/19N (2|25|36): objs=794 size=2.84KiB /27/20S (2|25|36): objs=132 size=234B /27/21N (2|25|36): objs=2854 size=11.85KiB /27/22S (2|25|36): objs=161 size=111B /27/23N (2|25|36): objs=939 size=3.71KiB /27/24S (2|25|36): objs=145 size=307B /27/25N (2|25|36): objs=5506 size=25.06KiB /27/26S (2|25|36): objs=141 size=145B /27/27N (2|25|36): objs=6354 size=30.15KiB /27/28S (2|25|36): objs=174 size=141B /27/29N (2|25|36): objs=1009 size=4.12KiB /27/30S (2|25|36): objs=149 size=96B /27/31S (2|25|36): objs=150 size=178B /27/32S (2|25|36): objs=152 size=122B /27/33N (2|25|36): objs=5278 size=25.71KiB /27/34S (2|25|36): objs=158 size=189B /27/35N (2|25|36): objs=1509 size=5.99KiB /28/0N (2|25|36): objs=37340 size=780.19KiB /28/1N (2|25|36): objs=38443 size=794.81KiB /28/2N (2|25|36): objs=32428 size=612.49KiB /28/3S (2|25|36): objs=158 size=324B /28/4N (2|25|36): objs=4495 size=20.99KiB /28/5S (2|25|36): objs=150 size=284B /28/6N (2|25|36): objs=2070 size=8.47KiB /28/7S (2|25|36): objs=168 size=202B /28/8N (2|25|36): objs=771 size=2.91KiB /28/9N (2|25|36): objs=460 size=1.47KiB /28/10S (2|25|36): objs=161 size=136B /28/11N (2|25|36): objs=468 size=1.58KiB /28/12S (2|25|36): objs=135 size=142B /28/13N (2|25|36): objs=4248 size=18.81KiB /28/14S (2|25|36): objs=168 size=218B /28/15N (2|25|36): objs=4850 size=21.81KiB /28/16S (2|25|36): objs=135 size=282B /28/17N (2|25|36): objs=9522 size=57.27KiB /28/18S (2|25|36): objs=170 size=208B /28/19N (2|25|36): objs=1585 size=6.49KiB /28/20S (2|25|36): objs=172 size=173B /28/21N (2|25|36): objs=1538 size=6.2KiB /28/22S (2|25|36): objs=175 size=200B /28/23N (2|25|36): objs=1356 size=5.53KiB /28/24S (2|25|36): objs=150 size=165B /28/26S (2|25|36): objs=157 size=90B /28/27N (2|25|36): objs=3664 size=15.97KiB /28/28S (2|25|36): objs=169 size=210B /28/29N (2|25|36): objs=4718 size=22.05KiB /28/30S (2|25|36): objs=166 size=97B /28/31N (2|25|36): objs=1602 size=6.59KiB /28/32S (2|25|36): objs=157 size=163B /28/33N (2|25|36): objs=437 size=1.68KiB /28/34S (2|25|36): objs=165 size=297B /28/35S (2|25|36): objs=147 size=302B /29/0N (2|25|36): objs=35959 size=634.97KiB /29/1N (2|25|36): objs=41258 size=950.65KiB /29/2N (2|25|36): objs=31664 size=503.5KiB /29/3S (2|25|36): objs=180 size=340B /29/4N (2|25|36): objs=4445 size=19.7KiB /29/5S (2|25|36): objs=145 size=219B /29/6N (2|25|36): objs=5830 size=27.07KiB /29/7S (2|25|36): objs=155 size=214B /29/8N (2|25|36): objs=1068 size=4.23KiB /29/9N (2|25|36): objs=2228 size=9.41KiB /29/10S (2|25|36): objs=162 size=225B /29/11N (2|25|36): objs=603 size=2.26KiB /29/12S (2|25|36): objs=147 size=332B /29/13N (2|25|36): objs=910 size=3.6KiB /29/14S (2|25|36): objs=154 size=182B /29/15N (2|25|36): objs=6113 size=31.53KiB /29/16S (2|25|36): objs=132 size=214B /29/17N (2|25|36): objs=1238 size=5.07KiB /29/18S (2|25|36): objs=151 size=259B /29/19N (2|25|36): objs=1365 size=5.64KiB /29/20S (2|25|36): objs=160 size=91B /29/21N (2|25|36): objs=1289 