I: pbuilder: network access will be disabled during build I: Current time: Wed May 10 11:08:34 -12 2023 I: pbuilder-time-stamp: 1683760114 I: Building the build Environment I: extracting base tarball [/var/cache/pbuilder/bookworm-reproducible-base.tgz] I: copying local configuration W: --override-config is not set; not updating apt.conf Read the manpage for details. I: mounting /proc filesystem I: mounting /sys filesystem I: creating /{dev,run}/shm I: mounting /dev/pts filesystem I: redirecting /dev/ptmx to /dev/pts/ptmx I: policy-rc.d already exists I: using eatmydata during job I: Copying source file I: copying [milib_2.2.0+dfsg-1.dsc] I: copying [./milib_2.2.0+dfsg.orig.tar.xz] I: copying [./milib_2.2.0+dfsg-1.debian.tar.xz] I: Extracting source gpgv: Signature made Fri Dec 30 02:08:01 2022 -12 gpgv: using RSA key 33CB284313E90BD27DCB4523600316A6DC277476 gpgv: Can't check signature: No public key dpkg-source: warning: cannot verify inline signature for ./milib_2.2.0+dfsg-1.dsc: no acceptable signature found dpkg-source: info: extracting milib in milib-2.2.0+dfsg dpkg-source: info: unpacking milib_2.2.0+dfsg.orig.tar.xz dpkg-source: info: unpacking milib_2.2.0+dfsg-1.debian.tar.xz dpkg-source: info: using patch list from debian/patches/series dpkg-source: info: applying build_gradle.patch dpkg-source: info: applying guava_interface.patch dpkg-source: info: applying deactivate_test_reading_build_properties.patch dpkg-source: info: applying flaky_test.patch I: Not using root during the build. I: Installing the build-deps I: user script /srv/workspace/pbuilder/960/tmp/hooks/D02_print_environment starting I: set BUILDDIR='/build' BUILDUSERGECOS='first user,first room,first work-phone,first home-phone,first other' BUILDUSERNAME='pbuilder1' BUILD_ARCH='i386' DEBIAN_FRONTEND='noninteractive' DEB_BUILD_OPTIONS='buildinfo=+all reproducible=+all parallel=8' DISTRIBUTION='bookworm' HOME='/root' HOST_ARCH='i386' IFS=' ' INVOCATION_ID='fece100921194176aff9ac9b963d2d06' LANG='C' LANGUAGE='en_US:en' LC_ALL='C' LD_LIBRARY_PATH='/usr/lib/libeatmydata' LD_PRELOAD='libeatmydata.so' MAIL='/var/mail/root' OPTIND='1' PATH='/usr/sbin:/usr/bin:/sbin:/bin:/usr/games' PBCURRENTCOMMANDLINEOPERATION='build' PBUILDER_OPERATION='build' PBUILDER_PKGDATADIR='/usr/share/pbuilder' PBUILDER_PKGLIBDIR='/usr/lib/pbuilder' PBUILDER_SYSCONFDIR='/etc' PPID='960' PS1='# ' PS2='> ' PS4='+ ' PWD='/' SHELL='/bin/bash' SHLVL='2' SUDO_COMMAND='/usr/bin/timeout -k 18.1h 18h /usr/bin/ionice -c 3 /usr/bin/nice /usr/sbin/pbuilder --build --configfile /srv/reproducible-results/rbuild-debian/r-b-build.kGPYLzJ6/pbuilderrc_FB3J --distribution bookworm --hookdir /etc/pbuilder/first-build-hooks --debbuildopts -b --basetgz /var/cache/pbuilder/bookworm-reproducible-base.tgz --buildresult /srv/reproducible-results/rbuild-debian/r-b-build.kGPYLzJ6/b1 --logfile b1/build.log milib_2.2.0+dfsg-1.dsc' SUDO_GID='112' SUDO_UID='107' SUDO_USER='jenkins' TERM='unknown' TZ='/usr/share/zoneinfo/Etc/GMT+12' USER='root' _='/usr/bin/systemd-run' http_proxy='http://78.137.99.97:3128' I: uname -a Linux ionos12-i386 5.10.0-22-686-pae #1 SMP Debian 5.10.178-3 (2023-04-22) i686 GNU/Linux I: ls -l /bin total 6036 -rwxr-xr-x 1 root root 1408088 Apr 23 09:24 bash -rwxr-xr-x 3 root root 38404 Sep 18 2022 bunzip2 -rwxr-xr-x 3 root root 38404 Sep 18 2022 bzcat lrwxrwxrwx 1 root root 6 Sep 18 2022 bzcmp -> bzdiff -rwxr-xr-x 1 root root 2225 Sep 18 2022 bzdiff lrwxrwxrwx 1 root root 6 Sep 18 2022 bzegrep -> bzgrep -rwxr-xr-x 1 root root 4893 Nov 27 2021 bzexe lrwxrwxrwx 1 root root 6 Sep 18 2022 bzfgrep -> bzgrep -rwxr-xr-x 1 root root 3775 Sep 18 2022 bzgrep -rwxr-xr-x 3 root root 38404 Sep 18 2022 bzip2 -rwxr-xr-x 1 root root 17892 Sep 18 2022 bzip2recover lrwxrwxrwx 1 root root 6 Sep 18 2022 bzless -> bzmore -rwxr-xr-x 1 root root 1297 Sep 18 2022 bzmore -rwxr-xr-x 1 root root 42920 Sep 20 2022 cat -rwxr-xr-x 1 root root 79816 Sep 20 2022 chgrp -rwxr-xr-x 1 root root 67496 Sep 20 2022 chmod -rwxr-xr-x 1 root root 79816 Sep 20 2022 chown -rwxr-xr-x 1 root root 162024 Sep 20 2022 cp -rwxr-xr-x 1 root root 136916 Jan 5 01:20 dash -rwxr-xr-x 1 root root 137160 Sep 20 2022 date -rwxr-xr-x 1 root root 100364 Sep 20 2022 dd -rwxr-xr-x 1 root root 108940 Sep 20 2022 df -rwxr-xr-x 1 root root 162152 Sep 20 2022 dir -rwxr-xr-x 1 root root 87760 Mar 22 22:20 dmesg lrwxrwxrwx 1 root root 8 Dec 19 01:33 dnsdomainname -> hostname lrwxrwxrwx 1 root root 8 Dec 19 01:33 domainname -> hostname -rwxr-xr-x 1 root root 38760 Sep 20 2022 echo -rwxr-xr-x 1 root root 41 Jan 24 02:43 egrep -rwxr-xr-x 1 root root 34664 Sep 20 2022 false -rwxr-xr-x 1 root root 41 Jan 24 02:43 fgrep -rwxr-xr-x 1 root root 84272 Mar 22 22:20 findmnt -rwsr-xr-x 1 root root 30240 Mar 22 20:38 fusermount -rwxr-xr-x 1 root root 218680 Jan 24 02:43 grep -rwxr-xr-x 2 root root 2346 Apr 9 2022 gunzip -rwxr-xr-x 1 root root 6447 Apr 9 2022 gzexe -rwxr-xr-x 1 root root 100952 Apr 9 2022 gzip -rwxr-xr-x 1 root root 21916 Dec 19 01:33 hostname -rwxr-xr-x 1 root root 75756 Sep 20 2022 ln -rwxr-xr-x 1 root root 55600 Mar 22 23:43 login -rwxr-xr-x 1 root root 162152 Sep 20 2022 ls -rwxr-xr-x 1 root root 214568 Mar 22 22:20 lsblk -rwxr-xr-x 1 root root 96328 Sep 20 2022 mkdir -rwxr-xr-x 1 root root 84008 Sep 20 2022 mknod -rwxr-xr-x 1 root root 38792 Sep 20 2022 mktemp -rwxr-xr-x 1 root root 63016 Mar 22 22:20 more -rwsr-xr-x 1 root root 58912 Mar 22 22:20 mount -rwxr-xr-x 1 root root 13856 Mar 22 22:20 mountpoint -rwxr-xr-x 1 root root 157932 Sep 20 2022 mv lrwxrwxrwx 1 root root 8 Dec 19 01:33 nisdomainname -> hostname lrwxrwxrwx 1 root root 14 Apr 2 18:25 pidof -> /sbin/killall5 -rwxr-xr-x 1 root root 38792 Sep 20 2022 pwd lrwxrwxrwx 1 root root 4 Apr 23 09:24 rbash -> bash -rwxr-xr-x 1 root root 51080 Sep 20 2022 readlink -rwxr-xr-x 1 root root 75720 Sep 20 2022 rm -rwxr-xr-x 1 root root 51080 Sep 20 2022 rmdir -rwxr-xr-x 1 root root 22308 Nov 2 2022 run-parts -rwxr-xr-x 1 root root 133224 Jan 5 07:55 sed lrwxrwxrwx 1 root root 4 Jan 5 01:20 sh -> dash -rwxr-xr-x 1 root root 38760 Sep 20 2022 sleep -rwxr-xr-x 1 root root 87976 Sep 20 2022 stty -rwsr-xr-x 1 root root 83492 Mar 22 22:20 su -rwxr-xr-x 1 root root 38792 Sep 20 2022 sync -rwxr-xr-x 1 root root 598456 Apr 6 02:25 tar -rwxr-xr-x 1 root root 13860 Nov 2 2022 tempfile -rwxr-xr-x 1 root root 120776 Sep 20 2022 touch -rwxr-xr-x 1 root root 34664 Sep 20 2022 true -rwxr-xr-x 1 root root 17892 Mar 22 20:38 ulockmgr_server -rwsr-xr-x 1 root root 30236 Mar 22 22:20 umount -rwxr-xr-x 1 root root 38760 Sep 20 2022 uname -rwxr-xr-x 2 root root 2346 Apr 9 2022 uncompress -rwxr-xr-x 1 root root 162152 Sep 20 2022 vdir -rwxr-xr-x 1 root root 71216 Mar 22 22:20 wdctl lrwxrwxrwx 1 root root 8 Dec 19 01:33 ypdomainname -> hostname -rwxr-xr-x 1 root root 1984 Apr 9 2022 zcat -rwxr-xr-x 1 root root 1678 Apr 9 2022 zcmp -rwxr-xr-x 1 root root 6460 Apr 9 2022 zdiff -rwxr-xr-x 1 root root 29 Apr 9 2022 zegrep -rwxr-xr-x 1 root root 29 Apr 9 2022 zfgrep -rwxr-xr-x 1 root root 2081 Apr 9 2022 zforce -rwxr-xr-x 1 root root 8103 Apr 9 2022 zgrep -rwxr-xr-x 1 root root 2206 Apr 9 2022 zless -rwxr-xr-x 1 root root 1842 Apr 9 2022 zmore -rwxr-xr-x 1 root root 4577 Apr 9 2022 znew I: user script /srv/workspace/pbuilder/960/tmp/hooks/D02_print_environment finished -> Attempting to satisfy build-dependencies -> Creating pbuilder-satisfydepends-dummy package Package: pbuilder-satisfydepends-dummy Version: 0.invalid.0 Architecture: i386 Maintainer: Debian Pbuilder Team Description: Dummy package to satisfy dependencies with aptitude - created by pbuilder This package was created automatically by pbuilder to satisfy the build-dependencies of the package being currently built. Depends: debhelper-compat (= 13), default-jdk, gradle-debian-helper, javahelper, maven-repo-helper, junit4, libcommons-compress-java, libcommons-io-java, libcommons-math3-java, libguava-java, libjackson2-annotations-java, libjackson2-core-java, libjackson2-databind-java, libjcommander-java, liblz4-java, libmockito-java, libredberry-pipe-java, libtrove3-java dpkg-deb: building package 'pbuilder-satisfydepends-dummy' in '/tmp/satisfydepends-aptitude/pbuilder-satisfydepends-dummy.deb'. Selecting previously unselected package pbuilder-satisfydepends-dummy. (Reading database ... 19604 files and directories currently installed.) Preparing to unpack .../pbuilder-satisfydepends-dummy.deb ... Unpacking pbuilder-satisfydepends-dummy (0.invalid.0) ... dpkg: pbuilder-satisfydepends-dummy: dependency problems, but configuring anyway as you requested: pbuilder-satisfydepends-dummy depends on debhelper-compat (= 13); however: Package debhelper-compat is not installed. pbuilder-satisfydepends-dummy depends on default-jdk; however: Package default-jdk is not installed. pbuilder-satisfydepends-dummy depends on gradle-debian-helper; however: Package gradle-debian-helper is not installed. pbuilder-satisfydepends-dummy depends on javahelper; however: Package javahelper is not installed. pbuilder-satisfydepends-dummy depends on maven-repo-helper; however: Package maven-repo-helper is not installed. pbuilder-satisfydepends-dummy depends on junit4; however: Package junit4 is not installed. pbuilder-satisfydepends-dummy depends on libcommons-compress-java; however: Package libcommons-compress-java is not installed. pbuilder-satisfydepends-dummy depends on libcommons-io-java; however: Package libcommons-io-java is not installed. pbuilder-satisfydepends-dummy depends on libcommons-math3-java; however: Package libcommons-math3-java is not installed. pbuilder-satisfydepends-dummy depends on libguava-java; however: Package libguava-java is not installed. pbuilder-satisfydepends-dummy depends on libjackson2-annotations-java; however: Package libjackson2-annotations-java is not installed. pbuilder-satisfydepends-dummy depends on libjackson2-core-java; however: Package libjackson2-core-java is not installed. pbuilder-satisfydepends-dummy depends on libjackson2-databind-java; however: Package libjackson2-databind-java is not installed. pbuilder-satisfydepends-dummy depends on libjcommander-java; however: Package libjcommander-java is not installed. pbuilder-satisfydepends-dummy depends on liblz4-java; however: Package liblz4-java is not installed. pbuilder-satisfydepends-dummy depends on libmockito-java; however: Package libmockito-java is not installed. pbuilder-satisfydepends-dummy depends on libredberry-pipe-java; however: Package libredberry-pipe-java is not installed. pbuilder-satisfydepends-dummy depends on libtrove3-java; however: Package libtrove3-java is not installed. Setting up pbuilder-satisfydepends-dummy (0.invalid.0) ... Reading package lists... Building dependency tree... Reading state information... Initializing package states... Writing extended state information... Building tag database... pbuilder-satisfydepends-dummy is already installed at the requested version (0.invalid.0) pbuilder-satisfydepends-dummy is already installed at the requested version (0.invalid.0) The following NEW packages will be installed: adwaita-icon-theme{a} ant{a} ant-optional{a} antlr{a} at-spi2-common{a} autoconf{a} automake{a} autopoint{a} autotools-dev{a} bnd{a} bsdextrautils{a} ca-certificates{a} ca-certificates-java{a} dctrl-tools{a} debhelper{a} default-jdk{a} default-jdk-headless{a} default-jre{a} default-jre-headless{a} devscripts{a} dh-autoreconf{a} dh-strip-nondeterminism{a} dirmngr{a} dwz{a} file{a} fontconfig{a} fontconfig-config{a} fonts-dejavu-core{a} gettext{a} gettext-base{a} gnupg{a} gnupg-l10n{a} gnupg-utils{a} gpg{a} gpg-agent{a} gpg-wks-client{a} gpg-wks-server{a} gpgconf{a} gpgsm{a} gradle{a} gradle-debian-helper{a} groff-base{a} groovy{a} gtk-update-icon-cache{a} hicolor-icon-theme{a} intltool-debian{a} ivy{a} java-common{a} java-wrappers{a} javahelper{a} junit4{a} libantlr-java{a} libaopalliance-java{a} libapache-pom-java{a} libarchive-zip-perl{a} libasm-java{a} libasound2{a} libasound2-data{a} libassuan0{a} libatinject-jsr330-api-java{a} libatk1.0-0{a} libavahi-client3{a} libavahi-common-data{a} libavahi-common3{a} libb-hooks-op-check-perl{a} libbcel-java{a} libbcpg-java{a} libbcprov-java{a} libbrotli1{a} libbsd0{a} libbsf-java{a} libbsh-java{a} libbyte-buddy-java{a} libcairo2{a} libcdi-api-java{a} libclass-method-modifiers-perl{a} libclass-xsaccessor-perl{a} libclone-perl{a} libcommons-cli-java{a} libcommons-codec-java{a} libcommons-collections3-java{a} libcommons-compress-java{a} libcommons-io-java{a} libcommons-lang-java{a} libcommons-lang3-java{a} libcommons-logging-java{a} libcommons-math3-java{a} libcommons-parent-java{a} libcups2{a} libdatrie1{a} libdbus-1-3{a} libdd-plist-java{a} libdebhelper-perl{a} libdeflate0{a} libdevel-callchecker-perl{a} libdom4j-java{a} libdrm-amdgpu1{a} libdrm-common{a} libdrm-intel1{a} libdrm-nouveau2{a} libdrm-radeon1{a} libdrm2{a} libdynaloader-functions-perl{a} libeclipse-jdt-annotation-java{a} libedit2{a} libel-api-java{a} libelf1{a} libencode-locale-perl{a} liberror-prone-java{a} libexpat1{a} libfelix-framework-java{a} libfelix-gogo-runtime-java{a} libfelix-resolver-java{a} libfile-dirlist-perl{a} libfile-homedir-perl{a} libfile-listing-perl{a} libfile-stripnondeterminism-perl{a} libfile-touch-perl{a} libfile-which-perl{a} libfindbugs-java{a} libfontconfig1{a} libfreetype6{a} libfribidi0{a} libgdk-pixbuf-2.0-0{a} libgdk-pixbuf2.0-common{a} libgeronimo-annotation-1.3-spec-java{a} libgeronimo-interceptor-3.0-spec-java{a} libgif7{a} libgl1{a} libgl1-mesa-dri{a} libglapi-mesa{a} libglib2.0-0{a} libglvnd0{a} libglx-mesa0{a} libglx0{a} libgoogle-gson-java{a} libgradle-core-java{a} libgradle-plugins-java{a} libgraphite2-3{a} libgtk2.0-0{a} libgtk2.0-common{a} libguava-java{a} libguice-java{a} libhamcrest-java{a} libharfbuzz0b{a} libhawtjni-runtime-java{a} libhtml-parser-perl{a} libhtml-tagset-perl{a} libhtml-tree-perl{a} libhttp-cookies-perl{a} libhttp-date-perl{a} libhttp-message-perl{a} libhttp-negotiate-perl{a} libhttpclient-java{a} libhttpcore-java{a} libicu72{a} libimport-into-perl{a} libio-html-perl{a} libio-pty-perl{a} libio-socket-ssl-perl{a} libipc-run-perl{a} libjackson2-annotations-java{a} libjackson2-core-java{a} libjackson2-databind-java{a} libjansi-java{a} libjansi-native-java{a} libjansi1-java{a} libjarjar-java{a} libjatl-java{a} libjavaewah-java{a} libjaxen-java{a} libjbig0{a} libjcifs-java{a} libjcip-annotations-java{a} libjcommander-java{a} libjetty9-java{a} libjformatstring-java{a} libjgit-java{a} libjline2-java{a} libjna-java{a} libjna-jni{a} libjpeg62-turbo{a} libjs-jquery{a} libjsch-java{a} libjsoup-java{a} libjsp-api-java{a} libjsr305-java{a} libjzlib-java{a} libkryo-java{a} libksba8{a} liblcms2-2{a} libldap-2.5-0{a} liblerc4{a} libllvm15{a} liblogback-java{a} liblwp-mediatypes-perl{a} liblwp-protocol-https-perl{a} liblz4-java{a} liblz4-jni{a} libmagic-mgc{a} libmagic1{a} libmaven-parent-java{a} libmaven-resolver-java{a} libmaven-shared-utils-java{a} libmaven3-core-java{a} libminlog-java{a} libmockito-java{a} libmodule-runtime-perl{a} libmoo-perl{a} libnative-platform-java{a} libnative-platform-jni{a} libncurses6{a} libnekohtml-java{a} libnet-http-perl{a} libnet-ssleay-perl{a} libnpth0{a} libnspr4{a} libnss3{a} libobjenesis-java{a} libosgi-annotation-java{a} libosgi-compendium-java{a} libosgi-core-java{a} libpango-1.0-0{a} libpangocairo-1.0-0{a} libpangoft2-1.0-0{a} libparams-classify-perl{a} libpciaccess0{a} libpcsclite1{a} libpipeline1{a} libpixman-1-0{a} libplexus-cipher-java{a} libplexus-classworlds-java{a} libplexus-component-annotations-java{a} libplexus-container-default-java{a} libplexus-interpolation-java{a} libplexus-sec-dispatcher-java{a} libplexus-utils2-java{a} libpng16-16{a} libpolyglot-maven-java{a} libpython3-stdlib{a} libpython3.11-minimal{a} libpython3.11-stdlib{a} libqdox-java{a} libreadline8{a} libredberry-pipe-java{a} libreflectasm-java{a} libregexp-ipv6-perl{a} librhino-java{a} librole-tiny-perl{a} libsasl2-2{a} libsasl2-modules-db{a} libsensors-config{a} libsensors5{a} libservlet-api-java{a} libsimple-http-java{a} libsisu-inject-java{a} libsisu-plexus-java{a} libslf4j-java{a} libsub-override-perl{a} libsub-quote-perl{a} libthai-data{a} libthai0{a} libtiff6{a} libtimedate-perl{a} libtool{a} libtrove3-java{a} libtry-tiny-perl{a} libuchardet0{a} liburi-perl{a} libwagon-file-java{a} libwagon-http-java{a} libwagon-provider-api-java{a} libwebp7{a} libwebsocket-api-java{a} libwww-perl{a} libwww-robotrules-perl{a} libx11-6{a} libx11-data{a} libx11-xcb1{a} libxau6{a} libxbean-reflect-java{a} libxcb-dri2-0{a} libxcb-dri3-0{a} libxcb-glx0{a} libxcb-present0{a} libxcb-randr0{a} libxcb-render0{a} libxcb-shm0{a} libxcb-sync1{a} libxcb-xfixes0{a} libxcb1{a} libxcomposite1{a} libxcursor1{a} libxdamage1{a} libxdmcp6{a} libxerces2-java{a} libxext6{a} libxfixes3{a} libxi6{a} libxinerama1{a} libxml-commons-external-java{a} libxml-commons-resolver1.1-java{a} libxml2{a} libxpp3-java{a} libxrandr2{a} libxrender1{a} libxshmfence1{a} libxstream-java{a} libxtst6{a} libxxf86vm1{a} libxz-java{a} libyaml-snake-java{a} libz3-4{a} m4{a} man-db{a} maven-repo-helper{a} media-types{a} netbase{a} openjdk-17-jdk{a} openjdk-17-jdk-headless{a} openjdk-17-jre{a} openjdk-17-jre-headless{a} openssl{a} patchutils{a} perl-openssl-defaults{a} pinentry-curses{a} po-debconf{a} python3{a} python3-minimal{a} python3.11{a} python3.11-minimal{a} readline-common{a} sensible-utils{a} shared-mime-info{a} testng{a} unzip{a} wdiff{a} x11-common{a} The following packages are RECOMMENDED but will NOT be installed: alsa-topology-conf alsa-ucm-conf curl dbus debian-keyring dput dput-ng dupload equivs fonts-dejavu-extra javascript-common libarchive-cpio-perl libatk-wrapper-java-jni libbindex-java libdata-dump-perl libdistro-info-perl libgail-common libgdk-pixbuf2.0-bin libgit-wrapper-perl libgitlab-api-v4-perl libglib2.0-data libgpars-groovy-java libgpm2 libgtk2.0-bin libhtml-form-perl libhtml-format-perl libhttp-daemon-perl libldap-common liblist-compare-perl libltdl-dev libmail-sendmail-perl libmailtools-perl libnamespace-clean-perl libreflectasm-java-doc librsvg2-common libsasl2-modules libsoap-lite-perl libstring-shellquote-perl libxstring-perl libxt-dev licensecheck lintian lynx pristine-tar python3-apt python3-debian python3-magic python3-requests python3-unidiff python3-xdg strace wget xdg-user-dirs 0 packages upgraded, 338 newly installed, 0 to remove and 0 not upgraded. Need to get 556 MB of archives. After unpacking 1044 MB will be used. Writing extended state information... Get: 1 http://deb.debian.org/debian bookworm/main i386 libpython3.11-minimal i386 3.11.2-6 [813 kB] Get: 2 http://deb.debian.org/debian bookworm/main i386 libexpat1 i386 2.5.0-1 [103 kB] Get: 3 http://deb.debian.org/debian bookworm/main i386 python3.11-minimal i386 3.11.2-6 [2130 kB] Get: 4 http://deb.debian.org/debian bookworm/main i386 python3-minimal i386 3.11.2-1+b1 [26.3 kB] Get: 5 http://deb.debian.org/debian bookworm/main i386 media-types all 10.0.0 [26.1 kB] Get: 6 http://deb.debian.org/debian bookworm/main i386 readline-common all 8.2-1.3 [69.0 kB] Get: 7 http://deb.debian.org/debian bookworm/main i386 libreadline8 i386 8.2-1.3 [171 kB] Get: 8 http://deb.debian.org/debian bookworm/main i386 libpython3.11-stdlib i386 3.11.2-6 [1799 kB] Get: 9 http://deb.debian.org/debian bookworm/main i386 python3.11 i386 3.11.2-6 [572 kB] Get: 10 http://deb.debian.org/debian bookworm/main i386 libpython3-stdlib i386 3.11.2-1+b1 [9308 B] Get: 11 http://deb.debian.org/debian bookworm/main i386 python3 i386 3.11.2-1+b1 [26.3 kB] Get: 12 http://deb.debian.org/debian bookworm/main i386 netbase all 6.4 [12.8 kB] Get: 13 http://deb.debian.org/debian bookworm/main i386 sensible-utils all 0.0.17+nmu1 [19.0 kB] Get: 14 http://deb.debian.org/debian bookworm/main i386 openssl i386 3.0.8-1 [1412 kB] Get: 15 http://deb.debian.org/debian bookworm/main i386 ca-certificates all 20230311 [153 kB] Get: 16 http://deb.debian.org/debian bookworm/main i386 libmagic-mgc i386 1:5.44-3 [305 kB] Get: 17 http://deb.debian.org/debian bookworm/main i386 libmagic1 i386 1:5.44-3 [114 kB] Get: 18 http://deb.debian.org/debian bookworm/main i386 file i386 1:5.44-3 [42.5 kB] Get: 19 http://deb.debian.org/debian bookworm/main i386 gettext-base i386 0.21-12 [162 kB] Get: 20 http://deb.debian.org/debian bookworm/main i386 libuchardet0 i386 0.0.7-1 [67.9 kB] Get: 21 http://deb.debian.org/debian bookworm/main i386 groff-base i386 1.22.4-10 [932 kB] Get: 22 http://deb.debian.org/debian bookworm/main i386 bsdextrautils i386 2.38.1-5+b1 [90.3 kB] Get: 23 http://deb.debian.org/debian bookworm/main i386 libpipeline1 i386 1.5.7-1 [40.0 kB] Get: 24 http://deb.debian.org/debian bookworm/main i386 man-db i386 2.11.2-2 [1397 kB] Get: 25 http://deb.debian.org/debian bookworm/main i386 hicolor-icon-theme all 0.17-2 [11.4 kB] Get: 26 http://deb.debian.org/debian bookworm/main i386 libgdk-pixbuf2.0-common all 2.42.10+dfsg-1 [306 kB] Get: 27 http://deb.debian.org/debian bookworm/main i386 libglib2.0-0 i386 2.74.6-2 [1467 kB] Get: 28 http://deb.debian.org/debian bookworm/main i386 libicu72 i386 72.1-3 [9541 kB] Get: 29 http://deb.debian.org/debian bookworm/main i386 libxml2 i386 2.9.14+dfsg-1.2 [720 kB] Get: 30 http://deb.debian.org/debian bookworm/main i386 shared-mime-info i386 2.2-1 [730 kB] Get: 31 http://deb.debian.org/debian bookworm/main i386 libjpeg62-turbo i386 1:2.1.5-2 [169 kB] Get: 32 http://deb.debian.org/debian bookworm/main i386 libpng16-16 i386 1.6.39-2 [283 kB] Get: 33 http://deb.debian.org/debian bookworm/main i386 libdeflate0 i386 1.14-1 [57.5 kB] Get: 34 http://deb.debian.org/debian bookworm/main i386 libjbig0 i386 2.1-6.1 [31.6 kB] Get: 35 http://deb.debian.org/debian bookworm/main i386 liblerc4 i386 4.0.0+ds-2 [181 kB] Get: 36 http://deb.debian.org/debian bookworm/main i386 libwebp7 i386 1.2.4-0.1 [293 kB] Get: 37 http://deb.debian.org/debian bookworm/main i386 libtiff6 i386 4.5.0-5 [332 kB] Get: 38 http://deb.debian.org/debian bookworm/main i386 libgdk-pixbuf-2.0-0 i386 2.42.10+dfsg-1+b1 [147 kB] Get: 39 http://deb.debian.org/debian bookworm/main i386 gtk-update-icon-cache i386 3.24.37-2 [43.9 kB] Get: 40 http://deb.debian.org/debian bookworm/main i386 adwaita-icon-theme all 43-1 [5124 kB] Get: 41 http://deb.debian.org/debian bookworm/main i386 ca-certificates-java all 20230103 [11.4 kB] Get: 42 http://deb.debian.org/debian bookworm/main i386 java-common all 0.74 [6388 B] Get: 43 http://deb.debian.org/debian bookworm/main i386 libavahi-common-data i386 0.8-10 [107 kB] Get: 44 http://deb.debian.org/debian bookworm/main i386 libavahi-common3 i386 0.8-10 [43.5 kB] Get: 45 http://deb.debian.org/debian bookworm/main i386 libdbus-1-3 i386 1.14.6-1 [213 kB] Get: 46 