size=5.52KiB /29/22S (2|25|36): objs=182 size=302B /29/23N (2|25|36): objs=2998 size=12.61KiB /29/24S (2|25|36): objs=147 size=277B /29/25N (2|25|36): objs=1674 size=6.93KiB /29/26S (2|25|36): objs=140 size=290B /29/27S (2|25|36): objs=164 size=334B /29/28S (2|25|36): objs=151 size=279B /29/29N (2|25|36): objs=6495 size=33.77KiB /29/30S (2|25|36): objs=137 size=245B /29/31N (2|25|36): objs=7710 size=42.56KiB /29/32S (2|25|36): objs=136 size=255B /29/33N (2|25|36): objs=1506 size=6.22KiB /29/34S (2|25|36): objs=161 size=279B /29/35N (2|25|36): objs=2250 size=9.24KiB /30/0N (2|25|36): objs=37413 size=717.31KiB /30/1N (2|25|36): objs=40740 size=1.02MiB /30/2N (2|25|36): objs=28511 size=422.7KiB /30/3S (2|25|36): objs=154 size=232B /30/4N (2|25|36): objs=10602 size=58.01KiB /30/5N (2|25|36): objs=5813 size=26.01KiB /30/6S (2|25|36): objs=143 size=113B /30/7N (2|25|36): objs=2425 size=10.04KiB /30/8S (2|25|36): objs=177 size=246B /30/9N (2|25|36): objs=1367 size=5.77KiB /30/10S (2|25|36): objs=136 size=110B /30/11N (2|25|36): objs=6522 size=32.93KiB /30/12S (2|25|36): objs=176 size=249B /30/14S (2|25|36): objs=138 size=287B /30/15N (2|25|36): objs=5224 size=22.44KiB /30/16S (2|25|36): objs=145 size=148B /30/17N (2|25|36): objs=440 size=1.53KiB /30/18S (2|25|36): objs=150 size=225B /30/19N (2|25|36): objs=3812 size=17.11KiB /30/20S (2|25|36): objs=185 size=166B /30/21N (2|25|36): objs=1233 size=4.78KiB /30/22S (2|25|36): objs=135 size=307B /30/23N (2|25|36): objs=581 size=2.29KiB /30/24S (2|25|36): objs=155 size=269B /30/25N (2|25|36): objs=2492 size=10.15KiB /30/26S (2|25|36): objs=142 size=228B /30/27N (2|25|36): objs=1807 size=7.5KiB /30/28S (2|25|36): objs=153 size=301B /30/29N (2|25|36): objs=302 size=819B /30/30S (2|25|36): objs=176 size=285B /30/31N (2|25|36): objs=637 size=2.34KiB /30/32S (2|25|36): objs=155 size=269B /30/33N (2|25|36): objs=2447 size=10.25KiB /30/34S (2|25|36): objs=178 size=92B /30/35N (2|25|36): objs=1682 size=6.94KiB /31/0N (2|25|36): objs=36756 size=706.21KiB /31/1N (2|25|36): objs=38599 size=802.86KiB /31/2N (2|25|36): objs=33368 size=585.82KiB /31/3N (2|25|36): objs=2883 size=13.65KiB /31/4S (2|25|36): objs=150 size=202B /31/5N (2|25|36): objs=2532 size=10.48KiB /31/6S (2|25|36): objs=156 size=258B /31/7N (2|25|36): objs=3627 size=17.07KiB /31/8S (2|25|36): objs=150 size=250B /31/9N (2|25|36): objs=1990 size=8.13KiB /31/10S (2|25|36): objs=154 size=236B /31/11N (2|25|36): objs=4897 size=23.06KiB /31/12S (2|25|36): objs=148 size=130B /31/13N (2|25|36): objs=4207 size=19.25KiB /31/14S (2|25|36): objs=143 size=258B /31/15N (2|25|36): objs=1999 size=8.45KiB /31/16S (2|25|36): objs=143 size=256B /31/17N (2|25|36): objs=1338 size=5.48KiB /31/18S (2|25|36): objs=152 size=269B /31/19N (2|25|36): objs=906 size=3.5KiB /31/20S (2|25|36): objs=139 size=298B /31/22S (2|25|36): objs=146 size=322B /31/23N (2|25|36): objs=2780 size=12.66KiB /31/24S (2|25|36): objs=145 