http://deb.debian.org/debian bookworm/main i386 libavahi-client3 i386 0.8-10 [47.6 kB] Get: 47 http://deb.debian.org/debian bookworm/main i386 libcups2 i386 2.4.2-3 [261 kB] Get: 48 http://deb.debian.org/debian bookworm/main i386 liblcms2-2 i386 2.14-2 [165 kB] Get: 49 http://deb.debian.org/debian bookworm/main i386 libbrotli1 i386 1.0.9-2+b6 [275 kB] Get: 50 http://deb.debian.org/debian bookworm/main i386 libfreetype6 i386 2.12.1+dfsg-5 [410 kB] Get: 51 http://deb.debian.org/debian bookworm/main i386 fonts-dejavu-core all 2.37-6 [1068 kB] Get: 52 http://deb.debian.org/debian bookworm/main i386 fontconfig-config i386 2.14.1-4 [315 kB] Get: 53 http://deb.debian.org/debian bookworm/main i386 libfontconfig1 i386 2.14.1-4 [398 kB] Get: 54 http://deb.debian.org/debian bookworm/main i386 libnspr4 i386 2:4.35-1 [123 kB] Get: 55 http://deb.debian.org/debian bookworm/main i386 libnss3 i386 2:3.87.1-1 [1439 kB] Get: 56 http://deb.debian.org/debian bookworm/main i386 libasound2-data all 1.2.8-1 [20.5 kB] Get: 57 http://deb.debian.org/debian bookworm/main i386 libasound2 i386 1.2.8-1+b1 [388 kB] Get: 58 http://deb.debian.org/debian bookworm/main i386 libgraphite2-3 i386 1.3.14-1 [84.0 kB] Get: 59 http://deb.debian.org/debian bookworm/main i386 libharfbuzz0b i386 6.0.0+dfsg-3 [1966 kB] Get: 60 http://deb.debian.org/debian bookworm/main i386 libpcsclite1 i386 1.9.9-2 [50.9 kB] Get: 61 http://deb.debian.org/debian bookworm/main i386 openjdk-17-jre-headless i386 17.0.6+10-1 [42.2 MB] Get: 62 http://deb.debian.org/debian bookworm/main i386 default-jre-headless i386 2:1.17-74 [2932 B] Get: 63 http://deb.debian.org/debian bookworm/main i386 ant all 1.10.13-1 [2161 kB] Get: 64 http://deb.debian.org/debian bookworm/main i386 ant-optional all 1.10.13-1 [449 kB] Get: 65 http://deb.debian.org/debian bookworm/main i386 libantlr-java all 2.7.7+dfsg-12 [458 kB] Get: 66 http://deb.debian.org/debian bookworm/main i386 antlr all 2.7.7+dfsg-12 [14.3 kB] Get: 67 http://deb.debian.org/debian bookworm/main i386 at-spi2-common all 2.46.0-5 [162 kB] Get: 68 http://deb.debian.org/debian bookworm/main i386 m4 i386 1.4.19-3 [294 kB] Get: 69 http://deb.debian.org/debian bookworm/main i386 autoconf all 2.71-3 [332 kB] Get: 70 http://deb.debian.org/debian bookworm/main i386 autotools-dev all 20220109.1 [51.6 kB] Get: 71 http://deb.debian.org/debian bookworm/main i386 automake all 1:1.16.5-1.3 [823 kB] Get: 72 http://deb.debian.org/debian bookworm/main i386 autopoint all 0.21-12 [495 kB] Get: 73 http://deb.debian.org/debian bookworm/main i386 unzip i386 6.0-28 [166 kB] Get: 74 http://deb.debian.org/debian bookworm/main i386 java-wrappers all 0.4 [8916 B] Get: 75 http://deb.debian.org/debian bookworm/main i386 libhamcrest-java all 2.2-1 [121 kB] Get: 76 http://deb.debian.org/debian bookworm/main i386 junit4 all 4.13.2-3 [348 kB] Get: 77 http://deb.debian.org/debian bookworm/main i386 libfelix-framework-java all 4.6.1-2.1 [569 kB] Get: 78 http://deb.debian.org/debian bookworm/main i386 libfelix-gogo-runtime-java all 0.16.2-1.1 [114 kB] Get: 79 http://deb.debian.org/debian bookworm/main i386 libosgi-annotation-java all 8.1.0-1 [9436 B] Get: 80 http://deb.debian.org/debian bookworm/main i386 libosgi-core-java all 8.0.0-2 [182 kB] Get: 81 http://deb.debian.org/debian bookworm/main i386 libfelix-resolver-java all 1.16.0-1 [180 kB] Get: 82 http://deb.debian.org/debian bookworm/main i386 libhawtjni-runtime-java all 1.18-1 [36.3 kB] Get: 83 http://deb.debian.org/debian bookworm/main i386 libjansi-native-java all 1.8-1 [26.0 kB] Get: 84 http://deb.debian.org/debian bookworm/main i386 libjansi1-java all 1.18-3 [66.5 kB] Get: 85 http://deb.debian.org/debian bookworm/main i386 libjline2-java all 2.14.6-5 [151 kB] Get: 86 http://deb.debian.org/debian bookworm/main i386 libosgi-compendium-java all 7.0.0-1 [477 kB] Get: 87 http://deb.debian.org/debian bookworm/main i386 libslf4j-java all 1.7.32-1 [144 kB] Get: 88 http://deb.debian.org/debian bookworm/main i386 libxz-java all 1.9-1 [143 kB] Get: 89 http://deb.debian.org/debian bookworm/main i386 libyaml-snake-java all 1.33-2 [321 kB] Get: 90 http://deb.debian.org/debian bookworm/main i386 bnd all 5.0.1-3 [9915 kB] Get: 91 http://deb.debian.org/debian bookworm/main i386 dctrl-tools i386 2.24-3 [105 kB] Get: 92 http://deb.debian.org/debian bookworm/main i386 libdebhelper-perl all 13.11.4 [81.2 kB] Get: 93 http://deb.debian.org/debian bookworm/main i386 libtool all 2.4.7-5 [517 kB] Get: 94 http://deb.debian.org/debian bookworm/main i386 dh-autoreconf all 20 [17.1 kB] Get: 95 http://deb.debian.org/debian bookworm/main i386 libarchive-zip-perl all 1.68-1 [104 kB] Get: 96 http://deb.debian.org/debian bookworm/main i386 libsub-override-perl all 0.09-4 [9304 B] Get: 97 http://deb.debian.org/debian bookworm/main i386 libfile-stripnondeterminism-perl all 1.13.1-1 [19.4 kB] Get: 98 http://deb.debian.org/debian bookworm/main i386 dh-strip-nondeterminism all 1.13.1-1 [8620 B] Get: 99 http://deb.debian.org/debian bookworm/main i386 libelf1 i386 0.188-2.1 [179 kB] Get: 100 http://deb.debian.org/debian bookworm/main i386 dwz i386 0.15-1 [118 kB] Get: 101 http://deb.debian.org/debian bookworm/main i386 gettext i386 0.21-12 [1311 kB] Get: 102 http://deb.debian.org/debian bookworm/main i386 intltool-debian all 0.35.0+20060710.6 [22.9 kB] Get: 103 http://deb.debian.org/debian bookworm/main i386 po-debconf all 1.0.21+nmu1 [248 kB] Get: 104 http://deb.debian.org/debian bookworm/main i386 debhelper all 13.11.4 [942 kB] Get: 105 http://deb.debian.org/debian bookworm/main i386 libgtk2.0-common all 2.24.33-2 [2700 kB] Get: 106 http://deb.debian.org/debian bookworm/main i386 libatk1.0-0 i386 2.46.0-5 [49.4 kB] Get: 107 http://deb.debian.org/debian bookworm/main i386 libpixman-1-0 i386 0.42.2-1 [548 kB] Get: 108 http://deb.debian.org/debian bookworm/main i386 libxau6 i386 1:1.0.9-1 [20.0 kB] Get: 109 http://deb.debian.org/debian bookworm/main i386 libbsd0 i386 0.11.7-2 [121 kB] Get: 110 http://deb.debian.org/debian bookworm/main i386 libxdmcp6 i386 1:1.1.2-3 [26.7 kB] Get: 111 http://deb.debian.org/debian bookworm/main i386 libxcb1 i386 1.15-1 [148 kB] Get: 112 http://deb.debian.org/debian bookworm/main i386 libx11-data all 2:1.8.4-2 [292 kB] Get: 113 http://deb.debian.org/debian bookworm/main i386 libx11-6 i386 2:1.8.4-2 [782 kB] Get: 114 http://deb.debian.org/debian bookworm/main i386 libxcb-render0 i386 1.15-1 [116 kB] Get: 115 http://deb.debian.org/debian bookworm/main i386 libxcb-shm0 i386 1.15-1 [106 kB] Get: 116 http://deb.debian.org/debian bookworm/main i386 libxext6 i386 2:1.3.4-1+b1 [55.3 kB] Get: 117 http://deb.debian.org/debian bookworm/main i386 libxrender1 i386 1:0.9.10-1.1 [34.1 kB] Get: 118 http://deb.debian.org/debian bookworm/main i386 libcairo2 i386 1.16.0-7 [627 kB] Get: 119 http://deb.debian.org/debian bookworm/main i386 fontconfig i386 2.14.1-4 [450 kB] Get: 120 http://deb.debian.org/debian bookworm/main i386 libfribidi0 i386 1.0.8-2.1 [65.6 kB] Get: 121 http://deb.debian.org/debian bookworm/main i386 libthai-data all 0.1.29-1 [176 kB] Get: 122 http://deb.debian.org/debian bookworm/main i386 libdatrie1 i386 0.2.13-2+b1 [45.0 kB] Get: 123 http://deb.debian.org/debian bookworm/main i386 libthai0 i386 0.1.29-1 [58.6 kB] Get: 124 http://deb.debian.org/debian bookworm/main i386 libpango-1.0-0 i386 1.50.12+ds-1 [220 kB] Get: 125 http://deb.debian.org/debian bookworm/main i386 libpangoft2-1.0-0 i386 1.50.12+ds-1 [50.5 kB] Get: 126 http://deb.debian.org/debian bookworm/main i386 libpangocairo-1.0-0 i386 1.50.12+ds-1 [35.4 kB] Get: 127 http://deb.debian.org/debian bookworm/main i386 libxcomposite1 i386 1:0.4.5-1 [16.9 kB] Get: 128 http://deb.debian.org/debian bookworm/main i386 libxfixes3 i386 1:6.0.0-2 [23.0 kB] Get: 129 http://deb.debian.org/debian bookworm/main i386 libxcursor1 i386 1:1.2.1-1 [42.4 kB] Get: 130 http://deb.debian.org/debian bookworm/main i386 libxdamage1 i386 1:1.1.6-1 [15.3 kB] Get: 131 http://deb.debian.org/debian bookworm/main i386 libxi6 i386 2:1.8-1+b1 [86.2 kB] Get: 132 http://deb.debian.org/debian bookworm/main i386 libxinerama1 i386 2:1.1.4-3 [18.1 kB] Get: 133 http://deb.debian.org/debian bookworm/main i386 libxrandr2 i386 2:1.5.2-2+b1 [40.8 kB] Get: 134 http://deb.debian.org/debian bookworm/main i386 libgtk2.0-0 i386 2.24.33-2 [1970 kB] Get: 135 http://deb.debian.org/debian bookworm/main i386 libglvnd0 i386 1.6.0-1 [42.7 kB] Get: 136 http://deb.debian.org/debian bookworm/main i386 libdrm-common all 2.4.114-1 [7112 B] Get: 137 http://deb.debian.org/debian bookworm/main i386 libdrm2 i386 2.4.114-1+b1 [40.8 kB] Get: 138 http://deb.debian.org/debian bookworm/main i386 libglapi-mesa i386 22.3.6-1+deb12u1 [35.6 kB] Get: 139 http://deb.debian.org/debian bookworm/main i386 libx11-xcb1 i386 2:1.8.4-2 [192 kB] Get: 140 http://deb.debian.org/debian bookworm/main i386 libxcb-dri2-0 i386 1.15-1 [107 kB] Get: 141 http://deb.debian.org/debian bookworm/main i386 libxcb-dri3-0 i386 1.15-1 [107 kB] Get: 142 http://deb.debian.org/debian bookworm/main i386 libxcb-glx0 i386 1.15-1 [124 kB] Get: 143 http://deb.debian.org/debian bookworm/main i386 libxcb-present0 i386 1.15-1 [106 kB] Get: 144 http://deb.debian.org/debian bookworm/main i386 libxcb-randr0 i386 1.15-1 [118 kB] Get: 145 http://deb.debian.org/debian bookworm/main i386 libxcb-sync1 i386 1.15-1 [109 kB] Get: 146 http://deb.debian.org/debian bookworm/main i386 libxcb-xfixes0 i386 1.15-1 [110 kB] Get: 147 http://deb.debian.org/debian bookworm/main i386 libxshmfence1 i386 1.3-1 [8976 B] Get: 148 http://deb.debian.org/debian bookworm/main i386 libxxf86vm1 i386 1:1.1.4-1+b2 [21.7 kB] Get: 149 http://deb.debian.org/debian bookworm/main i386 libdrm-amdgpu1 i386 2.4.114-1+b1 [24.1 kB] Get: 150 http://deb.debian.org/debian bookworm/main i386 libpciaccess0 i386 0.17-2 [53.4 kB] Get: 151 http://deb.debian.org/debian bookworm/main i386 libdrm-intel1 i386 2.4.114-1+b1 [67.9 kB] Get: 152 http://deb.debian.org/debian bookworm/main i386 libdrm-nouveau2 i386 2.4.114-1+b1 [20.7 kB] Get: 153 http://deb.debian.org/debian bookworm/main i386 libdrm-radeon1 i386 2.4.114-1+b1 [22.8 kB] Get: 154 http://deb.debian.org/debian bookworm/main i386 libedit2 i386 3.1-20221030-2 [97.2 kB] Get: 155 http://deb.debian.org/debian bookworm/main i386 libz3-4 i386 4.8.12-3.1 [7853 kB] Get: 156 http://deb.debian.org/debian bookworm/main i386 libllvm15 i386 1:15.0.6-4+b1 [26.5 MB] Get: 157 http://deb.debian.org/debian bookworm/main i386 libsensors-config all 1:3.6.0-7.1 [14.3 kB] Get: 158 http://deb.debian.org/debian bookworm/main i386 libsensors5 i386 1:3.6.0-7.1 [35.1 kB] Get: 159 http://deb.debian.org/debian bookworm/main i386 libgl1-mesa-dri i386 22.3.6-1+deb12u1 [7417 kB] Get: 160 http://deb.debian.org/debian bookworm/main i386 libglx-mesa0 i386 22.3.6-1+deb12u1 [156 kB] Get: 161 http://deb.debian.org/debian bookworm/main i386 libglx0 i386 1.6.0-1 [36.6 kB] Get: 162 http://deb.debian.org/debian bookworm/main i386 libgl1 i386 1.6.0-1 [82.1 kB] Get: 163 http://deb.debian.org/debian bookworm/main i386 libgif7 i386 5.2.1-2.5 [48.3 kB] Get: 164 http://deb.debian.org/debian bookworm/main i386 x11-common all 1:7.7+23 [252 kB] Get: 165 http://deb.debian.org/debian bookworm/main i386 libxtst6 i386 2:1.2.3-1.1 [28.6 kB] Get: 166 http://deb.debian.org/debian bookworm/main i386 openjdk-17-jre i386 17.0.6+10-1 [167 kB] Get: 167 http://deb.debian.org/debian bookworm/main i386 default-jre i386 2:1.17-74 [1056 B] Get: 168 http://deb.debian.org/debian bookworm/main i386 openjdk-17-jdk-headless i386 17.0.6+10-1 [309 MB] Get: 169 http://deb.debian.org/debian bookworm/main i386 default-jdk-headless i386 2:1.17-74 [1108 B] Get: 170 http://deb.debian.org/debian bookworm/main i386 openjdk-17-jdk i386 17.0.6+10-1 [4538 kB] Get: 171 http://deb.debian.org/debian bookworm/main i386 default-jdk i386 2:1.17-74 [1068 B] Get: 172 http://deb.debian.org/debian bookworm/main i386 libassuan0 i386 2.5.5-5 [50.3 kB] Get: 173 http://deb.debian.org/debian bookworm/main i386 gpgconf i386 2.2.40-1.1 [572 kB] Get: 174 http://deb.debian.org/debian bookworm/main i386 libksba8 i386 1.6.3-2 [135 kB] Get: 175 http://deb.debian.org/debian bookworm/main i386 libsasl2-modules-db i386 2.1.28+dfsg-10 [21.4 kB] Get: 176 http://deb.debian.org/debian bookworm/main i386 libsasl2-2 i386 2.1.28+dfsg-10 [62.7 kB] Get: 177 http://deb.debian.org/debian bookworm/main i386 libldap-2.5-0 i386 2.5.13+dfsg-5 [196 kB] Get: 178 http://deb.debian.org/debian bookworm/main i386 libnpth0 i386 1.6-3 [19.1 kB] Get: 179 http://deb.debian.org/debian bookworm/main i386 dirmngr i386 2.2.40-1.1 [819 kB] Get: 180 http://deb.debian.org/debian bookworm/main i386 gnupg-l10n all 2.2.40-1.1 [1093 kB] Get: 181 http://deb.debian.org/debian bookworm/main i386 gnupg-utils i386 2.2.40-1.1 [973 kB] Get: 182 http://deb.debian.org/debian bookworm/main i386 gpg i386 2.2.40-1.1 [991 kB] Get: 183 http://deb.debian.org/debian bookworm/main i386 pinentry-curses i386 1.2.1-1 [79.0 kB] Get: 184 http://deb.debian.org/debian bookworm/main i386 gpg-agent i386 2.2.40-1.1 [715 kB] Get: 185 http://deb.debian.org/debian bookworm/main i386 gpg-wks-client i386 2.2.40-1.1 [551 kB] Get: 186 http://deb.debian.org/debian bookworm/main i386 gpg-wks-server i386 2.2.40-1.1 [541 kB] Get: 187 http://deb.debian.org/debian bookworm/main i386 gpgsm i386 2.2.40-1.1 [691 kB] Get: 188 http://deb.debian.org/debian bookworm/main i386 gnupg all 2.2.40-1.1 [846 kB] Get: 189 http://deb.debian.org/debian bookworm/main i386 libfile-dirlist-perl all 0.05-3 [7600 B] Get: 190 http://deb.debian.org/debian bookworm/main i386 libfile-which-perl all 1.27-2 [15.1 kB] Get: 191 http://deb.debian.org/debian bookworm/main i386 libfile-homedir-perl all 1.006-2 [42.4 kB] Get: 192 http://deb.debian.org/debian bookworm/main i386 libfile-touch-perl all 0.12-2 [8816 B] Get: 193 http://deb.debian.org/debian bookworm/main i386 libio-pty-perl i386 1:1.17-1 [36.5 kB] Get: 194 http://deb.debian.org/debian bookworm/main i386 libipc-run-perl all 20220807.0-1 [104 kB] Get: 195 http://deb.debian.org/debian bookworm/main i386 libclass-method-modifiers-perl all 2.14-1 [18.1 kB] Get: 196 http://deb.debian.org/debian bookworm/main i386 libclass-xsaccessor-perl i386 1.19-4+b1 [38.0 kB] Get: 197 http://deb.debian.org/debian bookworm/main i386 libb-hooks-op-check-perl i386 0.22-2+b1 [10.6 kB] Get: 198 http://deb.debian.org/debian bookworm/main i386 libdynaloader-functions-perl all 0.003-3 [12.7 kB] Get: 199 http://deb.debian.org/debian bookworm/main i386 libdevel-callchecker-perl i386 0.008-2 [15.8 kB] Get: 200 http://deb.debian.org/debian bookworm/main i386 libparams-classify-perl i386 0.015-2+b1 [23.7 kB] Get: 201 http://deb.debian.org/debian bookworm/main i386 libmodule-runtime-perl all 0.016-2 [19.6 kB] Get: 202 http://deb.debian.org/debian bookworm/main i386 libimport-into-perl all 1.002005-2 [11.3 kB] Get: 203 http://deb.debian.org/debian bookworm/main i386 librole-tiny-perl all 2.002004-1 [21.4 kB] Get: 204 http://deb.debian.org/debian bookworm/main i386 libsub-quote-perl all 2.006008-1 [21.8 kB] Get: 205 http://deb.debian.org/debian bookworm/main i386 libmoo-perl all 2.005005-1 [58.0 kB] Get: 206 http://deb.debian.org/debian bookworm/main i386 libencode-locale-perl all 1.05-3 [12.9 kB] Get: 207 http://deb.debian.org/debian bookworm/main i386 libtimedate-perl all 2.3300-2 [39.3 kB] Get: 208 http://deb.debian.org/debian bookworm/main i386 libhttp-date-perl all 6.05-2 [10.5 kB] Get: 209 http://deb.debian.org/debian bookworm/main i386 libfile-listing-perl all 6.15-1 [12.6 kB] Get: 210 http://deb.debian.org/debian bookworm/main i386 libhtml-tagset-perl all 3.20-6 [11.7 kB] Get: 211 http://deb.debian.org/debian bookworm/main i386 libregexp-ipv6-perl all 0.03-3 [5212 B] Get: 212 http://deb.debian.org/debian bookworm/main i386 liburi-perl all 5.17-1 [90.4 kB] Get: 213 http://deb.debian.org/debian bookworm/main i386 libhtml-parser-perl i386 3.81-1 [102 kB] Get: 214 http://deb.debian.org/debian bookworm/main i386 libhtml-tree-perl all 5.07-3 [211 kB] Get: 215 http://deb.debian.org/debian bookworm/main i386 libclone-perl i386 0.46-1 [13.8 kB] Get: 216 http://deb.debian.org/debian bookworm/main i386 libio-html-perl all 1.004-3 [16.2 kB] Get: 217 http://deb.debian.org/debian bookworm/main i386 liblwp-mediatypes-perl all 6.04-2 [20.2 kB] Get: 218 http://deb.debian.org/debian bookworm/main i386 libhttp-message-perl all 6.44-1 [81.7 kB] Get: 219 http://deb.debian.org/debian bookworm/main i386 libhttp-cookies-perl all 6.10-1 [19.6 kB] Get: 220 http://deb.debian.org/debian bookworm/main i386 libhttp-negotiate-perl all 6.01-2 [13.1 kB] Get: 221 http://deb.debian.org/debian bookworm/main i386 perl-openssl-defaults i386 7+b1 [7920 B] Get: 222 http://deb.debian.org/debian bookworm/main i386 libnet-ssleay-perl i386 1.92-2+b1 [318 kB] Get: 223 http://deb.debian.org/debian bookworm/main i386 libio-socket-ssl-perl all 2.081-2 [219 kB] Get: 224 http://deb.debian.org/debian bookworm/main i386 libnet-http-perl all 6.22-1 [25.3 kB] Get: 225 http://deb.debian.org/debian bookworm/main i386 liblwp-protocol-https-perl all 6.10-1 [12.2 kB] Get: 226 http://deb.debian.org/debian bookworm/main i386 libtry-tiny-perl all 0.31-2 [22.6 kB] Get: 227 http://deb.debian.org/debian bookworm/main i386 libwww-robotrules-perl all 6.02-1 [12.9 kB] Get: 228 http://deb.debian.org/debian bookworm/main i386 libwww-perl all 6.68-1 [186 kB] Get: 229 http://deb.debian.org/debian bookworm/main i386 patchutils i386 0.4.2-1 [79.6 kB] Get: 230 http://deb.debian.org/debian bookworm/main i386 wdiff i386 1.2.2-5 [120 kB] Get: 231 http://deb.debian.org/debian bookworm/main i386 devscripts i386 2.23.3 [1072 kB] Get: 232 http://deb.debian.org/debian bookworm/main i386 ivy all 2.5.1-2 [1288 kB] Get: 233 http://deb.debian.org/debian bookworm/main i386 libasm-java all 9.4-1 [389 kB] Get: 234 http://deb.debian.org/debian bookworm/main i386 libbsf-java all 1:2.4.0-8 [76.3 kB] Get: 235 http://deb.debian.org/debian bookworm/main i386 libcommons-cli-java all 1.5.0-1 [60.0 kB] Get: 236 http://deb.debian.org/debian bookworm/main i386 libapache-pom-java all 29-2 [5276 B] Get: 237 http://deb.debian.org/debian bookworm/main i386 libcommons-parent-java all 56-1 [10.8 kB] Get: 238 http://deb.debian.org/debian bookworm/main i386 libcommons-logging-java all 1.2-3 [62.4 kB] Get: 239 http://deb.debian.org/debian bookworm/main i386 libjansi-java all 2.4.0-2 [105 kB] Get: 240 http://deb.debian.org/debian bookworm/main i386 libqdox-java all 1.12.1-3 [172 kB] Get: 241 http://deb.debian.org/debian bookworm/main i386 libservlet-api-java all 4.0.1-2 [81.0 kB] Get: 242 http://deb.debian.org/debian bookworm/main i386 libxpp3-java all 1.1.4c-3 [292 kB] Get: 243 http://deb.debian.org/debian bookworm/main i386 libxstream-java all 1.4.20-1 [565 kB] Get: 244 http://deb.debian.org/debian bookworm/main i386 groovy all 2.4.21-7 [12.9 MB] Get: 245 http://deb.debian.org/debian bookworm/main i386 libatinject-jsr330-api-java all 1.0+ds1-5 [5312 B] Get: 246 http://deb.debian.org/debian bookworm/main i386 libcommons-collections3-java all 3.2.2-2 [526 kB] Get: 247 http://deb.debian.org/debian bookworm/main i386 libcommons-compress-java all 1.22-1 [615 kB] Get: 248 http://deb.debian.org/debian bookworm/main i386 libcommons-io-java all 2.11.0-2 [319 kB] Get: 249 http://deb.debian.org/debian bookworm/main i386 libcommons-lang-java all 2.6-10 [273 kB] Get: 250 http://deb.debian.org/debian bookworm/main i386 liberror-prone-java all 2.18.0-1 [22.5 kB] Get: 251 http://deb.debian.org/debian bookworm/main i386 libjsr305-java all 0.1~+svn49-11 [26.9 kB] Get: 252 http://deb.debian.org/debian bookworm/main i386 libguava-java all 31.1-1 [2613 kB] Get: 253 http://deb.debian.org/debian bookworm/main i386 libcommons-codec-java all 1.15-1 [292 kB] Get: 254 http://deb.debian.org/debian bookworm/main i386 libhttpcore-java all 4.4.16-1 [636 kB] Get: 255 http://deb.debian.org/debian bookworm/main i386 libhttpclient-java all 4.5.14-1 [1247 kB] Get: 256 http://deb.debian.org/debian bookworm/main i386 libjarjar-java all 1.4+svn142-12 [205 kB] Get: 257 http://deb.debian.org/debian bookworm/main i386 libjcip-annotations-java all 20060626-6 [11.8 kB] Get: 258 http://deb.debian.org/debian bookworm/main i386 libjna-jni i386 5.13.0-2 [63.2 kB] Get: 259 http://deb.debian.org/debian bookworm/main i386 libjna-java all 5.13.0-2 [236 kB] Get: 260 http://deb.debian.org/debian bookworm/main i386 libjzlib-java all 1.1.3-2 [80.0 kB] Get: 261 http://deb.debian.org/debian bookworm/main i386 libjsch-java all 0.1.55-1 [298 kB] Get: 262 http://deb.debian.org/debian bookworm/main i386 libminlog-java all 1.3.0-1.1 [7928 B] Get: 263 http://deb.debian.org/debian bookworm/main i386 libobjenesis-java all 3.3-3 [41.3 kB] Get: 264 http://deb.debian.org/debian bookworm/main i386 libreflectasm-java all 1.11.9+dfsg-4 [25.0 kB] Get: 265 http://deb.debian.org/debian bookworm/main i386 libkryo-java all 2.20-7 [158 kB] Get: 266 http://deb.debian.org/debian bookworm/main i386 liblogback-java all 1:1.2.11-2 [700 kB] Get: 267 http://deb.debian.org/debian bookworm/main i386 libncurses6 i386 6.4-2 [111 kB] Get: 268 http://deb.debian.org/debian bookworm/main i386 libnative-platform-jni i386 0.14-5 [13.7 kB] Get: 269 http://deb.debian.org/debian bookworm/main i386 libnative-platform-java all 0.14-5 [71.0 kB] Get: 270 http://deb.debian.org/debian bookworm/main i386 libxml-commons-external-java all 1.4.01-5 [240 kB] Get: 271 http://deb.debian.org/debian bookworm/main i386 libxml-commons-resolver1.1-java all 1.2-11 [98.3 kB] Get: 272 http://deb.debian.org/debian bookworm/main i386 libxerces2-java all 2.12.2-1 [1440 kB] Get: 273 http://deb.debian.org/debian bookworm/main i386 libnekohtml-java all 1.9.22.noko2-0.1 [125 kB] Get: 274 http://deb.debian.org/debian bookworm/main i386 libxbean-reflect-java all 4.5-8 [133 kB] Get: 275 http://deb.debian.org/debian bookworm/main i386 libgradle-core-java all 4.4.1-18 [4286 kB] Get: 276 http://deb.debian.org/debian bookworm/main i386 libbcprov-java all 1.72-2 [8225 kB] Get: 277 http://deb.debian.org/debian bookworm/main i386 libbcpg-java all 1.72-2 [383 kB] Get: 278 http://deb.debian.org/debian bookworm/main i386 libbsh-java all 2.0b4-20 [291 kB] Get: 279 http://deb.debian.org/debian bookworm/main i386 libdd-plist-java all 1.20-1.1 [72.6 kB] Get: 280 http://deb.debian.org/debian bookworm/main i386 libjaxen-java all 1.1.6-4 [214 kB] Get: 281 http://deb.debian.org/debian bookworm/main i386 libdom4j-java all 2.1.3-2 [310 kB] Get: 282 http://deb.debian.org/debian bookworm/main i386 libbcel-java all 6.5.0-2 [634 kB] Get: 283 http://deb.debian.org/debian bookworm/main i386 libjformatstring-java all 0.10~20131207-2.1 [34.5 kB] Get: 284 http://deb.debian.org/debian bookworm/main i386 libfindbugs-java all 3.1.0~preview2-3 [3502 kB] Get: 285 http://deb.debian.org/debian bookworm/main i386 libgoogle-gson-java all 2.10-1 [261 kB] Get: 286 http://deb.debian.org/debian bookworm/main i386 libaopalliance-java all 20070526-7 [8572 B] Get: 287 http://deb.debian.org/debian bookworm/main i386 libguice-java all 4.2.3-2 [1435 kB] Get: 288 http://deb.debian.org/debian bookworm/main i386 libjatl-java all 0.2.3-1.1 [29.0 kB] Get: 289 http://deb.debian.org/debian bookworm/main i386 libjcifs-java all 1.3.19-2 [394 kB] Get: 290 http://deb.debian.org/debian bookworm/main i386 libeclipse-jdt-annotation-java all 2.2.700+eclipse4.26-2 [25.3 kB] Get: 291 http://deb.debian.org/debian bookworm/main i386 libjavaewah-java all 1.1.7-1 [156 kB] Get: 292 http://deb.debian.org/debian bookworm/main i386 libel-api-java all 3.0.0-3 [64.9 kB] Get: 293 http://deb.debian.org/debian bookworm/main i386 libjsp-api-java all 2.3.4-3 [53.7 kB] Get: 294 http://deb.debian.org/debian bookworm/main i386 libwebsocket-api-java all 1.1-2 [40.1 kB] Get: 295 http://deb.debian.org/debian bookworm/main i386 libjetty9-java all 9.4.50-3 [2962 kB] Get: 296 http://deb.debian.org/debian bookworm/main i386 libjgit-java all 4.11.9-2 [2534 kB] Get: 297 http://deb.debian.org/debian bookworm/main i386 libjs-jquery all 3.6.1+dfsg+~3.5.14-1 [326 kB] Get: 298 http://deb.debian.org/debian bookworm/main i386 libcommons-lang3-java all 3.12.0-2 [561 kB] Get: 299 http://deb.debian.org/debian bookworm/main i386 libplexus-utils2-java all 3.4.2-1 [258 kB] Get: 300 http://deb.debian.org/debian bookworm/main i386 libwagon-provider-api-java all 3.5.3-1 [48.2 kB] Get: 301 http://deb.debian.org/debian bookworm/main i386 libmaven-resolver-java all 1.6.3-1 [548 kB] Get: 302 http://deb.debian.org/debian bookworm/main i386 libgeronimo-annotation-1.3-spec-java all 1.3-1 [11.1 kB] Get: 303 http://deb.debian.org/debian bookworm/main i386 libmaven-parent-java all 35-1 [6140 B] Get: 304 http://deb.debian.org/debian bookworm/main i386 libmaven-shared-utils-java all 3.3.4-1 [138 kB] Get: 305 http://deb.debian.org/debian bookworm/main i386 libplexus-cipher-java all 2.0-1 [14.9 kB] Get: 306 http://deb.debian.org/debian bookworm/main i386 libplexus-classworlds-java all 2.7.0-1 [50.6 kB] Get: 307 http://deb.debian.org/debian bookworm/main i386 libplexus-component-annotations-java all 2.1.1-1 [7660 B] Get: 308 http://deb.debian.org/debian bookworm/main i386 libplexus-interpolation-java all 1.26-1 [76.8 kB] Get: 309 http://deb.debian.org/debian bookworm/main i386 libplexus-sec-dispatcher-java all 2.0-3 [28.3 kB] Get: 310 http://deb.debian.org/debian bookworm/main i386 libgeronimo-interceptor-3.0-spec-java all 1.0.1-4 [8484 B] Get: 311 http://deb.debian.org/debian bookworm/main i386 libcdi-api-java all 1.2-3 [54.3 kB] Get: 312 http://deb.debian.org/debian bookworm/main i386 libsisu-inject-java all 0.3.4-2 [347 kB] Get: 313 http://deb.debian.org/debian bookworm/main i386 libsisu-plexus-java all 0.3.4-3 [181 kB] Get: 314 http://deb.debian.org/debian bookworm/main i386 libmaven3-core-java all 3.8.7-1 [1572 kB] Get: 315 http://deb.debian.org/debian bookworm/main i386 libplexus-container-default-java all 2.1.1-1 [193 kB] Get: 316 http://deb.debian.org/debian bookworm/main i386 libpolyglot-maven-java all 0.8~tobrien+git20120905-10 [74.9 kB] Get: 317 http://deb.debian.org/debian bookworm/main i386 librhino-java all 1.7.14-2.1 [1357 kB] Get: 318 http://deb.debian.org/debian bookworm/main i386 libsimple-http-java all 4.1.21-1.1 [211 kB] Get: 319 http://deb.debian.org/debian bookworm/main i386 libwagon-file-java all 3.5.3-1 [8388 B] Get: 320 http://deb.debian.org/debian bookworm/main i386 libjsoup-java all 1.15.3-1 [431 kB] Get: 321 http://deb.debian.org/debian bookworm/main i386 libwagon-http-java all 3.5.3-1 [49.5 kB] Get: 322 http://deb.debian.org/debian bookworm/main i386 libjcommander-java all 1.71-4 [73.0 kB] Get: 323 http://deb.debian.org/debian bookworm/main i386 testng all 6.9.12-4 [795 kB] Get: 324 http://deb.debian.org/debian bookworm/main i386 libgradle-plugins-java all 4.4.1-18 [5212 kB] Get: 325 http://deb.debian.org/debian bookworm/main i386 gradle all 4.4.1-18 [398 kB] Get: 326 http://deb.debian.org/debian bookworm/main i386 maven-repo-helper all 1.11 [142 kB] Get: 327 http://deb.debian.org/debian bookworm/main i386 gradle-debian-helper all 2.4 [24.5 kB] Get: 328 http://deb.debian.org/debian bookworm/main i386 javahelper all 0.78 [97.2 kB] Get: 329 http://deb.debian.org/debian bookworm/main i386 libbyte-buddy-java all 1.12.21-1 [4393 kB] Get: 330 http://deb.debian.org/debian bookworm/main i386 libcommons-math3-java all 3.6.1-3 [2018 kB] Get: 331 http://deb.debian.org/debian bookworm/main i386 libjackson2-annotations-java all 2.14.0-1 [68.8 kB] Get: 332 http://deb.debian.org/debian bookworm/main i386 libjackson2-core-java all 2.14.1-1 [447 kB] Get: 333 http://deb.debian.org/debian bookworm/main i386 libjackson2-databind-java all 2.14.0-1 [1584 kB] Get: 334 http://deb.debian.org/debian bookworm/main i386 liblz4-jni i386 1.8.0-3 [9916 B] Get: 335 http://deb.debian.org/debian bookworm/main i386 liblz4-java all 1.8.0-3 [114 kB] Get: 336 http://deb.debian.org/debian bookworm/main i386 libmockito-java all 2.23.0-2 [479 kB] Get: 337 http://deb.debian.org/debian bookworm/main i386 libredberry-pipe-java all 1.0.0~alpha0-3 [62.7 kB] Get: 338 http://deb.debian.org/debian bookworm/main i386 libtrove3-java all 3.0.3-5 [2146 kB] Fetched 556 MB in 24s (22.7 MB/s) debconf: delaying package configuration, since apt-utils is not installed Selecting previously unselected package libpython3.11-minimal:i386. (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 19604 files and directories currently installed.) Preparing to unpack .../libpython3.11-minimal_3.11.2-6_i386.deb ... Unpacking libpython3.11-minimal:i386 (3.11.2-6) ... Selecting previously unselected package libexpat1:i386. Preparing to unpack .../libexpat1_2.5.0-1_i386.deb ... Unpacking libexpat1:i386 (2.5.0-1) ... Selecting previously unselected package python3.11-minimal. Preparing to unpack .../python3.11-minimal_3.11.2-6_i386.deb ... Unpacking python3.11-minimal (3.11.2-6) ... Setting up libpython3.11-minimal:i386 (3.11.2-6) ... Setting up libexpat1:i386 (2.5.0-1) ... Setting up python3.11-minimal (3.11.2-6) ... Selecting previously unselected package python3-minimal. (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 19920 files and directories currently installed.) Preparing to unpack .../0-python3-minimal_3.11.2-1+b1_i386.deb ... Unpacking python3-minimal (3.11.2-1+b1) ... Selecting previously unselected package media-types. Preparing to unpack .../1-media-types_10.0.0_all.deb ... Unpacking media-types (10.0.0) ... Selecting previously unselected package readline-common. Preparing to unpack .../2-readline-common_8.2-1.3_all.deb ... Unpacking readline-common (8.2-1.3) ... Selecting previously unselected package libreadline8:i386. Preparing to unpack .../3-libreadline8_8.2-1.3_i386.deb ... Unpacking libreadline8:i386 (8.2-1.3) ... Selecting previously unselected package libpython3.11-stdlib:i386. Preparing to unpack .../4-libpython3.11-stdlib_3.11.2-6_i386.deb ... Unpacking libpython3.11-stdlib:i386 (3.11.2-6) ... Selecting previously unselected package python3.11. Preparing to unpack .../5-python3.11_3.11.2-6_i386.deb ... Unpacking python3.11 (3.11.2-6) ... Selecting previously unselected package libpython3-stdlib:i386. Preparing to unpack .../6-libpython3-stdlib_3.11.2-1+b1_i386.deb ... Unpacking libpython3-stdlib:i386 (3.11.2-1+b1) ... Setting up python3-minimal (3.11.2-1+b1) ... Selecting previously unselected package python3. (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 20354 files and directories currently installed.) Preparing to unpack .../000-python3_3.11.2-1+b1_i386.deb ... Unpacking python3 (3.11.2-1+b1) ... Selecting previously unselected package netbase. Preparing to unpack .../001-netbase_6.4_all.deb ... Unpacking netbase (6.4) ... Selecting previously unselected package sensible-utils. Preparing to unpack .../002-sensible-utils_0.0.17+nmu1_all.deb ... Unpacking sensible-utils (0.0.17+nmu1) ... Selecting previously unselected package openssl. Preparing to unpack .../003-openssl_3.0.8-1_i386.deb ... Unpacking openssl (3.0.8-1) ... Selecting previously unselected package ca-certificates. Preparing to unpack .../004-ca-certificates_20230311_all.deb ... Unpacking ca-certificates (20230311) ... Selecting previously unselected package libmagic-mgc. Preparing to unpack .../005-libmagic-mgc_1%3a5.44-3_i386.deb ... Unpacking libmagic-mgc (1:5.44-3) ... Selecting previously unselected package libmagic1:i386. Preparing to unpack .../006-libmagic1_1%3a5.44-3_i386.deb ... Unpacking libmagic1:i386 (1:5.44-3) ... Selecting previously unselected package file. Preparing to unpack .../007-file_1%3a5.44-3_i386.deb ... Unpacking file (1:5.44-3) ... Selecting previously unselected package gettext-base. Preparing to unpack .../008-gettext-base_0.21-12_i386.deb ... Unpacking gettext-base (0.21-12) ... Selecting previously unselected package libuchardet0:i386. Preparing to unpack .../009-libuchardet0_0.0.7-1_i386.deb ... Unpacking libuchardet0:i386 (0.0.7-1) ... Selecting previously unselected package groff-base. Preparing to unpack .../010-groff-base_1.22.4-10_i386.deb ... Unpacking groff-base (1.22.4-10) ... Selecting previously unselected package bsdextrautils. Preparing to unpack .../011-bsdextrautils_2.38.1-5+b1_i386.deb ... Unpacking bsdextrautils (2.38.1-5+b1) ... Selecting previously unselected package libpipeline1:i386. Preparing to unpack .../012-libpipeline1_1.5.7-1_i386.deb ... Unpacking libpipeline1:i386 (1.5.7-1) ... Selecting previously unselected package man-db. Preparing to unpack .../013-man-db_2.11.2-2_i386.deb ... Unpacking man-db (2.11.2-2) ... Selecting previously unselected package hicolor-icon-theme. Preparing to unpack .../014-hicolor-icon-theme_0.17-2_all.deb ... Unpacking hicolor-icon-theme (0.17-2) ... Selecting previously unselected package libgdk-pixbuf2.0-common. Preparing to unpack .../015-libgdk-pixbuf2.0-common_2.42.10+dfsg-1_all.deb ... Unpacking libgdk-pixbuf2.0-common (2.42.10+dfsg-1) ... Selecting previously unselected package libglib2.0-0:i386. Preparing to unpack .../016-libglib2.0-0_2.74.6-2_i386.deb ... Unpacking libglib2.0-0:i386 (2.74.6-2) ... Selecting previously unselected package libicu72:i386. Preparing to unpack .../017-libicu72_72.1-3_i386.deb ... Unpacking libicu72:i386 (72.1-3) ... Selecting previously unselected package libxml2:i386. Preparing to unpack .../018-libxml2_2.9.14+dfsg-1.2_i386.deb ... Unpacking libxml2:i386 (2.9.14+dfsg-1.2) ... Selecting previously unselected package shared-mime-info. Preparing to unpack .../019-shared-mime-info_2.2-1_i386.deb ... Unpacking shared-mime-info (2.2-1) ... Selecting previously unselected package libjpeg62-turbo:i386. Preparing to unpack .../020-libjpeg62-turbo_1%3a2.1.5-2_i386.deb ... Unpacking libjpeg62-turbo:i386 (1:2.1.5-2) ... Selecting previously unselected package libpng16-16:i386. Preparing to unpack .../021-libpng16-16_1.6.39-2_i386.deb ... Unpacking libpng16-16:i386 (1.6.39-2) ... Selecting previously unselected package libdeflate0:i386. Preparing to unpack .../022-libdeflate0_1.14-1_i386.deb ... Unpacking libdeflate0:i386 (1.14-1) ... Selecting previously unselected package libjbig0:i386. Preparing to unpack .../023-libjbig0_2.1-6.1_i386.deb ... Unpacking libjbig0:i386 (2.1-6.1) ... Selecting previously unselected package liblerc4:i386. Preparing to unpack .../024-liblerc4_4.0.0+ds-2_i386.deb ... Unpacking liblerc4:i386 (4.0.0+ds-2) ... Selecting previously unselected package libwebp7:i386. Preparing to unpack .../025-libwebp7_1.2.4-0.1_i386.deb ... Unpacking libwebp7:i386 (1.2.4-0.1) ... Selecting previously unselected package libtiff6:i386. Preparing to unpack .../026-libtiff6_4.5.0-5_i386.deb ... Unpacking libtiff6:i386 (4.5.0-5) ... Selecting previously unselected package libgdk-pixbuf-2.0-0:i386. Preparing to unpack .../027-libgdk-pixbuf-2.0-0_2.42.10+dfsg-1+b1_i386.deb ... Unpacking libgdk-pixbuf-2.0-0:i386 (2.42.10+dfsg-1+b1) ... Selecting previously unselected package gtk-update-icon-cache. Preparing to unpack .../028-gtk-update-icon-cache_3.24.37-2_i386.deb ... Unpacking gtk-update-icon-cache (3.24.37-2) ... Selecting previously unselected package adwaita-icon-theme. Preparing to unpack .../029-adwaita-icon-theme_43-1_all.deb ... Unpacking adwaita-icon-theme (43-1) ... Selecting previously unselected package ca-certificates-java. Preparing to unpack .../030-ca-certificates-java_20230103_all.deb ... Unpacking ca-certificates-java (20230103) ... Selecting previously unselected package java-common. Preparing to unpack .../031-java-common_0.74_all.deb ... Unpacking java-common (0.74) ... Selecting previously unselected package libavahi-common-data:i386. Preparing to unpack .../032-libavahi-common-data_0.8-10_i386.deb ... Unpacking libavahi-common-data:i386 (0.8-10) ... Selecting previously unselected package libavahi-common3:i386. Preparing to unpack .../033-libavahi-common3_0.8-10_i386.deb ... Unpacking libavahi-common3:i386 (0.8-10) ... Selecting previously unselected package libdbus-1-3:i386. Preparing to unpack .../034-libdbus-1-3_1.14.6-1_i386.deb ... Unpacking libdbus-1-3:i386 (1.14.6-1) ... Selecting previously unselected package libavahi-client3:i386. Preparing to unpack .../035-libavahi-client3_0.8-10_i386.deb ... Unpacking libavahi-client3:i386 (0.8-10) ... Selecting previously unselected package libcups2:i386. Preparing to unpack .../036-libcups2_2.4.2-3_i386.deb ... Unpacking libcups2:i386 (2.4.2-3) ... Selecting previously unselected package liblcms2-2:i386. Preparing to unpack .../037-liblcms2-2_2.14-2_i386.deb ... Unpacking liblcms2-2:i386 (2.14-2) ... Selecting previously unselected package libbrotli1:i386. Preparing to unpack .../038-libbrotli1_1.0.9-2+b6_i386.deb ... Unpacking libbrotli1:i386 (1.0.9-2+b6) ... Selecting previously unselected package libfreetype6:i386. Preparing to unpack .../039-libfreetype6_2.12.1+dfsg-5_i386.deb ... Unpacking libfreetype6:i386 (2.12.1+dfsg-5) ... Selecting previously unselected package fonts-dejavu-core. Preparing to unpack .../040-fonts-dejavu-core_2.37-6_all.deb ... Unpacking fonts-dejavu-core (2.37-6) ... Selecting previously unselected package fontconfig-config. Preparing to unpack .../041-fontconfig-config_2.14.1-4_i386.deb ... Unpacking fontconfig-config (2.14.1-4) ... Selecting previously unselected package libfontconfig1:i386. Preparing to unpack .../042-libfontconfig1_2.14.1-4_i386.deb ... Unpacking libfontconfig1:i386 (2.14.1-4) ... Selecting previously unselected package libnspr4:i386. Preparing to unpack .../043-libnspr4_2%3a4.35-1_i386.deb ... Unpacking libnspr4:i386 (2:4.35-1) ... Selecting previously unselected package libnss3:i386. Preparing to unpack .../044-libnss3_2%3a3.87.1-1_i386.deb ... Unpacking libnss3:i386 (2:3.87.1-1) ... Selecting previously unselected package libasound2-data. Preparing to unpack .../045-libasound2-data_1.2.8-1_all.deb ... Unpacking libasound2-data (1.2.8-1) ... Selecting previously unselected package libasound2:i386. Preparing to unpack .../046-libasound2_1.2.8-1+b1_i386.deb ... Unpacking libasound2:i386 (1.2.8-1+b1) ... Selecting previously unselected package libgraphite2-3:i386. Preparing to unpack .../047-libgraphite2-3_1.3.14-1_i386.deb ... Unpacking libgraphite2-3:i386 (1.3.14-1) ... Selecting previously unselected package libharfbuzz0b:i386. Preparing to unpack .../048-libharfbuzz0b_6.0.0+dfsg-3_i386.deb ... Unpacking libharfbuzz0b:i386 (6.0.0+dfsg-3) ... Selecting previously unselected package libpcsclite1:i386. Preparing to unpack .../049-libpcsclite1_1.9.9-2_i386.deb ... Unpacking libpcsclite1:i386 (1.9.9-2) ... Selecting previously unselected package openjdk-17-jre-headless:i386. Preparing to unpack .../050-openjdk-17-jre-headless_17.0.6+10-1_i386.deb ... Unpacking openjdk-17-jre-headless:i386 (17.0.6+10-1) ... Selecting previously unselected package default-jre-headless. Preparing to unpack .../051-default-jre-headless_2%3a1.17-74_i386.deb ... Unpacking default-jre-headless (2:1.17-74) ... Selecting previously unselected package ant. Preparing to unpack .../052-ant_1.10.13-1_all.deb ... Unpacking ant (1.10.13-1) ... Selecting previously unselected package ant-optional. Preparing to unpack .../053-ant-optional_1.10.13-1_all.deb ... Unpacking ant-optional (1.10.13-1) ... Selecting previously unselected package libantlr-java. Preparing to unpack .../054-libantlr-java_2.7.7+dfsg-12_all.deb ... Unpacking libantlr-java (2.7.7+dfsg-12) ... Selecting previously unselected package antlr. Preparing to unpack .../055-antlr_2.7.7+dfsg-12_all.deb ... Unpacking antlr (2.7.7+dfsg-12) ... Selecting previously unselected package at-spi2-common. Preparing to unpack .../056-at-spi2-common_2.46.0-5_all.deb ... Unpacking at-spi2-common (2.46.0-5) ... Selecting previously unselected package m4. Preparing to unpack .../057-m4_1.4.19-3_i386.deb ... Unpacking m4 (1.4.19-3) ... Selecting previously unselected package autoconf. Preparing to unpack .../058-autoconf_2.71-3_all.deb ... Unpacking autoconf (2.71-3) ... Selecting previously unselected package autotools-dev. Preparing to unpack .../059-autotools-dev_20220109.1_all.deb ... Unpacking autotools-dev (20220109.1) ... Selecting previously unselected package automake. Preparing to unpack .../060-automake_1%3a1.16.5-1.3_all.deb ... Unpacking automake (1:1.16.5-1.3) ... Selecting previously unselected package autopoint. Preparing to unpack .../061-autopoint_0.21-12_all.deb ... Unpacking autopoint (0.21-12) ... Selecting previously unselected package unzip. Preparing to unpack .../062-unzip_6.0-28_i386.deb ... Unpacking unzip (6.0-28) ... Selecting previously unselected package java-wrappers. Preparing to unpack .../063-java-wrappers_0.4_all.deb ... Unpacking java-wrappers (0.4) ... Selecting previously unselected package libhamcrest-java. Preparing to unpack .../064-libhamcrest-java_2.2-1_all.deb ... Unpacking libhamcrest-java (2.2-1) ... Selecting previously unselected package junit4. Preparing to unpack .../065-junit4_4.13.2-3_all.deb ... Unpacking junit4 (4.13.2-3) ... Selecting previously unselected package libfelix-framework-java. Preparing to unpack .../066-libfelix-framework-java_4.6.1-2.1_all.deb ... Unpacking libfelix-framework-java (4.6.1-2.1) ... Selecting previously unselected package libfelix-gogo-runtime-java. Preparing to unpack .../067-libfelix-gogo-runtime-java_0.16.2-1.1_all.deb ... Unpacking libfelix-gogo-runtime-java (0.16.2-1.1) ... Selecting previously unselected package libosgi-annotation-java. Preparing to unpack .../068-libosgi-annotation-java_8.1.0-1_all.deb ... Unpacking libosgi-annotation-java (8.1.0-1) ... Selecting previously unselected package libosgi-core-java. Preparing to unpack .../069-libosgi-core-java_8.0.0-2_all.deb ... Unpacking libosgi-core-java (8.0.0-2) ... Selecting previously unselected package libfelix-resolver-java. Preparing to unpack .../070-libfelix-resolver-java_1.16.0-1_all.deb ... Unpacking libfelix-resolver-java (1.16.0-1) ... Selecting previously unselected package libhawtjni-runtime-java. Preparing to unpack .../071-libhawtjni-runtime-java_1.18-1_all.deb ... Unpacking libhawtjni-runtime-java (1.18-1) ... Selecting previously unselected package libjansi-native-java. Preparing to unpack .../072-libjansi-native-java_1.8-1_all.deb ... Unpacking libjansi-native-java (1.8-1) ... Selecting previously unselected package libjansi1-java. Preparing to unpack .../073-libjansi1-java_1.18-3_all.deb ... Unpacking libjansi1-java (1.18-3) ... Selecting previously unselected package libjline2-java. Preparing to unpack .../074-libjline2-java_2.14.6-5_all.deb ... Unpacking libjline2-java (2.14.6-5) ... Selecting previously unselected package libosgi-compendium-java. Preparing to unpack .../075-libosgi-compendium-java_7.0.0-1_all.deb ... Unpacking libosgi-compendium-java (7.0.0-1) ... Selecting previously unselected package libslf4j-java. Preparing to unpack .../076-libslf4j-java_1.7.32-1_all.deb ... Unpacking libslf4j-java (1.7.32-1) ... Selecting previously unselected package libxz-java. Preparing to unpack .../077-libxz-java_1.9-1_all.deb ... Unpacking libxz-java (1.9-1) ... Selecting previously unselected package libyaml-snake-java. Preparing to unpack .../078-libyaml-snake-java_1.33-2_all.deb ... Unpacking libyaml-snake-java (1.33-2) ... Selecting previously unselected package bnd. Preparing to unpack .../079-bnd_5.0.1-3_all.deb ... Unpacking bnd (5.0.1-3) ... Selecting previously unselected package dctrl-tools. Preparing to unpack .../080-dctrl-tools_2.24-3_i386.deb ... Unpacking dctrl-tools (2.24-3) ... Selecting previously unselected package libdebhelper-perl. Preparing to unpack .../081-libdebhelper-perl_13.11.4_all.deb ... Unpacking libdebhelper-perl (13.11.4) ... Selecting previously unselected package libtool. Preparing to unpack .../082-libtool_2.4.7-5_all.deb ... Unpacking libtool (2.4.7-5) ... Selecting previously unselected package dh-autoreconf. Preparing to unpack .../083-dh-autoreconf_20_all.deb ... Unpacking dh-autoreconf (20) ... Selecting previously unselected package libarchive-zip-perl. Preparing to unpack .../084-libarchive-zip-perl_1.68-1_all.deb ... Unpacking libarchive-zip-perl (1.68-1) ... Selecting previously unselected package libsub-override-perl. Preparing to unpack .../085-libsub-override-perl_0.09-4_all.deb ... Unpacking libsub-override-perl (0.09-4) ... Selecting previously unselected package libfile-stripnondeterminism-perl. Preparing to unpack .../086-libfile-stripnondeterminism-perl_1.13.1-1_all.deb ... Unpacking libfile-stripnondeterminism-perl (1.13.1-1) ... Selecting previously unselected package dh-strip-nondeterminism. Preparing to unpack .../087-dh-strip-nondeterminism_1.13.1-1_all.deb ... Unpacking dh-strip-nondeterminism (1.13.1-1) ... Selecting previously unselected package libelf1:i386. Preparing to unpack .../088-libelf1_0.188-2.1_i386.deb ... Unpacking libelf1:i386 (0.188-2.1) ... Selecting previously unselected package dwz. Preparing to unpack .../089-dwz_0.15-1_i386.deb ... Unpacking dwz (0.15-1) ... Selecting previously unselected package gettext. Preparing to unpack .../090-gettext_0.21-12_i386.deb ... Unpacking gettext (0.21-12) ... Selecting previously unselected package intltool-debian. Preparing to unpack .../091-intltool-debian_0.35.0+20060710.6_all.deb ... Unpacking intltool-debian (0.35.0+20060710.6) ... Selecting previously unselected package po-debconf. Preparing to unpack .../092-po-debconf_1.0.21+nmu1_all.deb ... Unpacking