size=102B /31/25S (2|25|36): objs=157 size=118B /31/26S (2|25|36): objs=157 size=110B /31/27N (2|25|36): objs=2747 size=11.66KiB /31/28S (2|25|36): objs=142 size=225B /31/29N (2|25|36): objs=477 size=1.51KiB /31/30S (2|25|36): objs=176 size=294B /31/31N (2|25|36): objs=3102 size=13.35KiB /31/32S (2|25|36): objs=167 size=275B /31/33N (2|25|36): objs=2382 size=10.06KiB /31/34S (2|25|36): objs=145 size=142B /31/35N (2|25|36): objs=3174 size=14.25KiB com.milaboratory.util.sorting.HashSorterTest > test2 SKIPPED com.milaboratory.util.sorting.SortingUtilTest > test1 STANDARD_OUT Collation: 244.27ms Sorting: 145.29ms 1 217 41506 99500 99997 com.milaboratory.util.VersionInfoTest > test3 SKIPPED Gradle Test Executor 1 finished executing tests. WARNING: A terminally deprecated method in java.lang.System has been called WARNING: System::setSecurityManager has been called by org.gradle.api.internal.tasks.testing.worker.TestWorker (file:/usr/share/gradle/lib/plugins/gradle-testing-base-4.4.1.jar) WARNING: Please consider reporting this to the maintainers of org.gradle.api.internal.tasks.testing.worker.TestWorker WARNING: System::setSecurityManager will be removed in a future release Finished generating test XML results (1.166 secs) into: /build/reproducible-path/milib-2.2.0+dfsg/build/test-results/test Generating HTML test report... Finished generating test html results (1.311 secs) into: /build/reproducible-path/milib-2.2.0+dfsg/build/reports/tests/test :test (Thread[Task worker for ':',5,main]) completed. Took 4 mins 41.861 secs. BUILD SUCCESSFUL in 5m 17s 5 actionable tasks: 3 executed, 2 up-to-date create-stamp debian/debhelper-build-stamp dh_prep dh_auto_install --destdir=debian/libmilib-java/ mh_install jh_installjavadoc dh_installdocs dh_installchangelogs dh_perl dh_link jh_installlibs jh_classpath jh_manifest jh_depends dh_strip_nondeterminism dh_compress dh_fixperms dh_missing dh_installdeb dh_gencontrol dh_md5sums dh_builddeb dpkg-deb: building package 'libmilib-java' in '../libmilib-java_2.2.0+dfsg-1_all.deb'. dpkg-genbuildinfo --build=binary -O../milib_2.2.0+dfsg-1_arm64.buildinfo dpkg-genchanges --build=binary -O../milib_2.2.0+dfsg-1_arm64.changes dpkg-genchanges: info: binary-only upload (no source code included) dpkg-source --after-build . dpkg-buildpackage: info: binary-only upload (no source included) dpkg-genchanges: info: including full source code in upload I: copying local configuration I: user script /srv/workspace/pbuilder/1445111/tmp/hooks/B01_cleanup starting I: user script /srv/workspace/pbuilder/1445111/tmp/hooks/B01_cleanup finished I: unmounting dev/ptmx filesystem I: unmounting dev/pts filesystem I: unmounting dev/shm filesystem I: unmounting proc filesystem I: unmounting sys filesystem I: cleaning the build env I: removing directory /srv/workspace/pbuilder/1445111 and its subdirectories I: Current time: Thu May 22 19:33:21 +14 2025 I: pbuilder-time-stamp: 1747892001