po-debconf (1.0.21+nmu1) ... Selecting previously unselected package debhelper. Preparing to unpack .../093-debhelper_13.11.4_all.deb ... Unpacking debhelper (13.11.4) ... Selecting previously unselected package libgtk2.0-common. Preparing to unpack .../094-libgtk2.0-common_2.24.33-2_all.deb ... Unpacking libgtk2.0-common (2.24.33-2) ... Selecting previously unselected package libatk1.0-0:i386. Preparing to unpack .../095-libatk1.0-0_2.46.0-5_i386.deb ... Unpacking libatk1.0-0:i386 (2.46.0-5) ... Selecting previously unselected package libpixman-1-0:i386. Preparing to unpack .../096-libpixman-1-0_0.42.2-1_i386.deb ... Unpacking libpixman-1-0:i386 (0.42.2-1) ... Selecting previously unselected package libxau6:i386. Preparing to unpack .../097-libxau6_1%3a1.0.9-1_i386.deb ... Unpacking libxau6:i386 (1:1.0.9-1) ... Selecting previously unselected package libbsd0:i386. Preparing to unpack .../098-libbsd0_0.11.7-2_i386.deb ... Unpacking libbsd0:i386 (0.11.7-2) ... Selecting previously unselected package libxdmcp6:i386. Preparing to unpack .../099-libxdmcp6_1%3a1.1.2-3_i386.deb ... Unpacking libxdmcp6:i386 (1:1.1.2-3) ... Selecting previously unselected package libxcb1:i386. Preparing to unpack .../100-libxcb1_1.15-1_i386.deb ... Unpacking libxcb1:i386 (1.15-1) ... Selecting previously unselected package libx11-data. Preparing to unpack .../101-libx11-data_2%3a1.8.4-2_all.deb ... Unpacking libx11-data (2:1.8.4-2) ... Selecting previously unselected package libx11-6:i386. Preparing to unpack .../102-libx11-6_2%3a1.8.4-2_i386.deb ... Unpacking libx11-6:i386 (2:1.8.4-2) ... Selecting previously unselected package libxcb-render0:i386. Preparing to unpack .../103-libxcb-render0_1.15-1_i386.deb ... Unpacking libxcb-render0:i386 (1.15-1) ... Selecting previously unselected package libxcb-shm0:i386. Preparing to unpack .../104-libxcb-shm0_1.15-1_i386.deb ... Unpacking libxcb-shm0:i386 (1.15-1) ... Selecting previously unselected package libxext6:i386. Preparing to unpack .../105-libxext6_2%3a1.3.4-1+b1_i386.deb ... Unpacking libxext6:i386 (2:1.3.4-1+b1) ... Selecting previously unselected package libxrender1:i386. Preparing to unpack .../106-libxrender1_1%3a0.9.10-1.1_i386.deb ... Unpacking libxrender1:i386 (1:0.9.10-1.1) ... Selecting previously unselected package libcairo2:i386. Preparing to unpack .../107-libcairo2_1.16.0-7_i386.deb ... Unpacking libcairo2:i386 (1.16.0-7) ... Selecting previously unselected package fontconfig. Preparing to unpack .../108-fontconfig_2.14.1-4_i386.deb ... Unpacking fontconfig (2.14.1-4) ... Selecting previously unselected package libfribidi0:i386. Preparing to unpack .../109-libfribidi0_1.0.8-2.1_i386.deb ... Unpacking libfribidi0:i386 (1.0.8-2.1) ... Selecting previously unselected package libthai-data. Preparing to unpack .../110-libthai-data_0.1.29-1_all.deb ... Unpacking libthai-data (0.1.29-1) ... Selecting previously unselected package libdatrie1:i386. Preparing to unpack .../111-libdatrie1_0.2.13-2+b1_i386.deb ... Unpacking libdatrie1:i386 (0.2.13-2+b1) ... Selecting previously unselected package libthai0:i386. Preparing to unpack .../112-libthai0_0.1.29-1_i386.deb ... Unpacking libthai0:i386 (0.1.29-1) ... Selecting previously unselected package libpango-1.0-0:i386. Preparing to unpack .../113-libpango-1.0-0_1.50.12+ds-1_i386.deb ... Unpacking libpango-1.0-0:i386 (1.50.12+ds-1) ... Selecting previously unselected package libpangoft2-1.0-0:i386. Preparing to unpack .../114-libpangoft2-1.0-0_1.50.12+ds-1_i386.deb ... Unpacking libpangoft2-1.0-0:i386 (1.50.12+ds-1) ... Selecting previously unselected package libpangocairo-1.0-0:i386. Preparing to unpack .../115-libpangocairo-1.0-0_1.50.12+ds-1_i386.deb ... Unpacking libpangocairo-1.0-0:i386 (1.50.12+ds-1) ... Selecting previously unselected package libxcomposite1:i386. Preparing to unpack .../116-libxcomposite1_1%3a0.4.5-1_i386.deb ... Unpacking libxcomposite1:i386 (1:0.4.5-1) ... Selecting previously unselected package libxfixes3:i386. Preparing to unpack .../117-libxfixes3_1%3a6.0.0-2_i386.deb ... Unpacking libxfixes3:i386 (1:6.0.0-2) ... Selecting previously unselected package libxcursor1:i386. Preparing to unpack .../118-libxcursor1_1%3a1.2.1-1_i386.deb ... Unpacking libxcursor1:i386 (1:1.2.1-1) ... Selecting previously unselected package libxdamage1:i386. Preparing to unpack .../119-libxdamage1_1%3a1.1.6-1_i386.deb ... Unpacking libxdamage1:i386 (1:1.1.6-1) ... Selecting previously unselected package libxi6:i386. Preparing to unpack .../120-libxi6_2%3a1.8-1+b1_i386.deb ... Unpacking libxi6:i386 (2:1.8-1+b1) ... Selecting previously unselected package libxinerama1:i386. Preparing to unpack .../121-libxinerama1_2%3a1.1.4-3_i386.deb ... Unpacking libxinerama1:i386 (2:1.1.4-3) ... Selecting previously unselected package libxrandr2:i386. Preparing to unpack .../122-libxrandr2_2%3a1.5.2-2+b1_i386.deb ... Unpacking libxrandr2:i386 (2:1.5.2-2+b1) ... Selecting previously unselected package libgtk2.0-0:i386. Preparing to unpack .../123-libgtk2.0-0_2.24.33-2_i386.deb ... Unpacking libgtk2.0-0:i386 (2.24.33-2) ... Selecting previously unselected package libglvnd0:i386. Preparing to unpack .../124-libglvnd0_1.6.0-1_i386.deb ... Unpacking libglvnd0:i386 (1.6.0-1) ... Selecting previously unselected package libdrm-common. Preparing to unpack .../125-libdrm-common_2.4.114-1_all.deb ... Unpacking libdrm-common (2.4.114-1) ... Selecting previously unselected package libdrm2:i386. Preparing to unpack .../126-libdrm2_2.4.114-1+b1_i386.deb ... Unpacking libdrm2:i386 (2.4.114-1+b1) ... Selecting previously unselected package libglapi-mesa:i386. Preparing to unpack .../127-libglapi-mesa_22.3.6-1+deb12u1_i386.deb ... Unpacking libglapi-mesa:i386 (22.3.6-1+deb12u1) ... Selecting previously unselected package libx11-xcb1:i386. Preparing to unpack .../128-libx11-xcb1_2%3a1.8.4-2_i386.deb ... Unpacking libx11-xcb1:i386 (2:1.8.4-2) ... Selecting previously unselected package libxcb-dri2-0:i386. Preparing to unpack .../129-libxcb-dri2-0_1.15-1_i386.deb ... Unpacking libxcb-dri2-0:i386 (1.15-1) ... Selecting previously unselected package libxcb-dri3-0:i386. Preparing to unpack .../130-libxcb-dri3-0_1.15-1_i386.deb ... Unpacking libxcb-dri3-0:i386 (1.15-1) ... Selecting previously unselected package libxcb-glx0:i386. Preparing to unpack .../131-libxcb-glx0_1.15-1_i386.deb ... Unpacking libxcb-glx0:i386 (1.15-1) ... Selecting previously unselected package libxcb-present0:i386. Preparing to unpack .../132-libxcb-present0_1.15-1_i386.deb ... Unpacking libxcb-present0:i386 (1.15-1) ... Selecting previously unselected package libxcb-randr0:i386. Preparing to unpack .../133-libxcb-randr0_1.15-1_i386.deb ... Unpacking libxcb-randr0:i386 (1.15-1) ... Selecting previously unselected package libxcb-sync1:i386. Preparing to unpack .../134-libxcb-sync1_1.15-1_i386.deb ... Unpacking libxcb-sync1:i386 (1.15-1) ... Selecting previously unselected package libxcb-xfixes0:i386. Preparing to unpack .../135-libxcb-xfixes0_1.15-1_i386.deb ... Unpacking libxcb-xfixes0:i386 (1.15-1) ... Selecting previously unselected package libxshmfence1:i386. Preparing to unpack .../136-libxshmfence1_1.3-1_i386.deb ... Unpacking libxshmfence1:i386 (1.3-1) ... Selecting previously unselected package libxxf86vm1:i386. Preparing to unpack .../137-libxxf86vm1_1%3a1.1.4-1+b2_i386.deb ... Unpacking libxxf86vm1:i386 (1:1.1.4-1+b2) ... Selecting previously unselected package libdrm-amdgpu1:i386. Preparing to unpack .../138-libdrm-amdgpu1_2.4.114-1+b1_i386.deb ... Unpacking libdrm-amdgpu1:i386 (2.4.114-1+b1) ... Selecting previously unselected package libpciaccess0:i386. Preparing to unpack .../139-libpciaccess0_0.17-2_i386.deb ... Unpacking libpciaccess0:i386 (0.17-2) ... Selecting previously unselected package libdrm-intel1:i386. Preparing to unpack .../140-libdrm-intel1_2.4.114-1+b1_i386.deb ... Unpacking libdrm-intel1:i386 (2.4.114-1+b1) ... Selecting previously unselected package libdrm-nouveau2:i386. Preparing to unpack .../141-libdrm-nouveau2_2.4.114-1+b1_i386.deb ... Unpacking libdrm-nouveau2:i386 (2.4.114-1+b1) ... Selecting previously unselected package libdrm-radeon1:i386. Preparing to unpack .../142-libdrm-radeon1_2.4.114-1+b1_i386.deb ... Unpacking libdrm-radeon1:i386 (2.4.114-1+b1) ... Selecting previously unselected package libedit2:i386. Preparing to unpack .../143-libedit2_3.1-20221030-2_i386.deb ... Unpacking libedit2:i386 (3.1-20221030-2) ... Selecting previously unselected package libz3-4:i386. Preparing to unpack .../144-libz3-4_4.8.12-3.1_i386.deb ... Unpacking libz3-4:i386 (4.8.12-3.1) ... Selecting previously unselected package libllvm15:i386. Preparing to unpack .../145-libllvm15_1%3a15.0.6-4+b1_i386.deb ... Unpacking libllvm15:i386 (1:15.0.6-4+b1) ... Selecting previously unselected package libsensors-config. Preparing to unpack .../146-libsensors-config_1%3a3.6.0-7.1_all.deb ... Unpacking libsensors-config (1:3.6.0-7.1) ... Selecting previously unselected package libsensors5:i386. Preparing to unpack .../147-libsensors5_1%3a3.6.0-7.1_i386.deb ... Unpacking libsensors5:i386 (1:3.6.0-7.1) ... Selecting previously unselected package libgl1-mesa-dri:i386. Preparing to unpack .../148-libgl1-mesa-dri_22.3.6-1+deb12u1_i386.deb ... Unpacking libgl1-mesa-dri:i386 (22.3.6-1+deb12u1) ... Selecting previously unselected package libglx-mesa0:i386. Preparing to unpack .../149-libglx-mesa0_22.3.6-1+deb12u1_i386.deb ... Unpacking libglx-mesa0:i386 (22.3.6-1+deb12u1) ... Selecting previously unselected package libglx0:i386. Preparing to unpack .../150-libglx0_1.6.0-1_i386.deb ... Unpacking libglx0:i386 (1.6.0-1) ... Selecting previously unselected package libgl1:i386. Preparing to unpack .../151-libgl1_1.6.0-1_i386.deb ... Unpacking libgl1:i386 (1.6.0-1) ... Selecting previously unselected package libgif7:i386. Preparing to unpack .../152-libgif7_5.2.1-2.5_i386.deb ... Unpacking libgif7:i386 (5.2.1-2.5) ... Selecting previously unselected package x11-common. Preparing to unpack .../153-x11-common_1%3a7.7+23_all.deb ... Unpacking x11-common (1:7.7+23) ... Selecting previously unselected package libxtst6:i386. Preparing to unpack .../154-libxtst6_2%3a1.2.3-1.1_i386.deb ... Unpacking libxtst6:i386 (2:1.2.3-1.1) ... Selecting previously unselected package openjdk-17-jre:i386. Preparing to unpack .../155-openjdk-17-jre_17.0.6+10-1_i386.deb ... Unpacking openjdk-17-jre:i386 (17.0.6+10-1) ... Selecting previously unselected package default-jre. Preparing to unpack .../156-default-jre_2%3a1.17-74_i386.deb ... Unpacking default-jre (2:1.17-74) ... Selecting previously unselected package openjdk-17-jdk-headless:i386. Preparing to unpack .../157-openjdk-17-jdk-headless_17.0.6+10-1_i386.deb ... Unpacking openjdk-17-jdk-headless:i386 (17.0.6+10-1) ... Selecting previously unselected package default-jdk-headless. Preparing to unpack .../158-default-jdk-headless_2%3a1.17-74_i386.deb ... Unpacking default-jdk-headless (2:1.17-74) ... Selecting previously unselected package openjdk-17-jdk:i386. Preparing to unpack .../159-openjdk-17-jdk_17.0.6+10-1_i386.deb ... Unpacking openjdk-17-jdk:i386 (17.0.6+10-1) ... Selecting previously unselected package default-jdk. Preparing to unpack .../160-default-jdk_2%3a1.17-74_i386.deb ... Unpacking default-jdk (2:1.17-74) ... Selecting previously unselected package libassuan0:i386. Preparing to unpack .../161-libassuan0_2.5.5-5_i386.deb ... Unpacking libassuan0:i386 (2.5.5-5) ... Selecting previously unselected package gpgconf. Preparing to unpack .../162-gpgconf_2.2.40-1.1_i386.deb ... Unpacking gpgconf (2.2.40-1.1) ... Selecting previously unselected package libksba8:i386. Preparing to unpack .../163-libksba8_1.6.3-2_i386.deb ... Unpacking libksba8:i386 (1.6.3-2) ... Selecting previously unselected package libsasl2-modules-db:i386. Preparing to unpack .../164-libsasl2-modules-db_2.1.28+dfsg-10_i386.deb ... Unpacking libsasl2-modules-db:i386 (2.1.28+dfsg-10) ... Selecting previously unselected package libsasl2-2:i386. Preparing to unpack .../165-libsasl2-2_2.1.28+dfsg-10_i386.deb ... Unpacking libsasl2-2:i386 (2.1.28+dfsg-10) ... Selecting previously unselected package libldap-2.5-0:i386. Preparing to unpack .../166-libldap-2.5-0_2.5.13+dfsg-5_i386.deb ... Unpacking libldap-2.5-0:i386 (2.5.13+dfsg-5) ... Selecting previously unselected package libnpth0:i386. Preparing to unpack .../167-libnpth0_1.6-3_i386.deb ... Unpacking libnpth0:i386 (1.6-3) ... Selecting previously unselected package dirmngr. Preparing to unpack .../168-dirmngr_2.2.40-1.1_i386.deb ... Unpacking dirmngr (2.2.40-1.1) ... Selecting previously unselected package gnupg-l10n. Preparing to unpack .../169-gnupg-l10n_2.2.40-1.1_all.deb ... Unpacking gnupg-l10n (2.2.40-1.1) ... Selecting previously unselected package gnupg-utils. Preparing to unpack .../170-gnupg-utils_2.2.40-1.1_i386.deb ... Unpacking gnupg-utils (2.2.40-1.1) ... Selecting previously unselected package gpg. Preparing to unpack .../171-gpg_2.2.40-1.1_i386.deb ... Unpacking gpg (2.2.40-1.1) ... Selecting previously unselected package pinentry-curses. Preparing to unpack .../172-pinentry-curses_1.2.1-1_i386.deb ... Unpacking pinentry-curses (1.2.1-1) ... Selecting previously unselected package gpg-agent. Preparing to unpack .../173-gpg-agent_2.2.40-1.1_i386.deb ... Unpacking gpg-agent (2.2.40-1.1) ... Selecting previously unselected package gpg-wks-client. Preparing to unpack .../174-gpg-wks-client_2.2.40-1.1_i386.deb ... Unpacking gpg-wks-client (2.2.40-1.1) ... Selecting previously unselected package gpg-wks-server. Preparing to unpack .../175-gpg-wks-server_2.2.40-1.1_i386.deb ... Unpacking gpg-wks-server (2.2.40-1.1) ... Selecting previously unselected package gpgsm. Preparing to unpack .../176-gpgsm_2.2.40-1.1_i386.deb ... Unpacking gpgsm (2.2.40-1.1) ... Selecting previously unselected package gnupg. Preparing to unpack .../177-gnupg_2.2.40-1.1_all.deb ... Unpacking gnupg (2.2.40-1.1) ... Selecting previously unselected package libfile-dirlist-perl. Preparing to unpack .../178-libfile-dirlist-perl_0.05-3_all.deb ... Unpacking libfile-dirlist-perl (0.05-3) ... Selecting previously unselected package libfile-which-perl. Preparing to unpack .../179-libfile-which-perl_1.27-2_all.deb ... Unpacking libfile-which-perl (1.27-2) ... Selecting previously unselected package libfile-homedir-perl. Preparing to unpack .../180-libfile-homedir-perl_1.006-2_all.deb ... Unpacking libfile-homedir-perl (1.006-2) ... Selecting previously unselected package libfile-touch-perl. Preparing to unpack .../181-libfile-touch-perl_0.12-2_all.deb ... Unpacking libfile-touch-perl (0.12-2) ... Selecting previously unselected package libio-pty-perl. Preparing to unpack .../182-libio-pty-perl_1%3a1.17-1_i386.deb ... Unpacking libio-pty-perl (1:1.17-1) ... Selecting previously unselected package libipc-run-perl. Preparing to unpack .../183-libipc-run-perl_20220807.0-1_all.deb ... Unpacking libipc-run-perl (20220807.0-1) ... Selecting previously unselected package libclass-method-modifiers-perl. Preparing to unpack .../184-libclass-method-modifiers-perl_2.14-1_all.deb ... Unpacking libclass-method-modifiers-perl (2.14-1) ... Selecting previously unselected package libclass-xsaccessor-perl. Preparing to unpack .../185-libclass-xsaccessor-perl_1.19-4+b1_i386.deb ... Unpacking libclass-xsaccessor-perl (1.19-4+b1) ... Selecting previously unselected package libb-hooks-op-check-perl:i386. Preparing to unpack .../186-libb-hooks-op-check-perl_0.22-2+b1_i386.deb ... Unpacking libb-hooks-op-check-perl:i386 (0.22-2+b1) ... Selecting previously unselected package libdynaloader-functions-perl. Preparing to unpack .../187-libdynaloader-functions-perl_0.003-3_all.deb ... Unpacking libdynaloader-functions-perl (0.003-3) ... Selecting previously unselected package libdevel-callchecker-perl:i386. Preparing to unpack .../188-libdevel-callchecker-perl_0.008-2_i386.deb ... Unpacking libdevel-callchecker-perl:i386 (0.008-2) ... Selecting previously unselected package libparams-classify-perl:i386. Preparing to unpack .../189-libparams-classify-perl_0.015-2+b1_i386.deb ... Unpacking libparams-classify-perl:i386 (0.015-2+b1) ... Selecting previously unselected package libmodule-runtime-perl. Preparing to unpack .../190-libmodule-runtime-perl_0.016-2_all.deb ... Unpacking libmodule-runtime-perl (0.016-2) ... Selecting previously unselected package libimport-into-perl. Preparing to unpack .../191-libimport-into-perl_1.002005-2_all.deb ... Unpacking libimport-into-perl (1.002005-2) ... Selecting previously unselected package librole-tiny-perl. Preparing to unpack .../192-librole-tiny-perl_2.002004-1_all.deb ... Unpacking librole-tiny-perl (2.002004-1) ... Selecting previously unselected package libsub-quote-perl. Preparing to unpack .../193-libsub-quote-perl_2.006008-1_all.deb ... Unpacking libsub-quote-perl (2.006008-1) ... Selecting previously unselected package libmoo-perl. Preparing to unpack .../194-libmoo-perl_2.005005-1_all.deb ... Unpacking libmoo-perl (2.005005-1) ... Selecting previously unselected package libencode-locale-perl. Preparing to unpack .../195-libencode-locale-perl_1.05-3_all.deb ... Unpacking libencode-locale-perl (1.05-3) ... Selecting previously unselected package libtimedate-perl. Preparing to unpack .../196-libtimedate-perl_2.3300-2_all.deb ... Unpacking libtimedate-perl (2.3300-2) ... Selecting previously unselected package libhttp-date-perl. Preparing to unpack .../197-libhttp-date-perl_6.05-2_all.deb ... Unpacking libhttp-date-perl (6.05-2) ... Selecting previously unselected package libfile-listing-perl. Preparing to unpack .../198-libfile-listing-perl_6.15-1_all.deb ... Unpacking libfile-listing-perl (6.15-1) ... Selecting previously unselected package libhtml-tagset-perl. Preparing to unpack .../199-libhtml-tagset-perl_3.20-6_all.deb ... Unpacking libhtml-tagset-perl (3.20-6) ... Selecting previously unselected package libregexp-ipv6-perl. Preparing to unpack .../200-libregexp-ipv6-perl_0.03-3_all.deb ... Unpacking libregexp-ipv6-perl (0.03-3) ... Selecting previously unselected package liburi-perl. Preparing to unpack .../201-liburi-perl_5.17-1_all.deb ... Unpacking liburi-perl (5.17-1) ... Selecting previously unselected package libhtml-parser-perl:i386. Preparing to unpack .../202-libhtml-parser-perl_3.81-1_i386.deb ... Unpacking libhtml-parser-perl:i386 (3.81-1) ... Selecting previously unselected package libhtml-tree-perl. Preparing to unpack .../203-libhtml-tree-perl_5.07-3_all.deb ... Unpacking libhtml-tree-perl (5.07-3) ... Selecting previously unselected package libclone-perl:i386. Preparing to unpack .../204-libclone-perl_0.46-1_i386.deb ... Unpacking libclone-perl:i386 (0.46-1) ... Selecting previously unselected package libio-html-perl. Preparing to unpack .../205-libio-html-perl_1.004-3_all.deb ... Unpacking libio-html-perl (1.004-3) ... Selecting previously unselected package liblwp-mediatypes-perl. Preparing to unpack .../206-liblwp-mediatypes-perl_6.04-2_all.deb ... Unpacking liblwp-mediatypes-perl (6.04-2) ... Selecting previously unselected package libhttp-message-perl. Preparing to unpack .../207-libhttp-message-perl_6.44-1_all.deb ... Unpacking libhttp-message-perl (6.44-1) ... Selecting previously unselected package libhttp-cookies-perl. Preparing to unpack .../208-libhttp-cookies-perl_6.10-1_all.deb ... Unpacking libhttp-cookies-perl (6.10-1) ... Selecting previously unselected package libhttp-negotiate-perl. Preparing to unpack .../209-libhttp-negotiate-perl_6.01-2_all.deb ... Unpacking libhttp-negotiate-perl (6.01-2) ... Selecting previously unselected package perl-openssl-defaults:i386. Preparing to unpack .../210-perl-openssl-defaults_7+b1_i386.deb ... Unpacking perl-openssl-defaults:i386 (7+b1) ... Selecting previously unselected package libnet-ssleay-perl:i386. Preparing to unpack .../211-libnet-ssleay-perl_1.92-2+b1_i386.deb ... Unpacking libnet-ssleay-perl:i386 (1.92-2+b1) ... Selecting previously unselected package libio-socket-ssl-perl. Preparing to unpack .../212-libio-socket-ssl-perl_2.081-2_all.deb ... Unpacking libio-socket-ssl-perl (2.081-2) ... Selecting previously unselected package libnet-http-perl. Preparing to unpack .../213-libnet-http-perl_6.22-1_all.deb ... Unpacking libnet-http-perl (6.22-1) ... Selecting previously unselected package liblwp-protocol-https-perl. Preparing to unpack .../214-liblwp-protocol-https-perl_6.10-1_all.deb ... Unpacking liblwp-protocol-https-perl (6.10-1) ... Selecting previously unselected package libtry-tiny-perl. Preparing to unpack .../215-libtry-tiny-perl_0.31-2_all.deb ... Unpacking libtry-tiny-perl (0.31-2) ... Selecting previously unselected package libwww-robotrules-perl. Preparing to unpack .../216-libwww-robotrules-perl_6.02-1_all.deb ... Unpacking libwww-robotrules-perl (6.02-1) ... Selecting previously unselected package libwww-perl. Preparing to unpack .../217-libwww-perl_6.68-1_all.deb ... Unpacking libwww-perl (6.68-1) ... Selecting previously unselected package patchutils. Preparing to unpack .../218-patchutils_0.4.2-1_i386.deb ... Unpacking patchutils (0.4.2-1) ... Selecting previously unselected package wdiff. Preparing to unpack .../219-wdiff_1.2.2-5_i386.deb ... Unpacking wdiff (1.2.2-5) ... Selecting previously unselected package devscripts. Preparing to unpack .../220-devscripts_2.23.3_i386.deb ... Unpacking devscripts (2.23.3) ... Selecting previously unselected package ivy. Preparing to unpack .../221-ivy_2.5.1-2_all.deb ... Unpacking ivy (2.5.1-2) ... Selecting previously unselected package libasm-java. Preparing to unpack .../222-libasm-java_9.4-1_all.deb ... Unpacking libasm-java (9.4-1) ... Selecting previously unselected package libbsf-java. Preparing to unpack .../223-libbsf-java_1%3a2.4.0-8_all.deb ... Unpacking libbsf-java (1:2.4.0-8) ... Selecting previously unselected package libcommons-cli-java. Preparing to unpack .../224-libcommons-cli-java_1.5.0-1_all.deb ... Unpacking libcommons-cli-java (1.5.0-1) ... Selecting previously unselected package libapache-pom-java. Preparing to unpack .../225-libapache-pom-java_29-2_all.deb ... Unpacking libapache-pom-java (29-2) ... Selecting previously unselected package libcommons-parent-java. Preparing to unpack .../226-libcommons-parent-java_56-1_all.deb ... Unpacking libcommons-parent-java (56-1) ... Selecting previously unselected package libcommons-logging-java. Preparing to unpack .../227-libcommons-logging-java_1.2-3_all.deb ... Unpacking libcommons-logging-java (1.2-3) ... Selecting previously unselected package libjansi-java. Preparing to unpack .../228-libjansi-java_2.4.0-2_all.deb ... Unpacking libjansi-java (2.4.0-2) ... Selecting previously unselected package libqdox-java. Preparing to unpack .../229-libqdox-java_1.12.1-3_all.deb ... Unpacking libqdox-java (1.12.1-3) ... Selecting previously unselected package libservlet-api-java. Preparing to unpack .../230-libservlet-api-java_4.0.1-2_all.deb ... Unpacking libservlet-api-java (4.0.1-2) ... Selecting previously unselected package libxpp3-java. Preparing to unpack .../231-libxpp3-java_1.1.4c-3_all.deb ... Unpacking libxpp3-java (1.1.4c-3) ... Selecting previously unselected package libxstream-java. Preparing to unpack .../232-libxstream-java_1.4.20-1_all.deb ... Unpacking libxstream-java (1.4.20-1) ... Selecting previously unselected package groovy. Preparing to unpack .../233-groovy_2.4.21-7_all.deb ... Unpacking groovy (2.4.21-7) ... Selecting previously unselected package libatinject-jsr330-api-java. Preparing to unpack .../234-libatinject-jsr330-api-java_1.0+ds1-5_all.deb ... Unpacking libatinject-jsr330-api-java (1.0+ds1-5) ... Selecting previously unselected package libcommons-collections3-java. Preparing to unpack .../235-libcommons-collections3-java_3.2.2-2_all.deb ... Unpacking libcommons-collections3-java (3.2.2-2) ... Selecting previously unselected package libcommons-compress-java. Preparing to unpack .../236-libcommons-compress-java_1.22-1_all.deb ... Unpacking libcommons-compress-java (1.22-1) ... Selecting previously unselected package libcommons-io-java. Preparing to unpack .../237-libcommons-io-java_2.11.0-2_all.deb ... Unpacking libcommons-io-java (2.11.0-2) ... Selecting previously unselected package libcommons-lang-java. Preparing to unpack .../238-libcommons-lang-java_2.6-10_all.deb ... Unpacking libcommons-lang-java (2.6-10) ... Selecting previously unselected package liberror-prone-java. Preparing to unpack .../239-liberror-prone-java_2.18.0-1_all.deb ... Unpacking liberror-prone-java (2.18.0-1) ... Selecting previously unselected package libjsr305-java. Preparing to unpack .../240-libjsr305-java_0.1~+svn49-11_all.deb ... Unpacking libjsr305-java (0.1~+svn49-11) ... Selecting previously unselected package libguava-java. Preparing to unpack .../241-libguava-java_31.1-1_all.deb ... Unpacking libguava-java (31.1-1) ... Selecting previously unselected package libcommons-codec-java. Preparing to unpack .../242-libcommons-codec-java_1.15-1_all.deb ... Unpacking libcommons-codec-java (1.15-1) ... Selecting previously unselected package libhttpcore-java. Preparing to unpack .../243-libhttpcore-java_4.4.16-1_all.deb ... Unpacking libhttpcore-java (4.4.16-1) ... Selecting previously unselected package libhttpclient-java. Preparing to unpack .../244-libhttpclient-java_4.5.14-1_all.deb ... Unpacking libhttpclient-java (4.5.14-1) ... Selecting previously unselected package libjarjar-java. Preparing to unpack .../245-libjarjar-java_1.4+svn142-12_all.deb ... Unpacking libjarjar-java (1.4+svn142-12) ... Selecting previously unselected package libjcip-annotations-java. Preparing to unpack .../246-libjcip-annotations-java_20060626-6_all.deb ... Unpacking libjcip-annotations-java (20060626-6) ... Selecting previously unselected package libjna-jni. Preparing to unpack .../247-libjna-jni_5.13.0-2_i386.deb ... Unpacking libjna-jni (5.13.0-2) ... Selecting previously unselected package libjna-java. Preparing to unpack .../248-libjna-java_5.13.0-2_all.deb ... Unpacking libjna-java (5.13.0-2) ... Selecting previously unselected package libjzlib-java. Preparing to unpack .../249-libjzlib-java_1.1.3-2_all.deb ... Unpacking libjzlib-java (1.1.3-2) ... Selecting previously unselected package libjsch-java. Preparing to unpack .../250-libjsch-java_0.1.55-1_all.deb ... Unpacking libjsch-java (0.1.55-1) ... Selecting previously unselected package libminlog-java. Preparing to unpack .../251-libminlog-java_1.3.0-1.1_all.deb ... Unpacking libminlog-java (1.3.0-1.1) ... Selecting previously unselected package libobjenesis-java. Preparing to unpack .../252-libobjenesis-java_3.3-3_all.deb ... Unpacking libobjenesis-java (3.3-3) ... Selecting previously unselected package libreflectasm-java. Preparing to unpack .../253-libreflectasm-java_1.11.9+dfsg-4_all.deb ... Unpacking libreflectasm-java (1.11.9+dfsg-4) ... Selecting previously unselected package libkryo-java. Preparing to unpack .../254-libkryo-java_2.20-7_all.deb ... Unpacking libkryo-java (2.20-7) ... Selecting previously unselected package liblogback-java. Preparing to unpack .../255-liblogback-java_1%3a1.2.11-2_all.deb ... Unpacking liblogback-java (1:1.2.11-2) ... Selecting previously unselected package libncurses6:i386. Preparing to unpack .../256-libncurses6_6.4-2_i386.deb ... Unpacking libncurses6:i386 (6.4-2) ... Selecting previously unselected package libnative-platform-jni. Preparing to unpack .../257-libnative-platform-jni_0.14-5_i386.deb ... Unpacking libnative-platform-jni (0.14-5) ... Selecting previously unselected package libnative-platform-java. Preparing to unpack .../258-libnative-platform-java_0.14-5_all.deb ... Unpacking libnative-platform-java (0.14-5) ... Selecting previously unselected package libxml-commons-external-java. Preparing to unpack .../259-libxml-commons-external-java_1.4.01-5_all.deb ... Unpacking libxml-commons-external-java (1.4.01-5) ... Selecting previously unselected package libxml-commons-resolver1.1-java. Preparing to unpack .../260-libxml-commons-resolver1.1-java_1.2-11_all.deb ... Unpacking libxml-commons-resolver1.1-java (1.2-11) ... Selecting previously unselected package libxerces2-java. Preparing to unpack .../261-libxerces2-java_2.12.2-1_all.deb ... Unpacking libxerces2-java (2.12.2-1) ... Selecting previously unselected package libnekohtml-java. Preparing to unpack .../262-libnekohtml-java_1.9.22.noko2-0.1_all.deb ... Unpacking libnekohtml-java (1.9.22.noko2-0.1) ... Selecting previously unselected package libxbean-reflect-java. Preparing to unpack .../263-libxbean-reflect-java_4.5-8_all.deb ... Unpacking libxbean-reflect-java (4.5-8) ... Selecting previously unselected package libgradle-core-java. Preparing to unpack .../264-libgradle-core-java_4.4.1-18_all.deb ... Unpacking libgradle-core-java (4.4.1-18) ... Selecting previously unselected package libbcprov-java. Preparing to unpack .../265-libbcprov-java_1.72-2_all.deb ... Unpacking libbcprov-java (1.72-2) ... Selecting previously unselected package libbcpg-java. Preparing to unpack .../266-libbcpg-java_1.72-2_all.deb ... Unpacking libbcpg-java (1.72-2) ... Selecting previously unselected package libbsh-java. Preparing to unpack .../267-libbsh-java_2.0b4-20_all.deb ... Unpacking libbsh-java (2.0b4-20) ... Selecting previously unselected package libdd-plist-java. Preparing to unpack .../268-libdd-plist-java_1.20-1.1_all.deb ... Unpacking libdd-plist-java (1.20-1.1) ... Selecting previously unselected package libjaxen-java. Preparing to unpack .../269-libjaxen-java_1.1.6-4_all.deb ... Unpacking libjaxen-java (1.1.6-4) ... Selecting previously unselected package libdom4j-java. Preparing to unpack .../270-libdom4j-java_2.1.3-2_all.deb ... Unpacking libdom4j-java (2.1.3-2) ... Selecting previously unselected package libbcel-java. Preparing to unpack .../271-libbcel-java_6.5.0-2_all.deb ... Unpacking libbcel-java (6.5.0-2) ... Selecting previously unselected package libjformatstring-java. Preparing to unpack .../272-libjformatstring-java_0.10~20131207-2.1_all.deb ... Unpacking libjformatstring-java (0.10~20131207-2.1) ... Selecting previously unselected package libfindbugs-java. Preparing to unpack .../273-libfindbugs-java_3.1.0~preview2-3_all.deb ... Unpacking libfindbugs-java (3.1.0~preview2-3) ... Selecting previously unselected package libgoogle-gson-java. Preparing to unpack .../274-libgoogle-gson-java_2.10-1_all.deb ... Unpacking libgoogle-gson-java (2.10-1) ... Selecting previously unselected package libaopalliance-java. Preparing to unpack .../275-libaopalliance-java_20070526-7_all.deb ... Unpacking libaopalliance-java (20070526-7) ... Selecting previously unselected package libguice-java. Preparing to unpack .../276-libguice-java_4.2.3-2_all.deb ... Unpacking libguice-java (4.2.3-2) ... Selecting previously unselected package libjatl-java. Preparing to unpack .../277-libjatl-java_0.2.3-1.1_all.deb ... Unpacking libjatl-java (0.2.3-1.1) ... Selecting previously unselected package libjcifs-java. Preparing to unpack .../278-libjcifs-java_1.3.19-2_all.deb ... Unpacking libjcifs-java (1.3.19-2) ... Selecting previously unselected package libeclipse-jdt-annotation-java. Preparing to unpack .../279-libeclipse-jdt-annotation-java_2.2.700+eclipse4.26-2_all.deb ... Unpacking libeclipse-jdt-annotation-java (2.2.700+eclipse4.26-2) ... Selecting previously unselected package libjavaewah-java. Preparing to unpack .../280-libjavaewah-java_1.1.7-1_all.deb ... Unpacking libjavaewah-java (1.1.7-1) ... Selecting previously unselected package libel-api-java. Preparing to unpack .../281-libel-api-java_3.0.0-3_all.deb ... Unpacking libel-api-java (3.0.0-3) ... Selecting previously unselected package libjsp-api-java. Preparing to unpack .../282-libjsp-api-java_2.3.4-3_all.deb ... Unpacking libjsp-api-java (2.3.4-3) ... Selecting previously unselected package libwebsocket-api-java. Preparing to unpack .../283-libwebsocket-api-java_1.1-2_all.deb ... Unpacking libwebsocket-api-java (1.1-2) ... Selecting previously unselected package libjetty9-java. Preparing to unpack .../284-libjetty9-java_9.4.50-3_all.deb ... Unpacking libjetty9-java (9.4.50-3) ... Selecting previously unselected package libjgit-java. Preparing to unpack .../285-libjgit-java_4.11.9-2_all.deb ... Unpacking libjgit-java (4.11.9-2) ... Selecting previously unselected package libjs-jquery. Preparing to unpack .../286-libjs-jquery_3.6.1+dfsg+~3.5.14-1_all.deb ... Unpacking libjs-jquery (3.6.1+dfsg+~3.5.14-1) ... Selecting previously unselected package libcommons-lang3-java. Preparing to unpack .../287-libcommons-lang3-java_3.12.0-2_all.deb ... Unpacking libcommons-lang3-java (3.12.0-2) ... Selecting previously unselected package libplexus-utils2-java. Preparing to unpack .../288-libplexus-utils2-java_3.4.2-1_all.deb ... Unpacking libplexus-utils2-java (3.4.2-1) ... Selecting previously unselected package libwagon-provider-api-java. Preparing to unpack .../289-libwagon-provider-api-java_3.5.3-1_all.deb ... Unpacking libwagon-provider-api-java (3.5.3-1) ... Selecting previously unselected package libmaven-resolver-java. Preparing to unpack .../290-libmaven-resolver-java_1.6.3-1_all.deb ... Unpacking libmaven-resolver-java (1.6.3-1) ... Selecting previously unselected package libgeronimo-annotation-1.3-spec-java. Preparing to unpack .../291-libgeronimo-annotation-1.3-spec-java_1.3-1_all.deb ... Unpacking libgeronimo-annotation-1.3-spec-java (1.3-1) ... Selecting previously unselected package libmaven-parent-java. Preparing to unpack .../292-libmaven-parent-java_35-1_all.deb ... Unpacking libmaven-parent-java (35-1) ... Selecting previously unselected package libmaven-shared-utils-java. Preparing to unpack .../293-libmaven-shared-utils-java_3.3.4-1_all.deb ... Unpacking libmaven-shared-utils-java (3.3.4-1) ... Selecting previously unselected package libplexus-cipher-java. Preparing to unpack .../294-libplexus-cipher-java_2.0-1_all.deb ... Unpacking libplexus-cipher-java (2.0-1) ... Selecting previously unselected package libplexus-classworlds-java. Preparing to unpack .../295-libplexus-classworlds-java_2.7.0-1_all.deb ... Unpacking libplexus-classworlds-java (2.7.0-1) ... Selecting previously unselected package libplexus-component-annotations-java. Preparing to unpack .../296-libplexus-component-annotations-java_2.1.1-1_all.deb ... Unpacking libplexus-component-annotations-java (2.1.1-1) ... Selecting previously unselected package libplexus-interpolation-java. Preparing to unpack .../297-libplexus-interpolation-java_1.26-1_all.deb ... Unpacking libplexus-interpolation-java (1.26-1) ... Selecting previously unselected package libplexus-sec-dispatcher-java. Preparing to unpack .../298-libplexus-sec-dispatcher-java_2.0-3_all.deb ... Unpacking libplexus-sec-dispatcher-java (2.0-3) ... Selecting previously unselected package libgeronimo-interceptor-3.0-spec-java. Preparing to unpack .../299-libgeronimo-interceptor-3.0-spec-java_1.0.1-4_all.deb ... Unpacking libgeronimo-interceptor-3.0-spec-java (1.0.1-4) ... Selecting previously unselected package libcdi-api-java. Preparing to unpack .../300-libcdi-api-java_1.2-3_all.deb ... Unpacking libcdi-api-java (1.2-3) ... Selecting previously unselected package libsisu-inject-java. Preparing to unpack .../301-libsisu-inject-java_0.3.4-2_all.deb ... Unpacking libsisu-inject-java (0.3.4-2) ... Selecting previously unselected package libsisu-plexus-java. Preparing to unpack .../302-libsisu-plexus-java_0.3.4-3_all.deb ... Unpacking libsisu-plexus-java (0.3.4-3) ... Selecting previously unselected package libmaven3-core-java. Preparing to unpack .../303-libmaven3-core-java_3.8.7-1_all.deb ... Unpacking libmaven3-core-java (3.8.7-1) ... Selecting previously unselected package libplexus-container-default-java. Preparing to unpack .../304-libplexus-container-default-java_2.1.1-1_all.deb ... Unpacking libplexus-container-default-java (2.1.1-1) ... Selecting previously unselected package libpolyglot-maven-java. Preparing to unpack .../305-libpolyglot-maven-java_0.8~tobrien+git20120905-10_all.deb ... Unpacking libpolyglot-maven-java (0.8~tobrien+git20120905-10) ... Selecting previously unselected package librhino-java. Preparing to unpack .../306-librhino-java_1.7.14-2.1_all.deb ... Unpacking librhino-java (1.7.14-2.1) ... Selecting previously unselected package libsimple-http-java. Preparing to unpack .../307-libsimple-http-java_4.1.21-1.1_all.deb ... Unpacking libsimple-http-java (4.1.21-1.1) ... Selecting previously unselected package libwagon-file-java. Preparing to unpack .../308-libwagon-file-java_3.5.3-1_all.deb ... Unpacking libwagon-file-java (3.5.3-1) ... Selecting previously unselected package libjsoup-java. Preparing to unpack .../309-libjsoup-java_1.15.3-1_all.deb ... Unpacking libjsoup-java (1.15.3-1) ... Selecting previously unselected package libwagon-http-java. Preparing to unpack .../310-libwagon-http-java_3.5.3-1_all.deb ... Unpacking libwagon-http-java (3.5.3-1) ... Selecting previously unselected package libjcommander-java. Preparing to unpack .../311-libjcommander-java_1.71-4_all.deb ... Unpacking libjcommander-java (1.71-4) ... Selecting previously unselected package testng. Preparing to unpack .../312-testng_6.9.12-4_all.deb ... Unpacking testng (6.9.12-4) ... Selecting previously unselected package libgradle-plugins-java. Preparing to unpack .../313-libgradle-plugins-java_4.4.1-18_all.deb ... Unpacking libgradle-plugins-java (4.4.1-18) ... Selecting previously unselected package gradle. Preparing to unpack .../314-gradle_4.4.1-18_all.deb ... Unpacking gradle (4.4.1-18) ... Selecting previously unselected package maven-repo-helper. Preparing to unpack .../315-maven-repo-helper_1.11_all.deb ... Unpacking maven-repo-helper (1.11) ... Selecting previously unselected package gradle-debian-helper. Preparing to unpack .../316-gradle-debian-helper_2.4_all.deb ... Unpacking gradle-debian-helper (2.4) ... Selecting previously unselected package javahelper. Preparing to unpack .../317-javahelper_0.78_all.deb ... Unpacking javahelper (0.78) ... Selecting previously unselected package libbyte-buddy-java. Preparing to unpack .../318-libbyte-buddy-java_1.12.21-1_all.deb ... Unpacking libbyte-buddy-java (1.12.21-1) ... Selecting previously unselected package libcommons-math3-java. Preparing to unpack .../319-libcommons-math3-java_3.6.1-3_all.deb ... Unpacking libcommons-math3-java (3.6.1-3) ... Selecting previously unselected package libjackson2-annotations-java. Preparing to unpack .../320-libjackson2-annotations-java_2.14.0-1_all.deb ... Unpacking libjackson2-annotations-java (2.14.0-1) ... Selecting previously unselected package libjackson2-core-java. Preparing to unpack .../321-libjackson2-core-java_2.14.1-1_all.deb ... Unpacking libjackson2-core-java (2.14.1-1) ... Selecting previously unselected package libjackson2-databind-java. Preparing to unpack .../322-libjackson2-databind-java_2.14.0-1_all.deb ... Unpacking libjackson2-databind-java (2.14.0-1) ... Selecting previously unselected package liblz4-jni. Preparing to unpack .../323-liblz4-jni_1.8.0-3_i386.deb ... Unpacking liblz4-jni (1.8.0-3) ... Selecting previously unselected package liblz4-java. Preparing to unpack .../324-liblz4-java_1.8.0-3_all.deb ... Unpacking liblz4-java (1.8.0-3) ... Selecting previously unselected package libmockito-java. Preparing to unpack .../325-libmockito-java_2.23.0-2_all.deb ... Unpacking libmockito-java (2.23.0-2) ... Selecting previously unselected package libredberry-pipe-java. Preparing to unpack .../326-libredberry-pipe-java_1.0.0~alpha0-3_all.deb ... Unpacking libredberry-pipe-java (1.0.0~alpha0-3) ... Selecting previously unselected package libtrove3-java. Preparing to unpack .../327-libtrove3-java_3.0.3-5_all.deb ... Unpacking libtrove3-java (3.0.3-5) ... Setting up libjcifs-java (1.3.19-2) ... Setting up libbcprov-java (1.72-2) ... Setting up libksba8:i386 (1.6.3-2) ... Setting up media-types (10.0.0) ... Setting up libpipeline1:i386 (1.5.7-1) ... Setting up libgraphite2-3:i386 (1.3.14-1) ... Setting up liblcms2-2:i386 (2.14-2) ... Setting up libpixman-1-0:i386 (0.42.2-1) ... Setting up libjcommander-java (1.71-4) ... Setting up libjackson2-annotations-java (2.14.0-1) ... Setting up wdiff (1.2.2-5) ... Setting up libpciaccess0:i386 (0.17-2) ... Setting up libslf4j-java (1.7.32-1) ... Setting up libfile-which-perl (1.27-2) ... Setting up libxau6:i386 (1:1.0.9-1) ... Setting up libplexus-utils2-java (3.4.2-1) ... Setting up libredberry-pipe-java (1.0.0~alpha0-3) ... Setting up libplexus-classworlds-java (2.7.0-1) ... Setting up libqdox-java (1.12.1-3) ... Setting up libicu72:i386 (72.1-3) ... Setting up liblerc4:i386 (4.0.0+ds-2) ... Setting up libjsr305-java (0.1~+svn49-11) ... Setting up libsimple-http-java (4.1.21-1.1) ... Setting up bsdextrautils (2.38.1-5+b1) ... Setting up hicolor-icon-theme (0.17-2) ... Setting up java-common (0.74) ... Setting up libdynaloader-functions-perl (0.003-3) ... Setting up libdatrie1:i386 (0.2.13-2+b1) ... Setting up libjcip-annotations-java (20060626-6) ... Setting up libobjenesis-java (3.3-3) ... Setting up libclass-method-modifiers-perl (2.14-1) ... Setting up libaopalliance-java (20070526-7) ... Setting up libcommons-cli-java (1.5.0-1) ... Setting up libio-pty-perl (1:1.17-1) ... Setting up libmagic-mgc (1:5.44-3) ... Setting up liblogback-java (1:1.2.11-2) ... Setting up libclone-perl:i386 (0.46-1) ... Setting up libminlog-java (1.3.0-1.1) ... Setting up libarchive-zip-perl (1.68-1) ... Setting up libglib2.0-0:i386 (2.74.6-2) ... No schema files found: doing nothing. Setting up libglvnd0:i386 (1.6.0-1) ... Setting up libgoogle-gson-java (2.10-1) ... Setting up libhtml-tagset-perl (3.20-6) ... Setting up unzip (6.0-28) ... Setting up libdebhelper-perl (13.11.4) ... Setting up libbrotli1:i386 (1.0.9-2+b6) ... Setting up liblwp-mediatypes-perl (6.04-2) ... Setting up libgdk-pixbuf2.0-common (2.42.10+dfsg-1) ... Setting up libasm-java (9.4-1) ... Setting up x11-common (1:7.7+23) ... invoke-rc.d: could not determine current runlevel Setting up X socket directories... /tmp/.X11-unix /tmp/.ICE-unix. Setting up libtry-tiny-perl (0.31-2) ... Setting up libsensors-config (1:3.6.0-7.1) ... Setting up libmagic1:i386 (1:5.44-3) ... Setting up libdeflate0:i386 (1.14-1) ... Setting up perl-openssl-defaults:i386 (7+b1) ... Setting up libdd-plist-java (1.20-1.1) ... Setting up gettext-base (0.21-12) ... Setting up m4 (1.4.19-3) ... Setting up libel-api-java (3.0.0-3) ... Setting up libencode-locale-perl (1.05-3) ... Setting up libplexus-component-annotations-java (2.1.1-1) ... Setting up libnpth0:i386 (1.6-3) ... Setting up file (1:5.44-3) ... Setting up libpolyglot-maven-java (0.8~tobrien+git20120905-10) ... Setting up libfelix-gogo-runtime-java (0.16.2-1.1) ... Setting up libassuan0:i386 (2.5.5-5) ... Setting up libjzlib-java (1.1.3-2) ... Setting up libjbig0:i386 (2.1-6.1) ... Setting up libsasl2-modules-db:i386 (2.1.28+dfsg-10) ... Setting up libgeronimo-annotation-1.3-spec-java (1.3-1) ... Setting up libgeronimo-interceptor-3.0-spec-java (1.0.1-4) ... Setting up libcommons-collections3-java (3.2.2-2) ... Setting up libasound2-data (1.2.8-1) ... Setting up libjsch-java (0.1.55-1) ... Setting up libreflectasm-java (1.11.9+dfsg-4) ... Setting up librhino-java (1.7.14-2.1) ... Setting up autotools-dev (20220109.1) ... Setting up libz3-4:i386 (4.8.12-3.1) ... Setting up libbsf-java (1:2.4.0-8) ... Setting up libosgi-annotation-java (8.1.0-1) ... Setting up libjformatstring-java (0.10~20131207-2.1) ... Setting up libjavaewah-java (1.1.7-1) ... Setting up libjpeg62-turbo:i386 (1:2.1.5-2) ... Setting up libjaxen-java (1.1.6-4) ... Setting up libx11-data (2:1.8.4-2) ... Setting up libnspr4:i386 (2:4.35-1) ... Setting up gnupg-l10n (2.2.40-1.1) ... Setting up libeclipse-jdt-annotation-java (2.2.700+eclipse4.26-2) ... Setting up libjansi-java (2.4.0-2) ... Setting up libapache-pom-java (29-2) ... Setting up libavahi-common-data:i386 (0.8-10) ... Setting up libxpp3-java (1.1.4c-3) ... Setting up libncurses6:i386 (6.4-2) ... Setting up libatinject-jsr330-api-java (1.0+ds1-5) ... Setting up libdbus-1-3:i386 (1.14.6-1) ... Setting up libwebsocket-api-java (1.1-2) ... Setting up libfribidi0:i386 (1.0.8-2.1) ... Setting up libplexus-interpolation-java (1.26-1) ... Setting up libpng16-16:i386 (1.6.39-2) ... Setting up libxml-commons-resolver1.1-java (1.2-11) ... Setting up libkryo-java (2.20-7) ... Setting up libxz-java (1.9-1) ... Setting up libio-html-perl (1.004-3) ... Setting up libjna-jni (5.13.0-2) ... Setting up autopoint (0.21-12) ... Setting up libb-hooks-op-check-perl:i386 (0.22-2+b1) ... Setting up fonts-dejavu-core (2.37-6) ... Setting up libfelix-framework-java (4.6.1-2.1) ... Setting up libipc-run-perl (20220807.0-1) ... Setting up libpcsclite1:i386 (1.9.9-2) ... Setting up libsensors5:i386 (1:3.6.0-7.1) ... Setting up libhamcrest-java (2.2-1) ... Setting up libglapi-mesa:i386 (22.3.6-1+deb12u1) ... Setting up libbsh-java (2.0b4-20) ... Setting up libjsp-api-java (2.3.4-3) ... Setting up libsasl2-2:i386 (2.1.28+dfsg-10) ... Setting up autoconf (2.71-3) ... Setting up libwebp7:i386 (1.2.4-0.1) ... Setting up libtimedate-perl (2.3300-2) ... Setting up libregexp-ipv6-perl (0.03-3) ... Setting up libgif7:i386 (5.2.1-2.5) ... Setting up libjarjar-java (1.4+svn142-12) ... Setting up libtrove3-java (3.0.3-5) ... Setting up sensible-utils (0.0.17+nmu1) ... Setting up libxshmfence1:i386 (1.3-1) ... Setting up libjsoup-java (1.15.3-1) ... Setting up at-spi2-common (2.46.0-5) ... Setting up libtiff6:i386 (4.5.0-5) ... Setting up libuchardet0:i386 (0.0.7-1) ... Setting up libxml-commons-external-java (1.4.01-5) ... Setting up libjna-java (5.13.0-2) ... Setting up libxbean-reflect-java (4.5-8) ... Setting up libasound2:i386 (1.2.8-1+b1) ... Setting up libservlet-api-java (4.0.1-2) ... Setting up librole-tiny-perl (2.002004-1) ... Setting up libjackson2-core-java (2.14.1-1) ... Setting up libsub-override-perl (0.09-4) ... Setting up libthai-data (0.1.29-1) ... Setting up netbase (6.4) ... Setting up libcommons-math3-java (3.6.1-3) ... Setting up libsub-quote-perl (2.006008-1) ... Setting up libnative-platform-jni (0.14-5) ... Setting up libclass-xsaccessor-perl (1.19-4+b1) ... Setting up libgtk2.0-common (2.24.33-2) ... Setting up libatk1.0-0:i386 (2.46.0-5) ... Setting up liblz4-jni (1.8.0-3) ... Setting up libhttpcore-java (4.4.16-1) ... Setting up libbcpg-java (1.72-2) ... Setting up libjs-jquery (3.6.1+dfsg+~3.5.14-1) ... Setting up libxerces2-java (2.12.2-1) ... Setting up libfile-dirlist-perl (0.05-3) ... Setting up libfile-homedir-perl (1.006-2) ... Setting up libantlr-java (2.7.7+dfsg-12) ... Setting up libyaml-snake-java (1.33-2) ... Setting up openssl (3.0.8-1) ... Setting up libbsd0:i386 (0.11.7-2) ... Setting up libdrm-common (2.4.114-1) ... Setting up libcdi-api-java (1.2-3) ... Setting up libelf1:i386 (0.188-2.1) ... Setting up readline-common (8.2-1.3) ... Setting up libhawtjni-runtime-java (1.18-1) ... Setting up libxml2:i386 (2.9.14+dfsg-1.2) ... Setting up liburi-perl (5.17-1) ... Setting up libfile-touch-perl (0.12-2) ... Setting up dctrl-tools (2.24-3) ... Setting up libjatl-java (0.2.3-1.1) ... Setting up libnet-ssleay-perl:i386 (1.92-2+b1) ... Setting up automake (1:1.16.5-1.3) ... update-alternatives: using /usr/bin/automake-1.16 to provide /usr/bin/automake (automake) in auto mode Setting up pinentry-curses (1.2.1-1) ... Setting up libdom4j-java (2.1.3-2) ... Setting up libfile-stripnondeterminism-perl (1.13.1-1) ... Setting up libwagon-provider-api-java (3.5.3-1) ... Setting up libnative-platform-java (0.14-5) ... Setting up libosgi-core-java (8.0.0-2) ... Setting up libhttp-date-perl (6.05-2) ... Setting up libxstream-java (1.4.20-1) ... Setting up libnekohtml-java (1.9.22.noko2-0.1) ... Setting up libxdmcp6:i386 (1:1.1.2-3) ... Setting up liblz4-java (1.8.0-3) ... Setting up libxcb1:i386 (1.15-1) ... Setting up gettext (0.21-12) ... Setting up libjetty9-java (9.4.50-3) ... Setting up libxcb-xfixes0:i386 (1.15-1) ... Setting up java-wrappers (0.4) ... Setting up libfile-listing-perl (6.15-1) ... Setting up libosgi-compendium-java (7.0.0-1) ... Setting up libtool (2.4.7-5) ... Setting up libxcb-render0:i386 (1.15-1) ... Setting up fontconfig-config (2.14.1-4) ... Setting up libxcb-glx0:i386 (1.15-1) ... Setting up libmaven-parent-java (35-1) ... Setting up libedit2:i386 (3.1-20221030-2) ... Setting up libreadline8:i386 (8.2-1.3) ... Setting up libcommons-parent-java (56-1) ... Setting up libavahi-common3:i386 (0.8-10) ... Setting up libcommons-logging-java (1.2-3) ... Setting up libnet-http-perl (6.22-1) ... Setting up libsisu-inject-java (0.3.4-2) ... Setting up libnss3:i386 (2:3.87.1-1) ... Setting up libxcb-shm0:i386 (1.15-1) ... Setting up libdevel-callchecker-perl:i386 (0.008-2) ... Setting up libcommons-lang-java (2.6-10) ... Setting up libldap-2.5-0:i386 (2.5.13+dfsg-5) ... Setting up libjackson2-databind-java (2.14.0-1) ... Setting up libplexus-cipher-java (2.0-1) ... Setting up intltool-debian (0.35.0+20060710.6) ... Setting up libxcb-present0:i386 (1.15-1) ... Setting up dh-autoreconf (20) ... Setting up patchutils (0.4.2-1) ... Setting up libthai0:i386 (0.1.29-1) ... Setting up ca-certificates (20230311) ... Updating certificates in /etc/ssl/certs... 140 added, 0 removed; done. Setting up libsisu-plexus-java (0.3.4-3) ... Setting up libbcel-java (6.5.0-2) ... Setting up libfreetype6:i386 (2.12.1+dfsg-5) ... Setting up libxcb-sync1:i386 (1.15-1) ... Setting up testng (6.9.12-4) ... Setting up shared-mime-info (2.2-1) ... Setting up libcommons-lang3-java (3.12.0-2) ... Setting up libxcb-dri2-0:i386 (1.15-1) ... Setting up dh-strip-nondeterminism (1.13.1-1) ... Setting up libwww-robotrules-perl (6.02-1) ... Setting up libfelix-resolver-java (1.16.0-1) ... Setting up libdrm2:i386 (2.4.114-1+b1) ... Setting up dwz (0.15-1) ... Setting up libjansi-native-java (1.8-1) ... Setting up groff-base (1.22.4-10) ... Setting up libxcb-randr0:i386 (1.15-1) ... Setting up libhtml-parser-perl:i386 (3.81-1) ... Setting up libllvm15:i386 (1:15.0.6-4+b1) ... Setting up gpgconf (2.2.40-1.1) ... Setting up libjansi1-java (1.18-3) ... Setting up libplexus-sec-dispatcher-java (2.0-3) ... Setting up libx11-6:i386 (2:1.8.4-2) ... Setting up libharfbuzz0b:i386 (6.0.0+dfsg-3) ... Setting up libgdk-pixbuf-2.0-0:i386 (2.42.10+dfsg-1+b1) ... Setting up libfontconfig1:i386 (2.14.1-4) ... Setting up libwagon-file-java (3.5.3-1) ... Setting up libcommons-codec-java (1.15-1) ... Setting up libjline2-java (2.14.6-5) ... Setting up libxcomposite1:i386 (1:0.4.5-1) ... Setting up libavahi-client3:i386 (0.8-10) ... Setting up libio-socket-ssl-perl (2.081-2) ... Setting up gpg (2.2.40-1.1) ... Setting up gnupg-utils (2.2.40-1.1) ... Setting up libhttp-message-perl (6.44-1) ... Setting up libdrm-amdgpu1:i386 (2.4.114-1+b1) ... Setting up libxcb-dri3-0:i386 (1.15-1) ... Setting up gtk-update-icon-cache (3.24.37-2) ... Setting up libx11-xcb1:i386 (2:1.8.4-2) ... Setting up libhttp-negotiate-perl (6.01-2) ... Setting up fontconfig (2.14.1-4) ... Regenerating fonts cache... done. Setting up libdrm-nouveau2:i386 (2.4.114-1+b1) ... Setting up libfindbugs-java (3.1.0~preview2-3) ... Setting up libxdamage1:i386 (1:1.1.6-1) ... Setting up gpg-agent (2.2.40-1.1) ... Setting up libxrender1:i386 (1:0.9.10-1.1) ... Setting up libcommons-compress-java (1.22-1) ... Setting up libhttp-cookies-perl (6.10-1) ... Setting up libcommons-io-java (2.11.0-2) ... Setting up libdrm-radeon1:i386 (2.4.114-1+b1) ... Setting up po-debconf (1.0.21+nmu1) ... Setting up libhtml-tree-perl (5.07-3) ... Setting up libpython3.11-stdlib:i386 (3.11.2-6) ... Setting up libparams-classify-perl:i386 (0.015-2+b1) ... Setting up gpgsm (2.2.40-1.1) ... Setting up libpango-1.0-0:i386 (1.50.12+ds-1) ... Setting up libdrm-intel1:i386 (2.4.114-1+b1) ... Setting up libgl1-mesa-dri:i386 (22.3.6-1+deb12u1) ... Setting up libxext6:i386 (2:1.3.4-1+b1) ... Setting up man-db (2.11.2-2) ... Not building database; man-db/auto-update is not 'true'. Setting up libcairo2:i386 (1.16.0-7) ... Setting up libxxf86vm1:i386 (1:1.1.4-1+b2) ... Setting up dirmngr (2.2.40-1.1) ... Setting up libmaven-resolver-java (1.6.3-1) ... Setting up adwaita-icon-theme (43-1) ... update-alternatives: using /usr/share/icons/Adwaita/cursor.theme to provide /usr/share/icons/default/index.theme (x-cursor-theme) in auto mode Setting up libmodule-runtime-perl (0.016-2) ... Setting up libxfixes3:i386 (1:6.0.0-2) ... Setting up libxinerama1:i386 (2:1.1.4-3) ... Setting up libxrandr2:i386 (2:1.5.2-2+b1) ... Setting up gpg-wks-server (2.2.40-1.1) ... Setting up libcups2:i386 (2.4.2-3) ... Setting up libhttpclient-java (4.5.14-1) ... Setting up libwagon-http-java (3.5.3-1) ... Setting up libmaven-shared-utils-java (3.3.4-1) ... Setting up libpangoft2-1.0-0:i386 (1.50.12+ds-1) ... Setting up libpangocairo-1.0-0:i386 (1.50.12+ds-1) ... Setting up libpython3-stdlib:i386 (3.11.2-1+b1) ... Setting up python3.11 (3.11.2-6) ... Setting up libjgit-java (4.11.9-2) ... Setting up libglx-mesa0:i386 (22.3.6-1+deb12u1) ... Setting up libxi6:i386 (2:1.8-1+b1) ... Setting up gpg-wks-client (2.2.40-1.1) ... Setting up libglx0:i386 (1.6.0-1) ... Setting up libimport-into-perl (1.002005-2) ... Setting up libxtst6:i386 (2:1.2.3-1.1) ... Setting up libmoo-perl (2.005005-1) ... Setting up libxcursor1:i386 (1:1.2.1-1) ... Setting up debhelper (13.11.4) ... Setting up python3 (3.11.2-1+b1) ... Setting up libgl1:i386 (1.6.0-1) ... Setting up gnupg (2.2.40-1.1) ... Setting up libgtk2.0-0:i386 (2.24.33-2) ... Setting up openjdk-17-jre-headless:i386 (17.0.6+10-1) ... update-alternatives: using /usr/lib/jvm/java-17-openjdk-i386/bin/java to provide /usr/bin/java (java) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-i386/bin/jpackage to provide /usr/bin/jpackage (jpackage) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-i386/bin/keytool to provide /usr/bin/keytool (keytool) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-i386/bin/rmiregistry to provide /usr/bin/rmiregistry (rmiregistry) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-i386/lib/jexec to provide /usr/bin/jexec (jexec) in auto mode Setting up ca-certificates-java (20230103) ... Adding debian:ACCVRAIZ1.pem Adding debian:AC_RAIZ_FNMT-RCM.pem Adding debian:AC_RAIZ_FNMT-RCM_SERVIDORES_SEGUROS.pem Adding debian:ANF_Secure_Server_Root_CA.pem Adding debian:Actalis_Authentication_Root_CA.pem Adding debian:AffirmTrust_Commercial.pem Adding debian:AffirmTrust_Networking.pem Adding debian:AffirmTrust_Premium.pem Adding debian:AffirmTrust_Premium_ECC.pem Adding debian:Amazon_Root_CA_1.pem Adding debian:Amazon_Root_CA_2.pem Adding debian:Amazon_Root_CA_3.pem Adding debian:Amazon_Root_CA_4.pem Adding debian:Atos_TrustedRoot_2011.pem Adding debian:Autoridad_de_Certificacion_Firmaprofesional_CIF_A62634068.pem Adding debian:Autoridad_de_Certificacion_Firmaprofesional_CIF_A62634068_2.pem Adding debian:Baltimore_CyberTrust_Root.pem Adding debian:Buypass_Class_2_Root_CA.pem Adding debian:Buypass_Class_3_Root_CA.pem Adding debian:CA_Disig_Root_R2.pem Adding debian:CFCA_EV_ROOT.pem Adding debian:COMODO_Certification_Authority.pem Adding debian:COMODO_ECC_Certification_Authority.pem Adding debian:COMODO_RSA_Certification_Authority.pem Adding debian:Certainly_Root_E1.pem Adding debian:Certainly_Root_R1.pem Adding debian:Certigna.pem Adding debian:Certigna_Root_CA.pem Adding debian:Certum_EC-384_CA.pem Adding debian:Certum_Trusted_Network_CA.pem Adding debian:Certum_Trusted_Network_CA_2.pem Adding debian:Certum_Trusted_Root_CA.pem Adding debian:Comodo_AAA_Services_root.pem Adding debian:D-TRUST_BR_Root_CA_1_2020.pem Adding debian:D-TRUST_EV_Root_CA_1_2020.pem Adding debian:D-TRUST_Root_Class_3_CA_2_2009.pem Adding debian:D-TRUST_Root_Class_3_CA_2_EV_2009.pem Adding debian:DigiCert_Assured_ID_Root_CA.pem Adding debian:DigiCert_Assured_ID_Root_G2.pem Adding debian:DigiCert_Assured_ID_Root_G3.pem Adding debian:DigiCert_Global_Root_CA.pem Adding debian:DigiCert_Global_Root_G2.pem Adding debian:DigiCert_Global_Root_G3.pem Adding debian:DigiCert_High_Assurance_EV_Root_CA.pem Adding debian:DigiCert_TLS_ECC_P384_Root_G5.pem Adding debian:DigiCert_TLS_RSA4096_Root_G5.pem Adding debian:DigiCert_Trusted_Root_G4.pem Adding debian:E-Tugra_Certification_Authority.pem Adding debian:E-Tugra_Global_Root_CA_ECC_v3.pem Adding debian:E-Tugra_Global_Root_CA_RSA_v3.pem Adding debian:Entrust.net_Premium_2048_Secure_Server_CA.pem Adding debian:Entrust_Root_Certification_Authority.pem Adding debian:Entrust_Root_Certification_Authority_-_EC1.pem Adding debian:Entrust_Root_Certification_Authority_-_G2.pem Adding debian:Entrust_Root_Certification_Authority_-_G4.pem Adding debian:GDCA_TrustAUTH_R5_ROOT.pem Adding debian:GLOBALTRUST_2020.pem Adding debian:GTS_Root_R1.pem Adding debian:GTS_Root_R2.pem Adding debian:GTS_Root_R3.pem Adding debian:GTS_Root_R4.pem Adding debian:GlobalSign_ECC_Root_CA_-_R4.pem Adding debian:GlobalSign_ECC_Root_CA_-_R5.pem Adding debian:GlobalSign_Root_CA.pem Adding debian:GlobalSign_Root_CA_-_R3.pem Adding debian:GlobalSign_Root_CA_-_R6.pem Adding debian:GlobalSign_Root_E46.pem Adding debian:GlobalSign_Root_R46.pem Adding debian:Go_Daddy_Class_2_CA.pem Adding debian:Go_Daddy_Root_Certificate_Authority_-_G2.pem Adding debian:HARICA_TLS_ECC_Root_CA_2021.pem Adding debian:HARICA_TLS_RSA_Root_CA_2021.pem Adding debian:Hellenic_Academic_and_Research_Institutions_ECC_RootCA_2015.pem Adding debian:Hellenic_Academic_and_Research_Institutions_RootCA_2015.pem Adding debian:HiPKI_Root_CA_-_G1.pem Adding debian:Hongkong_Post_Root_CA_1.pem Adding debian:Hongkong_Post_Root_CA_3.pem Adding debian:ISRG_Root_X1.pem Adding debian:ISRG_Root_X2.pem Adding debian:IdenTrust_Commercial_Root_CA_1.pem Adding debian:IdenTrust_Public_Sector_Root_CA_1.pem Adding debian:Izenpe.com.pem Adding debian:Microsec_e-Szigno_Root_CA_2009.pem Adding debian:Microsoft_ECC_Root_Certificate_Authority_2017.pem Adding debian:Microsoft_RSA_Root_Certificate_Authority_2017.pem Adding debian:NAVER_Global_Root_Certification_Authority.pem Adding debian:NetLock_Arany_=Class_Gold=_Főtanúsítvány.pem Adding debian:OISTE_WISeKey_Global_Root_GB_CA.pem Adding debian:OISTE_WISeKey_Global_Root_GC_CA.pem Adding debian:QuoVadis_Root_CA_1_G3.pem Adding debian:QuoVadis_Root_CA_2.pem Adding debian:QuoVadis_Root_CA_2_G3.pem Adding debian:QuoVadis_Root_CA_3.pem Adding debian:QuoVadis_Root_CA_3_G3.pem Adding debian:SSL.com_EV_Root_Certification_Authority_ECC.pem Adding debian:SSL.com_EV_Root_Certification_Authority_RSA_R2.pem Adding debian:SSL.com_Root_Certification_Authority_ECC.pem Adding debian:SSL.com_Root_Certification_Authority_RSA.pem Adding debian:SZAFIR_ROOT_CA2.pem Adding debian:SecureSign_RootCA11.pem Adding debian:SecureTrust_CA.pem Adding debian:Secure_Global_CA.pem Adding debian:Security_Communication_ECC_RootCA1.pem Adding debian:Security_Communication_RootCA2.pem Adding debian:Security_Communication_RootCA3.pem Adding debian:Security_Communication_Root_CA.pem Adding debian:Starfield_Class_2_CA.pem Adding debian:Starfield_Root_Certificate_Authority_-_G2.pem Adding debian:Starfield_Services_Root_Certificate_Authority_-_G2.pem Adding debian:SwissSign_Gold_CA_-_G2.pem Adding debian:SwissSign_Silver_CA_-_G2.pem Adding debian:T-TeleSec_GlobalRoot_Class_2.pem Adding debian:T-TeleSec_GlobalRoot_Class_3.pem Adding debian:TUBITAK_Kamu_SM_SSL_Kok_Sertifikasi_-_Surum_1.pem Adding debian:TWCA_Global_Root_CA.pem Adding debian:TWCA_Root_Certification_Authority.pem Adding debian:TeliaSonera_Root_CA_v1.pem Adding debian:Telia_Root_CA_v2.pem Adding debian:TrustCor_ECA-1.pem Adding debian:TrustCor_RootCert_CA-1.pem Adding debian:TrustCor_RootCert_CA-2.pem Adding debian:Trustwave_Global_Certification_Authority.pem Adding debian:Trustwave_Global_ECC_P256_Certification_Authority.pem Adding debian:Trustwave_Global_ECC_P384_Certification_Authority.pem Adding debian:TunTrust_Root_CA.pem Adding debian:UCA_Extended_Validation_Root.pem Adding debian:UCA_Global_G2_Root.pem Adding debian:USERTrust_ECC_Certification_Authority.pem Adding debian:USERTrust_RSA_Certification_Authority.pem Adding debian:XRamp_Global_CA_Root.pem Adding debian:certSIGN_ROOT_CA.pem Adding debian:certSIGN_Root_CA_G2.pem Adding debian:e-Szigno_Root_CA_2017.pem Adding debian:ePKI_Root_Certification_Authority.pem Adding debian:emSign_ECC_Root_CA_-_C3.pem Adding debian:emSign_ECC_Root_CA_-_G3.pem Adding debian:emSign_Root_CA_-_C1.pem Adding debian:emSign_Root_CA_-_G1.pem Adding debian:vTrus_ECC_Root_CA.pem Adding debian:vTrus_Root_CA.pem done. Setting up junit4 (4.13.2-3) ... Setting up liblwp-protocol-https-perl (6.10-1) ... Setting up liberror-prone-java (2.18.0-1) ... Setting up default-jre-headless (2:1.17-74) ... Setting up libwww-perl (6.68-1) ... Setting up openjdk-17-jre:i386 (17.0.6+10-1) ... Setting up maven-repo-helper (1.11) ... Setting up default-jre (2:1.17-74) ... Setting up antlr (2.7.7+dfsg-12) ... Setting up bnd (5.0.1-3) ... Setting up devscripts (2.23.3) ... Setting up libguava-java (31.1-1) ... Setting up openjdk-17-jdk-headless:i386 (17.0.6+10-1) ... update-alternatives: using /usr/lib/jvm/java-17-openjdk-i386/bin/jar to provide /usr/bin/jar (jar) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-i386/bin/jarsigner to provide /usr/bin/jarsigner (jarsigner) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-i386/bin/javac to provide /usr/bin/javac (javac) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-i386/bin/javadoc to provide /usr/bin/javadoc (javadoc) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-i386/bin/javap to provide /usr/bin/javap (javap) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-i386/bin/jcmd to provide /usr/bin/jcmd (jcmd) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-i386/bin/jdb to provide /usr/bin/jdb (jdb) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-i386/bin/jdeprscan to provide /usr/bin/jdeprscan (jdeprscan) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-i386/bin/jdeps to provide /usr/bin/jdeps (jdeps) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-i386/bin/jfr to provide /usr/bin/jfr (jfr) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-i386/bin/jimage to provide /usr/bin/jimage (jimage) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-i386/bin/jinfo to provide /usr/bin/jinfo (jinfo) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-i386/bin/jlink to provide /usr/bin/jlink (jlink) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-i386/bin/jmap to provide /usr/bin/jmap (jmap) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-i386/bin/jmod to provide /usr/bin/jmod (jmod) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-i386/bin/jps to provide /usr/bin/jps (jps) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-i386/bin/jrunscript to provide /usr/bin/jrunscript (jrunscript) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-i386/bin/jshell to provide /usr/bin/jshell (jshell) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-i386/bin/jstack to provide /usr/bin/jstack (jstack) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-i386/bin/jstat to provide /usr/bin/jstat (jstat) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-i386/bin/jstatd to provide /usr/bin/jstatd (jstatd) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-i386/bin/serialver to provide /usr/bin/serialver (serialver) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-i386/bin/jhsdb to provide /usr/bin/jhsdb (jhsdb) in auto mode Setting up ivy (2.5.1-2) ... Setting up ant (1.10.13-1) ... Setting up javahelper (0.78) ... Setting up libplexus-container-default-java (2.1.1-1) ... Setting up groovy (2.4.21-7) ... update-alternatives: using /usr/share/groovy/bin/groovy to provide /usr/bin/groovy (groovy) in auto mode update-alternatives: using /usr/share/groovy/bin/groovyc to provide /usr/bin/groovyc (groovyc) in auto mode update-alternatives: using /usr/share/groovy/bin/grape to provide /usr/bin/grape (grape) in auto mode update-alternatives: using /usr/share/groovy/bin/startGroovy to provide /usr/bin/startGroovy (startGroovy) in auto mode update-alternatives: using /usr/share/groovy/bin/groovysh to provide /usr/bin/groovysh (groovysh) in auto mode update-alternatives: using /usr/share/groovy/bin/java2groovy to provide /usr/bin/java2groovy (java2groovy) in auto mode update-alternatives: using /usr/share/groovy/bin/groovyConsole to provide /usr/bin/groovyConsole (groovyConsole) in auto mode update-alternatives: using /usr/share/groovy/bin/groovydoc to provide /usr/bin/groovydoc (groovydoc) in auto mode Setting up openjdk-17-jdk:i386 (17.0.6+10-1) ... update-alternatives: using /usr/lib/jvm/java-17-openjdk-i386/bin/jconsole to provide /usr/bin/jconsole (jconsole) in auto mode Setting up libguice-java (4.2.3-2) ... Setting up ant-optional (1.10.13-1) ... Setting up default-jdk-headless (2:1.17-74) ... Setting up libgradle-core-java (4.4.1-18) ... Setting up libmaven3-core-java (3.8.7-1) ... Setting up default-jdk (2:1.17-74) ... Setting up libgradle-plugins-java (4.4.1-18) ... Setting up gradle (4.4.1-18) ... Setting up libbyte-buddy-java (1.12.21-1) ... Setting up libmockito-java (2.23.0-2) ... Setting up gradle-debian-helper (2.4) ... Processing triggers for libc-bin (2.36-9) ... Processing triggers for ca-certificates (20230311) ... Updating certificates in /etc/ssl/certs... 0 added, 0 removed; done. Running hooks in /etc/ca-certificates/update.d... done. Processing triggers for ca-certificates-java (20230103) ... done. Reading package lists... Building dependency tree... Reading state information... Reading extended state information... Initializing package states... Writing extended state information... Building tag database... -> Finished parsing the build-deps I: Building the package I: Running cd /build/milib-2.2.0+dfsg/ && env PATH="/usr/sbin:/usr/bin:/sbin:/bin:/usr/games" HOME="/nonexistent/first-build" dpkg-buildpackage -us -uc -b && env PATH="/usr/sbin:/usr/bin:/sbin:/bin:/usr/games" HOME="/nonexistent/first-build" dpkg-genchanges -S > ../milib_2.2.0+dfsg-1_source.changes dpkg-buildpackage: info: source package milib dpkg-buildpackage: info: source version 2.2.0+dfsg-1 dpkg-buildpackage: info: source distribution unstable dpkg-buildpackage: info: source changed by Pierre Gruet dpkg-source --before-build . dpkg-buildpackage: info: host architecture i386 debian/rules clean dh clean --with javahelper --with maven_repo_helper debian/rules override_dh_auto_clean make[1]: Entering directory '/build/milib-2.2.0+dfsg' dh_auto_clean # Clearing the build.gradle file we provide rm build.gradle rm: cannot remove 'build.gradle': No such file or directory make[1]: [debian/rules:11: override_dh_auto_clean] Error 1 (ignored) make[1]: Leaving directory '/build/milib-2.2.0+dfsg' jh_clean dh_clean debian/rules binary dh binary --with javahelper --with maven_repo_helper dh_update_autotools_config dh_autoreconf debian/rules override_dh_auto_configure make[1]: Entering directory '/build/milib-2.2.0+dfsg' # Adding the upstream version number (without +dfsg) to the build.gradle file # we got by patching build.gradle.kts sed "s/\(^group.*\)/\1\nversion = '2.2.0+dfsg'/ ; s/\+dfsg[[:digit:]]*//" build.gradle.kts > build.gradle dh_auto_configure make[1]: Leaving directory '/build/milib-2.2.0+dfsg' jh_linkjars dh_auto_build mkdir -p .gradle/init.d cp /usr/share/gradle-debian-helper/init.gradle .gradle/init.d/ gradle --info --console plain --offline --stacktrace --no-daemon --refresh-dependencies --gradle-user-home .gradle -Duser.home=. -Duser.name=debian -Ddebian.package=milib -Dfile.encoding=UTF-8 --parallel --max-workers=8 jar openjdk version "17.0.6" 2023-01-17 OpenJDK Runtime Environment (build 17.0.6+10-Debian-1) OpenJDK Server VM (build 17.0.6+10-Debian-1, mixed mode, sharing) Initialized native services in: /build/milib-2.2.0+dfsg/.gradle/native To honour the JVM settings for this build a new JVM will be forked. Please consider using the daemon: https://docs.gradle.org/4.4.1/userguide/gradle_daemon.html. Starting process 'Gradle build daemon'. Working directory: /build/milib-2.2.0+dfsg/.gradle/daemon/4.4.1 Command: /usr/lib/jvm/java-17-openjdk-i386/bin/java --add-opens java.base/java.lang=ALL-UNNAMED -Xbootclasspath/a:/usr/share/java/gradle-helper-hook.jar:/usr/share/java/maven-repo-helper.jar -Dfile.encoding=UTF-8 -Duser.country=US -Duser.language=en -Duser.variant -cp /usr/share/gradle/lib/gradle-launcher-4.4.1.jar org.gradle.launcher.daemon.bootstrap.GradleDaemon 4.4.1 Successfully started process 'Gradle build daemon' An attempt to start the daemon took 3.501 secs. The client will now receive all logging from the daemon (pid: 13080). The daemon log file: /build/milib-2.2.0+dfsg/.gradle/daemon/4.4.1/daemon-13080.out.log Daemon will be stopped at the end of the build stopping after processing Closing daemon's stdin at end of input. The daemon will no longer process any standard input. Using 8 worker leases. Creating new cache for fileHashes, path /build/milib-2.2.0+dfsg/.gradle/caches/4.4.1/fileHashes/fileHashes.bin, access org.gradle.cache.internal.DefaultCacheAccess@6de5ff Creating new cache for resourceHashesCache, path /build/milib-2.2.0+dfsg/.gradle/caches/4.4.1/fileHashes/resourceHashesCache.bin, access org.gradle.cache.internal.DefaultCacheAccess@6de5ff Creating new cache for fileHashes, path /build/milib-2.2.0+dfsg/.gradle/4.4.1/fileHashes/fileHashes.bin, access org.gradle.cache.internal.DefaultCacheAccess@1269aab Starting Build Compiling initialization script '/build/milib-2.2.0+dfsg/.gradle/init.d/init.gradle' using SubsetScriptTransformer. Creating new cache for metadata-1.1/results, path /build/milib-2.2.0+dfsg/.gradle/caches/transforms-1/metadata-1.1/results.bin, access org.gradle.cache.internal.DefaultCacheAccess@f6a093 Compiling initialization script '/build/milib-2.2.0+dfsg/.gradle/init.d/init.gradle' using BuildScriptTransformer. Settings evaluated using settings file '/build/milib-2.2.0+dfsg/settings.gradle'. Settings file not found (/build/milib-2.2.0+dfsg/settings.gradle) Root project name not defined in settings.gradle, defaulting to 'milib' instead of the name of the root directory 'milib-2.2.0+dfsg' Projects loaded. Root project using build file '/build/milib-2.2.0+dfsg/build.gradle'. Included projects: [root project 'milib'] Keep-alive timer started Adding Debian repository to project 'milib' Parallel execution is an incubating feature. Evaluating root project 'milib' using build file '/build/milib-2.2.0+dfsg/build.gradle'. Compiling build file '/build/milib-2.2.0+dfsg/build.gradle' using SubsetScriptTransformer. Compiling build file '/build/milib-2.2.0+dfsg/build.gradle' using BuildScriptTransformer. Adding Maven pom generation to project 'milib' Linking the generated javadoc to the system JDK API documentation All projects evaluated. Selected primary task 'jar' from project : Creating new cache for annotation-processors, path /build/milib-2.2.0+dfsg/.gradle/4.4.1/fileContent/annotation-processors.bin, access org.gradle.cache.internal.DefaultCacheAccess@aaf5ab Tasks to be executed: [task ':compileJava', task ':processResources', task ':classes', task ':debianMavenPom', task ':jar'] Creating new cache for resourceHashesCache, path /build/milib-2.2.0+dfsg/.gradle/4.4.1/fileHashes/resourceHashesCache.bin, access org.gradle.cache.internal.DefaultCacheAccess@1269aab Creating new cache for taskHistory, path /build/milib-2.2.0+dfsg/.gradle/4.4.1/taskHistory/taskHistory.bin, access org.gradle.cache.internal.DefaultCacheAccess@10c83cc Creating new cache for outputFiles, path /build/milib-2.2.0+dfsg/.gradle/buildOutputCleanup/outputFiles.bin, access org.gradle.cache.internal.DefaultCacheAccess@1c23974 :compileJava (Thread[Task worker for ':',5,main]) started. :compileJava Putting task artifact state for task ':compileJava' into context took 0.01 secs. Creating new cache for metadata-2.36/module-metadata, path /build/milib-2.2.0+dfsg/.gradle/caches/modules-2/metadata-2.36/module-metadata.bin, access org.gradle.cache.internal.DefaultCacheAccess@9d4625 Loading the Maven rules... Replacing org.apache.commons:commons-math3:jar:3.6.1 -> org.apache.commons:commons-math3:jar:debian Replacing cc.redberry:pipe:jar:1.3.0 -> cc.redberry:pipe:jar:1.0.0-alpha0 Replacing com.fasterxml.jackson:jackson-bom:jar:2.14.0 -> com.fasterxml.jackson:jackson-bom:jar:debian Passing through com.fasterxml.jackson:jackson-parent:jar:debian Passing through com.fasterxml:oss-parent:jar:debian Passing through com.fasterxml.jackson.core:jackson-databind:jar:2.x Passing through com.fasterxml.jackson:jackson-base:jar:debian Passing through com.fasterxml.jackson:jackson-bom:jar:debian Replacing org.apache.commons:commons-compress:jar:1.21 -> org.apache.commons:commons-compress:jar:debian Passing through org.apache.commons:commons-parent:jar:debian Passing through org.apache:apache:jar:debian Replacing commons-io:commons-io:jar:2.11.0 -> commons-io:commons-io:jar:debian Replacing org.lz4:lz4-java:jar:1.8.0 -> org.lz4:lz4-java:jar:debian Replacing com.beust:jcommander:jar:1.72 -> com.beust:jcommander:jar:debian Replacing net.sf.trove4j:trove4j:jar:3.0.3 -> net.sf.trove4j:trove4j:jar:debian Replacing com.google.guava:guava:jar:31.1-jre -> com.google.guava:guava:jar:debian Passing through com.google.guava:guava-parent:jar:debian Passing through com.fasterxml.jackson.core:jackson-annotations:jar:2.x Passing through com.fasterxml.jackson.core:jackson-core:jar:2.x Passing through org.jsr-305:jsr305:jar:0.x Passing through com.google.errorprone:error_prone_annotations:jar:debian Passing through com.google.errorprone:error_prone_parent:jar:debian Malformed jar [jackson-databind-2.x.jar] found on classpath. Gradle 5.0 will no longer allow malformed jars on a classpath. at org.gradle.api.internal.changedetection.state.AbstractClasspathSnapshotBuilder$JarHasher.hashMalformedZip(AbstractClasspathSnapshotBuilder.java:120) at org.gradle.api.internal.changedetection.state.AbstractClasspathSnapshotBuilder$JarHasher.hashJarContents(AbstractClasspathSnapshotBuilder.java:115) at org.gradle.api.internal.changedetection.state.AbstractClasspathSnapshotBuilder$JarHasher.hash(AbstractClasspathSnapshotBuilder.java:93) at org.gradle.api.internal.changedetection.state.ResourceSnapshotterCacheService.hashFile(ResourceSnapshotterCacheService.java:44) at org.gradle.api.internal.changedetection.state.AbstractClasspathSnapshotBuilder.visitJar(AbstractClasspathSnapshotBuilder.java:83) at org.gradle.api.internal.changedetection.state.AbstractClasspathSnapshotBuilder.visitFileSnapshot(AbstractClasspathSnapshotBuilder.java:76) at org.gradle.api.internal.changedetection.state.AbstractFileCollectionSnapshotter$FileCollectionVisitorImpl.visitCollection(AbstractFileCollectionSnapshotter.java:77) at org.gradle.api.internal.file.AbstractFileCollection.visitRootElements(AbstractFileCollection.java:234) at org.gradle.api.internal.file.CompositeFileCollection.visitRootElements(CompositeFileCollection.java:185) at org.gradle.api.internal.changedetection.state.AbstractFileCollectionSnapshotter.snapshot(AbstractFileCollectionSnapshotter.java:53) at org.gradle.api.internal.changedetection.state.DefaultCompileClasspathSnapshotter.snapshot(DefaultCompileClasspathSnapshotter.java:38) at org.gradle.api.internal.changedetection.state.CacheBackedTaskHistoryRepository.snapshotTaskFiles(CacheBackedTaskHistoryRepository.java:331) at org.gradle.api.internal.changedetection.state.CacheBackedTaskHistoryRepository.createExecution(CacheBackedTaskHistoryRepository.java:154) at org.gradle.api.internal.changedetection.state.CacheBackedTaskHistoryRepository.access$100(CacheBackedTaskHistoryRepository.java:61) at org.gradle.api.internal.changedetection.state.CacheBackedTaskHistoryRepository$1.getCurrentExecution(CacheBackedTaskHistoryRepository.java:114) at org.gradle.api.internal.changedetection.changes.DefaultTaskArtifactStateRepository$TaskArtifactStateImpl.getStates(DefaultTaskArtifactStateRepository.java:201) at org.gradle.api.internal.changedetection.changes.DefaultTaskArtifactStateRepository$TaskArtifactStateImpl.isUpToDate(DefaultTaskArtifactStateRepository.java:86) at org.gradle.api.internal.tasks.execution.SkipUpToDateTaskExecuter.execute(SkipUpToDateTaskExecuter.java:53) at org.gradle.api.internal.tasks.execution.ResolveTaskOutputCachingStateExecuter.execute(ResolveTaskOutputCachingStateExecuter.java:54) at org.gradle.api.internal.tasks.execution.ValidatingTaskExecuter.execute(ValidatingTaskExecuter.java:60) at org.gradle.api.internal.tasks.execution.SkipEmptySourceFilesTaskExecuter.execute(SkipEmptySourceFilesTaskExecuter.java:97) at org.gradle.api.internal.tasks.execution.CleanupStaleOutputsExecuter.execute(CleanupStaleOutputsExecuter.java:87) at org.gradle.api.internal.tasks.execution.ResolveTaskArtifactStateTaskExecuter.execute(ResolveTaskArtifactStateTaskExecuter.java:52) at org.gradle.api.internal.tasks.execution.SkipTaskWithNoActionsExecuter.execute(SkipTaskWithNoActionsExecuter.java:52) at org.gradle.api.internal.tasks.execution.SkipOnlyIfTaskExecuter.execute(SkipOnlyIfTaskExecuter.java:54) at org.gradle.api.internal.tasks.execution.ExecuteAtMostOnceTaskExecuter.execute(ExecuteAtMostOnceTaskExecuter.java:43) at org.gradle.api.internal.tasks.execution.CatchExceptionTaskExecuter.execute(CatchExceptionTaskExecuter.java:34) at org.gradle.execution.taskgraph.DefaultTaskGraphExecuter$EventFiringTaskWorker$1.run(DefaultTaskGraphExecuter.java:248) at org.gradle.internal.progress.DefaultBuildOperationExecutor$RunnableBuildOperationWorker.execute(DefaultBuildOperationExecutor.java:336) at org.gradle.internal.progress.DefaultBuildOperationExecutor$RunnableBuildOperationWorker.execute(DefaultBuildOperationExecutor.java:328) at org.gradle.internal.progress.DefaultBuildOperationExecutor.execute(DefaultBuildOperationExecutor.java:199) at org.gradle.internal.progress.DefaultBuildOperationExecutor.run(DefaultBuildOperationExecutor.java:110) at org.gradle.execution.taskgraph.DefaultTaskGraphExecuter$EventFiringTaskWorker.execute(DefaultTaskGraphExecuter.java:241) at org.gradle.execution.taskgraph.DefaultTaskGraphExecuter$EventFiringTaskWorker.execute(DefaultTaskGraphExecuter.java:230) at org.gradle.execution.taskgraph.DefaultTaskPlanExecutor$TaskExecutorWorker.processTask(DefaultTaskPlanExecutor.java:123) at org.gradle.execution.taskgraph.DefaultTaskPlanExecutor$TaskExecutorWorker.access$200(DefaultTaskPlanExecutor.java:79) at org.gradle.execution.taskgraph.DefaultTaskPlanExecutor$TaskExecutorWorker$1.execute(DefaultTaskPlanExecutor.java:104) at org.gradle.execution.taskgraph.DefaultTaskPlanExecutor$TaskExecutorWorker$1.execute(DefaultTaskPlanExecutor.java:98) at org.gradle.execution.taskgraph.DefaultTaskExecutionPlan.execute(DefaultTaskExecutionPlan.java:626) at org.gradle.execution.taskgraph.DefaultTaskExecutionPlan.executeWithTask(DefaultTaskExecutionPlan.java:581) at org.gradle.execution.taskgraph.DefaultTaskPlanExecutor$TaskExecutorWorker.run(DefaultTaskPlanExecutor.java:98) at org.gradle.internal.concurrent.ExecutorPolicy$CatchAndRecordFailures.onExecute(ExecutorPolicy.java:63) at org.gradle.internal.concurrent.ManagedExecutorImpl$1.run(ManagedExecutorImpl.java:46) at java.base/java.util.concurrent.ThreadPoolExecutor.runWorker(ThreadPoolExecutor.java:1136) at java.base/java.util.concurrent.ThreadPoolExecutor$Worker.run(ThreadPoolExecutor.java:635) at org.gradle.internal.concurrent.ThreadFactoryImpl$ManagedThreadRunnable.run(ThreadFactoryImpl.java:55) at java.base/java.lang.Thread.run(Thread.java:833) Up-to-date check for task ':compileJava' took 13.795 secs. It is not up-to-date because: No history is available. All input files are considered out-of-date for incremental task ':compileJava'. Compiling with JDK Java compiler API. Note: Some input files use or override a deprecated API. Note: Recompile with -Xlint:deprecation for details. Note: Some input files use unchecked or unsafe operations. Note: Recompile with -Xlint:unchecked for details. :compileJava (Thread[Task worker for ':',5,main]) completed. Took 46.784 secs. :processResources (Thread[Task worker for ':',5,main]) started. :processResources Putting task artifact state for task ':processResources' into context took 0.0 secs. Up-to-date check for task ':processResources' took 0.074 secs. It is not up-to-date because: No history is available. :processResources (Thread[Task worker for ':',5,main]) completed. Took 0.188 secs. :classes (Thread[Task worker for ':',5,main]) started. :classes Skipping task ':classes' as it has no actions. :classes (Thread[Task worker for ':',5,main]) completed. Took 0.0 secs. :debianMavenPom (Thread[Task worker for ':',5,main]) started. :debianMavenPom Putting task artifact state for task ':debianMavenPom' into context took 0.0 secs. Up-to-date check for task ':debianMavenPom' took 0.008 secs. It is not up-to-date because: No history is available. Generating pom file /build/milib-2.2.0+dfsg/build/debian/milib.pom :debianMavenPom (Thread[Task worker for ':',5,main]) completed. Took 0.432 secs. :jar (Thread[Task worker for ':',5,main]) started. :jar Putting task artifact state for task ':jar' into context took 0.0 secs. Up-to-date check for task ':jar' took 0.085 secs. It is not up-to-date because: No history is available. :jar (Thread[Task worker for ':',5,main]) completed. Took 0.913 secs. BUILD SUCCESSFUL in 1m 6s 4 actionable tasks: 4 executed dh_auto_test mkdir -p .gradle/init.d cp /usr/share/gradle-debian-helper/init.gradle .gradle/init.d/ gradle --info --console plain --offline --stacktrace --no-daemon --refresh-dependencies --gradle-user-home .gradle -Duser.home=. -Duser.name=debian -Ddebian.package=milib -Dfile.encoding=UTF-8 --parallel --max-workers=8 test openjdk version "17.0.6" 2023-01-17 OpenJDK Runtime Environment (build 17.0.6+10-Debian-1) OpenJDK Server VM (build 17.0.6+10-Debian-1, mixed mode, sharing) Initialized native services in: /build/milib-2.2.0+dfsg/.gradle/native To honour the JVM settings for this build a new JVM will be forked. Please consider using the daemon: https://docs.gradle.org/4.4.1/userguide/gradle_daemon.html. Starting process 'Gradle build daemon'. Working directory: /build/milib-2.2.0+dfsg/.gradle/daemon/4.4.1 Command: /usr/lib/jvm/java-17-openjdk-i386/bin/java --add-opens java.base/java.lang=ALL-UNNAMED -Xbootclasspath/a:/usr/share/java/gradle-helper-hook.jar:/usr/share/java/maven-repo-helper.jar -Dfile.encoding=UTF-8 -Duser.country=US -Duser.language=en -Duser.variant -cp /usr/share/gradle/lib/gradle-launcher-4.4.1.jar org.gradle.launcher.daemon.bootstrap.GradleDaemon 4.4.1 Successfully started process 'Gradle build daemon' An attempt to start the daemon took 3.948 secs. The client will now receive all logging from the daemon (pid: 14386). The daemon log file: /build/milib-2.2.0+dfsg/.gradle/daemon/4.4.1/daemon-14386.out.log Daemon will be stopped at the end of the build stopping after processing Closing daemon's stdin at end of input. The daemon will no longer process any standard input. Using 8 worker leases. Creating new cache for fileHashes, path /build/milib-2.2.0+dfsg/.gradle/caches/4.4.1/fileHashes/fileHashes.bin, access org.gradle.cache.internal.DefaultCacheAccess@1b766ce Creating new cache for resourceHashesCache, path /build/milib-2.2.0+dfsg/.gradle/caches/4.4.1/fileHashes/resourceHashesCache.bin, access org.gradle.cache.internal.DefaultCacheAccess@1b766ce Creating new cache for fileHashes, path /build/milib-2.2.0+dfsg/.gradle/4.4.1/fileHashes/fileHashes.bin, access org.gradle.cache.internal.DefaultCacheAccess@885573 Starting Build Creating new cache for metadata-1.1/results, path /build/milib-2.2.0+dfsg/.gradle/caches/transforms-1/metadata-1.1/results.bin, access org.gradle.cache.internal.DefaultCacheAccess@ef743a Settings evaluated using settings file '/build/milib-2.2.0+dfsg/settings.gradle'. Settings file not found (/build/milib-2.2.0+dfsg/settings.gradle) Root project name not defined in settings.gradle, defaulting to 'milib' instead of the name of the root directory 'milib-2.2.0+dfsg' Projects loaded. Root project using build file '/build/milib-2.2.0+dfsg/build.gradle'. Included projects: [root project 'milib'] Keep-alive timer started Adding Debian repository to project 'milib' Parallel execution is an incubating feature. Evaluating root project 'milib' using build file '/build/milib-2.2.0+dfsg/build.gradle'. Adding Maven pom generation to project 'milib' Linking the generated javadoc to the system JDK API documentation All projects evaluated. Selected primary task 'test' from project : Creating new cache for annotation-processors, path /build/milib-2.2.0+dfsg/.gradle/4.4.1/fileContent/annotation-processors.bin, access org.gradle.cache.internal.DefaultCacheAccess@25e52c Tasks to be executed: [task ':compileJava', task ':processResources', task ':classes', task ':compileTestJava', task ':processTestResources', task ':testClasses', task ':test'] Creating new cache for resourceHashesCache, path /build/milib-2.2.0+dfsg/.gradle/4.4.1/fileHashes/resourceHashesCache.bin, access org.gradle.cache.internal.DefaultCacheAccess@885573 Creating new cache for taskHistory, path /build/milib-2.2.0+dfsg/.gradle/4.4.1/taskHistory/taskHistory.bin, access org.gradle.cache.internal.DefaultCacheAccess@16244df Creating new cache for outputFiles, path /build/milib-2.2.0+dfsg/.gradle/buildOutputCleanup/outputFiles.bin, access org.gradle.cache.internal.DefaultCacheAccess@1de5299 :compileJava (Thread[Task worker for ':',5,main]) started. :compileJava Putting task artifact state for task ':compileJava' into context took 0.013 secs. Creating new cache for metadata-2.36/module-metadata, path /build/milib-2.2.0+dfsg/.gradle/caches/modules-2/metadata-2.36/module-metadata.bin, access org.gradle.cache.internal.DefaultCacheAccess@1e7a1be Loading the Maven rules... Replacing org.apache.commons:commons-math3:jar:3.6.1 -> org.apache.commons:commons-math3:jar:debian Replacing cc.redberry:pipe:jar:1.3.0 -> cc.redberry:pipe:jar:1.0.0-alpha0 Replacing com.fasterxml.jackson:jackson-bom:jar:2.14.0 -> com.fasterxml.jackson:jackson-bom:jar:debian Passing through com.fasterxml.jackson:jackson-parent:jar:debian Passing through com.fasterxml:oss-parent:jar:debian Passing through com.fasterxml.jackson.core:jackson-databind:jar:2.x Passing through com.fasterxml.jackson:jackson-base:jar:debian Passing through com.fasterxml.jackson:jackson-bom:jar:debian Replacing org.apache.commons:commons-compress:jar:1.21 -> org.apache.commons:commons-compress:jar:debian Passing through org.apache.commons:commons-parent:jar:debian Passing through org.apache:apache:jar:debian Replacing commons-io:commons-io:jar:2.11.0 -> commons-io:commons-io:jar:debian Replacing org.lz4:lz4-java:jar:1.8.0 -> org.lz4:lz4-java:jar:debian Replacing com.beust:jcommander:jar:1.72 -> com.beust:jcommander:jar:debian Replacing net.sf.trove4j:trove4j:jar:3.0.3 -> net.sf.trove4j:trove4j:jar:debian Replacing com.google.guava:guava:jar:31.1-jre -> com.google.guava:guava:jar:debian Passing through com.google.guava:guava-parent:jar:debian Passing through com.fasterxml.jackson.core:jackson-annotations:jar:2.x Passing through com.fasterxml.jackson.core:jackson-core:jar:2.x Passing through org.jsr-305:jsr305:jar:0.x Passing through com.google.errorprone:error_prone_annotations:jar:debian Passing through com.google.errorprone:error_prone_parent:jar:debian Skipping task ':compileJava' as it is up-to-date (took 7.084 secs). :compileJava UP-TO-DATE :compileJava (Thread[Task worker for ':',5,main]) completed. Took 7.209 secs. :processResources (Thread[Task worker for ':',5,main]) started. :processResources Putting task artifact state for task ':processResources' into context took 0.0 secs. Skipping task ':processResources' as it is up-to-date (took 0.04 secs). :processResources UP-TO-DATE :processResources (Thread[Task worker for ':',5,main]) completed. Took 0.053 secs. :classes (Thread[Task worker for ':',5,main]) started. :classes Skipping task ':classes' as it has no actions. :classes UP-TO-DATE :classes (Thread[Task worker for ':',5,main]) completed. Took 0.001 secs. :compileTestJava (Thread[Task worker for ':',5,main]) started. :compileTestJava Putting task artifact state for task ':compileTestJava' into context took 0.0 secs. Replacing junit:junit:jar:4.13.2 -> junit:junit:jar:4.x Replacing org.mockito:mockito-all:jar:1.10.19 -> org.mockito:mockito-all:jar:debian org.mockito:mockito-all:debian is relocated to org.mockito:mockito-core:debian. Please update your dependencies. Passing through org.hamcrest:hamcrest:jar:debian Passing through org.mockito:mockito-core:jar:debian Passing through net.bytebuddy:byte-buddy:jar:debian Passing through net.bytebuddy:byte-buddy-parent:jar:debian Passing through net.bytebuddy:byte-buddy-agent:jar:debian Passing through org.objenesis:objenesis:jar:debian Passing through org.objenesis:objenesis-parent:jar:debian Passing through net.bytebuddy:byte-buddy-dep:jar:debian Passing through org.ow2.asm:asm:jar:debian Passing through org.ow2.asm:asm-commons:jar:debian Up-to-date check for task ':compileTestJava' took 8.803 secs. It is not up-to-date because: No history is available. All input files are considered out-of-date for incremental task ':compileTestJava'. Compiling with JDK Java compiler API. Note: Some input files use or override a deprecated API. Note: Recompile with -Xlint:deprecation for details. Note: Some input files use unchecked or unsafe operations. Note: Recompile with -Xlint:unchecked for details. :compileTestJava (Thread[Task worker for ':',5,main]) completed. Took 27.573 secs. :processTestResources (Thread[Task worker for ':',5,main]) started. :processTestResources Putting task artifact state for task ':processTestResources' into context took 0.0 secs. Up-to-date check for task ':processTestResources' took 0.198 secs. It is not up-to-date because: No history is available. :processTestResources (Thread[Task worker for ':',5,main]) completed. Took 0.445 secs. :testClasses (Thread[Task worker for ':',5,main]) started. :testClasses Skipping task ':testClasses' as it has no actions. :testClasses (Thread[Task worker for ':',5,main]) completed. Took 0.006 secs. :test (Thread[Task worker for ':',5,main]) started. :test Putting task artifact state for task ':test' into context took 0.0 secs. Up-to-date check for task ':test' took 3.022 secs. It is not up-to-date because: No history is available. Starting process 'Gradle Test Executor 1'. Working directory: /build/milib-2.2.0+dfsg Command: /usr/lib/jvm/java-17-openjdk-i386/bin/java -Dorg.gradle.native=false @/tmp/gradle-worker-classpath12450880116065079991txt -Xms1024m -Xmx2048m -Dfile.encoding=UTF-8 -Duser.country=US -Duser.language=en -Duser.variant -ea worker.org.gradle.process.internal.worker.GradleWorkerMain 'Gradle Test Executor 1' Successfully started process 'Gradle Test Executor 1' Gradle Test Executor 1 started executing tests. com.milaboratory.primitivio.blocks.PrimitivOBlocksTest > benchmark1 SKIPPED com.milaboratory.primitivio.blocks.PrimitivOBlocksTest > test1 STANDARD_OUT ================== High compression: false Concurrency: 4 File size: 6799510 Write time: 1.08s O. Stats: Wall clock time: 1.1s Total CPU time: 1.44s User wait time: 790.18ms Serialization time: 709.57ms (49.2%) Checksum calculation time: 627.07ms (43.48%) Compression time: 95.19ms (6.6%) Total IO delay: 329.76ms Concurrency overhead: 306.41ms Uncompressed size: 18.44MiB (~2.08KiB per object) Output size: 6.48MiB (~748B per object; compression = 35.17%) IO speed: 19.71MiB/s Concurrency adjusted uncompressed speed: 24.62MiB/s Actual uncompressed speed: 16.81MiB/s Actual speed: 5.91MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 748B Blocks: 62 (~107.1KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Pending / IO / Serde: 0 / 1 / 0 I. Stats 1: Wall clock time: 604.53ms Total CPU time: 585.51ms Serialization time: 307.58ms (52.53%) Checksum calculation time: 203.23ms (34.71%) Compression time: 67.42ms (11.52%) Total IO delay: 309.93ms Input size: 6.48MiB Decompressed size: 18.44MiB (compression = 35.17%) IO speed: 20.99MiB/s Concurrency adjusted uncompressed speed: 82.68MiB/s Actual uncompressed speed: 30.52MiB/s Actual speed: 10.74MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 748B Blocks: 62 (~107.1KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 2: Wall clock time: 1.07s Total CPU time: 749ms Serialization time: 374.56ms (50.01%) Checksum calculation time: 227.72ms (30.4%) Compression time: 130.66ms (17.44%) Total IO delay: 623.16ms Input size: 12.97MiB Decompressed size: 36.87MiB (compression = 35.17%) IO speed: 20.82MiB/s Concurrency adjusted uncompressed speed: 107.5MiB/s Actual uncompressed speed: 34.43MiB/s Actual speed: 12.11MiB/s Objects: 18158 Average object size uncompressed: 2.08KiB Average object size compressed: 748B Blocks: 124 (~107.1KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 ================== High compression: false Concurrency: 4 File size: 6791878 Write time: 479.65ms O. Stats: Wall clock time: 480.69ms Total CPU time: 484.2ms User wait time: 373.42ms Serialization time: 242.78ms (50.14%) Checksum calculation time: 13.46ms (2.78%) Compression time: 162.38ms (33.54%) Total IO delay: 150.68ms Concurrency overhead: 71.27ms Uncompressed size: 18.44MiB (~2.08KiB per object) Output size: 6.48MiB (~748B per object; compression = 35.13%) IO speed: 43.18MiB/s Concurrency adjusted uncompressed speed: 80.51MiB/s Actual uncompressed speed: 38.41MiB/s Actual speed: 13.49MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 748B Blocks: 20 (~331.63KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 1: Wall clock time: 316.02ms Total CPU time: 318.85ms Serialization time: 173.74ms (54.49%) Checksum calculation time: 17.4ms (5.46%) Compression time: 126.75ms (39.75%) Total IO delay: 127.17ms Input size: 6.48MiB Decompressed size: 18.44MiB (compression = 35.13%) IO speed: 51MiB/s Concurrency adjusted uncompressed speed: 166.1MiB/s Actual uncompressed speed: 58.34MiB/s Actual speed: 20.5MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 748B Blocks: 20 (~331.63KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 2: Wall clock time: 715.06ms Total CPU time: 648.5ms Serialization time: 359.96ms (55.51%) Checksum calculation time: 39.2ms (6.04%) Compression time: 247.34ms (38.14%) Total IO delay: 255.86ms Input size: 12.95MiB Decompressed size: 36.87MiB (compression = 35.13%) IO speed: 50.8MiB/s Concurrency adjusted uncompressed speed: 163.16MiB/s Actual uncompressed speed: 51.57MiB/s Actual speed: 18.12MiB/s Objects: 18158 Average object size uncompressed: 2.08KiB Average object size compressed: 748B Blocks: 40 (~331.63KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 ================== High compression: false Concurrency: 1 File size: 6799510 Write time: 980.81ms O. Stats: Wall clock time: 982.2ms Total CPU time: 182.64ms User wait time: 891.18ms Serialization time: 90.28ms (49.43%) Checksum calculation time: 8.76ms (4.8%) Compression time: 63.73ms (34.89%) Total IO delay: 187.2ms Concurrency overhead: 239.41ms Uncompressed size: 18.44MiB (~2.08KiB per object) Output size: 6.48MiB (~748B per object; compression = 35.17%) IO speed: 34.68MiB/s Concurrency adjusted uncompressed speed: 30.27MiB/s Actual uncompressed speed: 18.77MiB/s Actual speed: 6.6MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 748B Blocks: 62 (~107.1KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Checksum ok! I. Stats 1: Wall clock time: 349.09ms Total CPU time: 209.55ms Serialization time: 104.82ms (50.02%) Checksum calculation time: 8.83ms (4.22%) Compression time: 88.33ms (42.15%) Total IO delay: 285.71ms Input size: 6.48MiB Decompressed size: 18.44MiB (compression = 35.17%) IO speed: 22.75MiB/s Concurrency adjusted uncompressed speed: 37.25MiB/s Actual uncompressed speed: 52.83MiB/s Actual speed: 18.58MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 748B Blocks: 62 (~107.1KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 2: Wall clock time: 780.18ms Total CPU time: 398.63ms Serialization time: 191.33ms (48%) Checksum calculation time: 17.56ms (4.4%) Compression time: 168.44ms (42.26%) Total IO delay: 618.57ms Input size: 12.97MiB Decompressed size: 36.87MiB (compression = 35.17%) IO speed: 20.99MiB/s Concurrency adjusted uncompressed speed: 36.26MiB/s Actual uncompressed speed: 47.27MiB/s Actual speed: 16.63MiB/s Objects: 18158 Average object size uncompressed: 2.08KiB Average object size compressed: 748B Blocks: 124 (~107.1KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 ================== High compression: false Concurrency: 1 File size: 6791878 Write time: 695.66ms O. Stats: Wall clock time: 697.07ms Total CPU time: 404.42ms User wait time: 632.54ms Serialization time: 215.76ms (53.35%) Checksum calculation time: 25.5ms (6.31%) Compression time: 146.26ms (36.17%) Total IO delay: 120.68ms Concurrency overhead: 40.34ms Uncompressed size: 18.44MiB (~2.08KiB per object) Output size: 6.48MiB (~748B per object; compression = 35.13%) IO speed: 53.98MiB/s Concurrency adjusted uncompressed speed: 32.63MiB/s Actual uncompressed speed: 26.45MiB/s Actual speed: 9.29MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 748B Blocks: 20 (~331.63KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Checksum ok! I. Stats 1: Wall clock time: 354.44ms Total CPU time: 362.23ms Serialization time: 191.79ms (52.95%) Checksum calculation time: 34.01ms (9.39%) Compression time: 135.34ms (37.36%) Total IO delay: 151.94ms Input size: 6.48MiB Decompressed size: 18.44MiB (compression = 35.13%) IO speed: 42.9MiB/s Concurrency adjusted uncompressed speed: 35.87MiB/s Actual uncompressed speed: 52.08MiB/s Actual speed: 18.3MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 748B Blocks: 20 (~331.63KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 2: Wall clock time: 790.2ms Total CPU time: 754.58ms Serialization time: 452.9ms (60.02%) Checksum calculation time: 51.29ms (6.8%) Compression time: 248.32ms (32.91%) Total IO delay: 295.31ms Input size: 12.95MiB Decompressed size: 36.87MiB (compression = 35.13%) IO speed: 43.91MiB/s Concurrency adjusted uncompressed speed: 35.15MiB/s Actual uncompressed speed: 46.68MiB/s Actual speed: 16.4MiB/s Objects: 18158 Average object size uncompressed: 2.08KiB Average object size compressed: 748B Blocks: 40 (~331.63KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Pending / IO / Serde: 1 / 0 / 3 Pending / IO / Serde: 2 / 0 / 1 ================== High compression: true Concurrency: 4 File size: 4156299 Write time: 5.68s O. Stats: Wall clock time: 5.68s Total CPU time: 14.83s User wait time: 5.42s Serialization time: 93.37ms (0.63%) Checksum calculation time: 8.68ms (0.06%) Compression time: 14.7s (99.11%) Total IO delay: 260.58ms Concurrency overhead: 237.44ms Uncompressed size: 18.44MiB (~2.08KiB per object) Output size: 3.96MiB (~457B per object; compression = 21.5%) IO speed: 15.25MiB/s Concurrency adjusted uncompressed speed: 4.6MiB/s Actual uncompressed speed: 3.24MiB/s Actual speed: 714.09KiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 457B Blocks: 62 (~65.47KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Pending / IO / Serde: 0 / 0 / 0 I. Stats 1: Wall clock time: 212.91ms Total CPU time: 105.82ms Serialization time: 38.25ms (36.15%) Checksum calculation time: 8.82ms (8.34%) Compression time: 55.68ms (52.62%) Total IO delay: 175.24ms Input size: 3.96MiB Decompressed size: 18.44MiB (compression = 21.5%) IO speed: 22.65MiB/s Concurrency adjusted uncompressed speed: 263.38MiB/s Actual uncompressed speed: 86.97MiB/s Actual speed: 18.7MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 457B Blocks: 62 (~65.47KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 2: Wall clock time: 490.7ms Total CPU time: 210.08ms Serialization time: 74.72ms (35.57%) Checksum calculation time: 17.35ms (8.26%) Compression time: 111.78ms (53.21%) Total IO delay: 358.43ms Input size: 7.93MiB Decompressed size: 36.87MiB (compression = 21.5%) IO speed: 22.14MiB/s Concurrency adjusted uncompressed speed: 259.67MiB/s Actual uncompressed speed: 75.25MiB/s Actual speed: 16.18MiB/s Objects: 18158 Average object size uncompressed: 2.08KiB Average object size compressed: 457B Blocks: 124 (~65.47KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Pending / IO / Serde: 2 / 0 / 2 Pending / IO / Serde: 2 / 0 / 2 Pending / IO / Serde: 3 / 0 / 1 ================== High compression: true Concurrency: 4 File size: 4098671 Write time: 7.84s O. Stats: Wall clock time: 7.84s Total CPU time: 13.4s User wait time: 7.29s Serialization time: 78.09ms (0.58%) Checksum calculation time: 13.36ms (0.1%) Compression time: 13.3s (99.28%) Total IO delay: 122.99ms Concurrency overhead: 81.01ms Uncompressed size: 18.44MiB (~2.08KiB per object) Output size: 3.91MiB (~451B per object; compression = 21.2%) IO speed: 32.04MiB/s Concurrency adjusted uncompressed speed: 5.33MiB/s Actual uncompressed speed: 2.35MiB/s Actual speed: 510.8KiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 451B Blocks: 20 (~200.13KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Pending / IO / Serde: 3 / 1 / 0 I. Stats 1: Wall clock time: 245.27ms Total CPU time: 156.98ms Serialization time: 76.28ms (48.59%) Checksum calculation time: 13.24ms (8.43%) Compression time: 66.45ms (42.33%) Total IO delay: 151.09ms Input size: 3.91MiB Decompressed size: 18.44MiB (compression = 21.2%) IO speed: 25.89MiB/s Concurrency adjusted uncompressed speed: 239.44MiB/s Actual uncompressed speed: 75.25MiB/s Actual speed: 15.95MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 451B Blocks: 20 (~200.13KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 2: Wall clock time: 528.86ms Total CPU time: 304.15ms Serialization time: 126.91ms (41.73%) Checksum calculation time: 34.84ms (11.45%) Compression time: 140.6ms (46.23%) Total IO delay: 297.5ms Input size: 7.82MiB Decompressed size: 36.87MiB (compression = 21.2%) IO speed: 26.32MiB/s Concurrency adjusted uncompressed speed: 245.83MiB/s Actual uncompressed speed: 69.84MiB/s Actual speed: 14.81MiB/s Objects: 18158 Average object size uncompressed: 2.08KiB Average object size compressed: 451B Blocks: 40 (~200.13KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 ================== High compression: true Concurrency: 1 File size: 4156299 Write time: 10.84s O. Stats: Wall clock time: 10.84s Total CPU time: 10.54s User wait time: 10.79s Serialization time: 60.27ms (0.57%) Checksum calculation time: 8.66ms (0.08%) Compression time: 10.46s (99.28%) Total IO delay: 94.35ms Concurrency overhead: 74.57ms Uncompressed size: 18.44MiB (~2.08KiB per object) Output size: 3.96MiB (~457B per object; compression = 21.5%) IO speed: 42.17MiB/s Concurrency adjusted uncompressed speed: 1.72MiB/s Actual uncompressed speed: 1.7MiB/s Actual speed: 374.54KiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 457B Blocks: 62 (~65.47KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Checksum ok! I. Stats 1: Wall clock time: 328.43ms Total CPU time: 103.48ms Serialization time: 35.71ms (34.51%) Checksum calculation time: 8.57ms (8.29%) Compression time: 54.68ms (52.84%) Total IO delay: 324.5ms Input size: 3.96MiB Decompressed size: 18.44MiB (compression = 21.5%) IO speed: 12.23MiB/s Concurrency adjusted uncompressed speed: 43.18MiB/s Actual uncompressed speed: 56.21MiB/s Actual speed: 12.08MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 457B Blocks: 62 (~65.47KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 2: Wall clock time: 704.48ms Total CPU time: 208.14ms Serialization time: 71.53ms (34.36%) Checksum calculation time: 17.26ms (8.29%) Compression time: 110.48ms (53.08%) Total IO delay: 624.67ms Input size: 7.93MiB Decompressed size: 36.87MiB (compression = 21.5%) IO speed: 12.7MiB/s Concurrency adjusted uncompressed speed: 44.32MiB/s Actual uncompressed speed: 52.38MiB/s Actual speed: 11.26MiB/s Objects: 18158 Average object size uncompressed: 2.08KiB Average object size compressed: 457B Blocks: 124 (~65.47KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 ================== High compression: true Concurrency: 1 File size: 4098671 Write time: 11.72s O. Stats: Wall clock time: 11.72s Total CPU time: 11.34s User wait time: 11.64s Serialization time: 87.44ms (0.77%) Checksum calculation time: 9.06ms (0.08%) Compression time: 11.24s (99.1%) Total IO delay: 126.33ms Concurrency overhead: 71.62ms Uncompressed size: 18.44MiB (~2.08KiB per object) Output size: 3.91MiB (~451B per object; compression = 21.2%) IO speed: 31.02MiB/s Concurrency adjusted uncompressed speed: 1.6MiB/s Actual uncompressed speed: 1.57MiB/s Actual speed: 341.46KiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 451B Blocks: 20 (~200.13KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Checksum ok! Pending / IO / Serde: 0 / 0 / 0 I. Stats 1: Wall clock time: 212.95ms Total CPU time: 126.22ms Serialization time: 44.97ms (35.62%) Checksum calculation time: 17.27ms (13.68%) Compression time: 63.16ms (50.03%) Total IO delay: 154.25ms Input size: 3.91MiB Decompressed size: 18.44MiB (compression = 21.2%) IO speed: 25.38MiB/s Concurrency adjusted uncompressed speed: 65.85MiB/s Actual uncompressed speed: 86.97MiB/s Actual speed: 18.44MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 451B Blocks: 20 (~200.13KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 2: Wall clock time: 466.5ms Total CPU time: 252.28ms Serialization time: 94.62ms (37.51%) Checksum calculation time: 30.3ms (12.01%) Compression time: 125.83ms (49.87%) Total IO delay: 295.14ms Input size: 7.82MiB Decompressed size: 36.87MiB (compression = 21.2%) IO speed: 26.5MiB/s Concurrency adjusted uncompressed speed: 67.41MiB/s Actual uncompressed speed: 79.13MiB/s Actual speed: 16.78MiB/s Objects: 18158 Average object size uncompressed: 2.08KiB Average object size compressed: 451B Blocks: 40 (~200.13KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 com.milaboratory.primitivio.blocks.PrimitivOBlocksTest > bigBlocks STANDARD_OUT Pending / IO / Serde / Objs: 0 / 0 / 1 / 0 Pending / IO / Serde / Objs: 0 / 1 / 0 / 2000 Pending / IO / Serde / Objs: 0 / 0 / 1 / 3000 Pending / IO / Serde / Objs: 0 / 1 / 1 / 5000 Pending / IO / Serde / Objs: 0 / 1 / 0 / 7000 Pending / IO / Serde / Objs: 0 / 0 / 1 / 8000 Pending / IO / Serde / Objs: 0 / 1 / 0 / 10000 Pending / IO / Serde / Objs: 0 / 0 / 1 / 11000 Pending / IO / Serde / Objs: 0 / 1 / 0 / 13000 Pending / IO / Serde / Objs: 0 / 0 / 1 / 14000 Pending / IO / Serde / Objs: 0 / 0 / 0 / 16000 Pending / IO / Serde / Objs: 0 / 0 / 1 / 17000 Pending / IO / Serde / Objs: 0 / 1 / 0 / 19000 O. Stats: Wall clock time: 27.78s Total CPU time: 12.25s User wait time: 84.13us Serialization time: 3.86s (31.54%) Checksum calculation time: 1.86s (15.17%) Compression time: 2.66s (21.69%) Total IO delay: 12.15s Concurrency overhead: 29.53ms Uncompressed size: 1.86GiB (~97.66KiB per object) Output size: 1.86GiB (~97.66KiB per object; compression = 100%) IO speed: 157MiB/s Concurrency adjusted uncompressed speed: 619.5MiB/s Actual uncompressed speed: 68.66MiB/s Actual speed: 68.66MiB/s Objects: 20000 Average object size uncompressed: 97.66KiB Average object size compressed: 97.66KiB Blocks: 20 (~95.37MiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 com.milaboratory.test.TestUtil > testLT STANDARD_OUT Short tests. No system env properties. com.milaboratory.core.sequence.ShortSequenceSetTest > test1 STANDARD_OUT 99952 elements with 366.22KiB in raw nucleotide entropy serialized into 272.98KiB com.milaboratory.core.sequence.NucleotideAlphabetTest > testCalculateIntersections SKIPPED com.milaboratory.core.sequence.quality.QualityAggregatorTest > test1 STANDARD_OUT 48 com.milaboratory.core.sequence.quality.QualityAggregatorTest > test2 STANDARD_OUT 648 com.milaboratory.core.sequence.quality.QualityAggregatorTest > test3 STANDARD_OUT 2460 com.milaboratory.core.sequence.quality.QualityTrimmerTest > testParametersSerialization0 STANDARD_OUT { "averageQualityThreshold": 7.0, "windowSize": 6 } com.milaboratory.core.sequence.AminoAcidAlphabetTest > testCalculateMatches SKIPPED com.milaboratory.core.sequence.GeneticCodeTest > generateExtendedGeneticCode SKIPPED com.milaboratory.core.sequence.AminoAcidSequenceTest > testName STANDARD_OUT 3 com.milaboratory.core.sequence.AminoAcidSequenceTest > testConvertPositionSync1 STANDARD_OUT FromCenter 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 FromLeftWithoutIncompleteCodon 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 FromLeftWithIncompleteCodon 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 FromRightWithoutIncompleteCodon 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 FromRightWithIncompleteCodon 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 com.milaboratory.core.motif.BitapPatternTest > ttt STANDARD_OUT 0 ATTWCCGACA 9 ||| |||| 20 ATTT--GACA 27 [S3:W->T,D4:C,D5:C] 24 -26 com.milaboratory.core.RangeTest > test23e14 STANDARD_OUT 1000001 1010100 1000111 1000011 1000010 com.milaboratory.core.mutations.MutationTest > exportRegexps STANDARD_OUT S([\QAGCTNRYSWKMBDHV\E])(\d+)([\QAGCTNRYSWKMBDHV\E])|D([\QAGCTNRYSWKMBDHV\E])(\d+)|I(\d+)([\QAGCTNRYSWKMBDHV\E]) S([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E])(\d+)([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E])|D([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E])(\d+)|I(\d+)([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E]) com.milaboratory.core.mutations.MutationsUtilTest > test1111 STANDARD_OUT S([\QAGCTNRYSWKMBDHV\E])(\d+)([\QAGCTNRYSWKMBDHV\E])|D([\QAGCTNRYSWKMBDHV\E])(\d+)|I(\d+)([\QAGCTNRYSWKMBDHV\E]) S([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E])(\d+)([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E])|D([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E])(\d+)|I(\d+)([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E]) com.milaboratory.core.mutations.MutationsUtilTest > nt2AAWithMappingManual1 STANDARD_OUT [I2C::SM0I, I2G::I1A, I2C::I1A, SG2C:SM0I:I1A] com.milaboratory.core.mutations.MutationsUtilTest > nt2AAWithMappingManual2 STANDARD_OUT [S0:T->N,D13:V,S14:S->Y,S15:P->R,S16:W->P,S17:Y->G,S18:D->T,S19:P->I,S20:G->P,S21:D->A,S22:K->T,S23:A->K,S24:F->R,S25:G->S,S26:P->D,I27:S] [-1, -1, 9, 15] com.milaboratory.core.mutations.MutationsUtilTest > nt2AAWithMappingManual3 STANDARD_OUT 0 CAGGTTCAGCTGGTGCAGTCTGGAGCTGAGGTGAAGAAGCCTGGGGCCTCAGTGAAGGTCTCCTGCAAGGCTTCTGGTTACACCTTTACCAGCTACGGTATCAGCTGGGTGCGACAGGCCCCTGGACAAGGGCTTGAGTGGATGGGATGGATCAGCGCTTACAATGGTAACACAAACTATGCACAGAAGCTCCAGGGCAGAGTCACCATGACCACAGACACATCCACGAGCACAGCCTACATGGAGCTGAGGAGCCTGAGATCTGACGACACGGCCGTGTATTACTGTGCGAGAGA 295 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||| ||||| ||||||||||||||||||||||||||||| ||||||||| ||||||||| ||||||||||||||||||| || ||||| ||| || |||||||||||||| 0 CAGGTTCAGCTGGTGCAGTCTGGAGCTGAGGTGAAGAAGCCTGGGGCCTCAGTGAAGGTCTCCTGCAAGGCTTCTGGTTACACCTTTACCAGCTACGGTATCAGCTGGGTGCGACAGGCCCCTGGACAAGGGCTTGAGTGGATGGGATGGATCAGCGCTTACAATGGTAACACATTCTATGCAGAGAAGTTCCAGGGCAGAGTCACCATGACCACAGACGCATCCACGACCACAGCCTATATGGAGCTGAGGAGCCTGACATTTGACG-----GCCACATACTACTGTGCGAGAGA 290 [S58:N->F,S61:Q->E,S63:L->F,S73:T->A,S76:S->T,S86:R->T,S87:S->F,S89:D->G,D90:T,D91:A,S92:V->H,S93:Y->I,S94:Y->L,S95:C->L,S96:A->C,S97:R->E,S98:_->R] QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYGISWVRQAPGQGLEWMGWISAYNGNTFYAEKFQGRVTMTTDASTTTAYMELRSLTFDGHILLCER QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYGISWVRQAPGQGLEWMGWISAYNGNTFYAEKFQGRVTMTTDASTTTAYMELRSLTFDGHILLCER [S58:N->F,S61:Q->E,S63:L->F,S73:T->A,S76:S->T,S86:R->T,S87:S->F,S89:D->G,D90:T,D91:A,S92:V->H,S93:Y->I,S94:Y->L,S95:C->L,S96:A->C,S97:R->E,S98:_->R] [0, 0, 1, 2, 3, 4, -1, 5, 6, 7, 7, 8, 8, 8, 10, 10, 11, 12] com.milaboratory.core.mutations.MutationsUtilTest > nt2AAWithMappingManual4 STANDARD_OUT [S3:S->M,D4:D,S5:_->I] com.milaboratory.core.mutations.MutationsTest > testCanonical1 STANDARD_OUT TTATGGTCTTTAGATCAGGATCAAGACGGTGCGTGTTAGGGCGTAGCTGGATAAAAACAGTGGGCTCTCCATTACCCTGAAACGAAGACGGGTCCGCCCACCCTCCATGGACGGGTATACGAAGTGAATTCGTCTAACGGCGGTCAAATCCTGCTGTACCCAATAAGTGAAACGCTCGAGCAAAACTGGTCCACTAGATGCTTTTGTTCGCAACAAACGTGCATATCCTCTGCCTATTACTTTTATCGATTGAAACTTAGGTATGACACTGCACGTACCCGTAAAAAGCCCATGGTTAGGCTCGCCTATCCCGGACAATCTTGAAAGTGCACATACCTGTAAAGACCCCACGATGCAGCGTCTATTCGGGGTACGCCGAATACACGGTAGGGGGGAATATATCAGTACAACTTTAGGAAGCACCAAGTAATCGAACATGGTGTCGCCC TTATGGCTCTTAGATCAGGATCAGACGGTGCGTGTAGGGCGTAGCTGGATAAAAACAGTGGGCTCTCCATTATCCTGAAGAAGACGGTCCGCCCACCTTCCATGGACGGGTATACGAAGTGAGTTCGTCTAGGTGGTCAAATCCGCTGTACTCAATAAGTGAAAGCTCGAGCAACAACTGGTCCACTTAGGATTCTTTTGTTCGCAAAAACGTGCATATCCTCTGCCTATACTTTTATCATTGAAGCTCTAGGTATGACTGCACGTACCCGATCAAAAAGCCCATGGTTAGGCTCGCCTATCCCGGACAATCTTGAAAGTGCACAACTGTAAAGACCCTACGATGCACGTCTATTCGGGGTACGCCGTAACGGTAGGGGGGATATATCAGTACAACTTTTGGAAAGCACCAAGTATCGAACATGGTGATCCC TTATGGCTCTTAGTCAGGATCAGACTGTGCGTGAGGGCTGGCTGAGTAAAAACAGATGGGTCTCCATTATCCAAGAAGATGGTCCGCCCACCTTCCTATGGACGGTAGCGAAGTGAGTTCGTCTAGGTGGTCAAATCCGCTGTACTCAATGAATGAAAGCTCGAGCAACAACTGGTCCACTTAGATCTTTTGTTGCAAAAACGTGCTGTCCTCTGCCTATACTTTGTACATTGAGCTCTAGTATTACTGCACGACCCGATCAAAAAGCCCTGGTTAGGCTCGCCTATCCCGGACAATCTTGAAAGTGCACAACTTGTAAAGACCTACGATTCACGTTATTCGGGGTACGCCGTAACGGTAGGGTGGATATTCAGCACAACTTTGGAAAGCACCAAGTATCGAACATGTGATCCC 0 TTATGG-CTCTTAG-TCAGGATC-AGACTGTGCGTG--AGGGC-TGGCT-GAGTAAAAACAGATGGG-TCTCCATTATCC---AA-GAAGA-TGGTCCGCCCACCTTCCTATGGAC-GGTA-GCGAAGTGAGTTCGTCT-A-GGTGGTCAAATCC-GCTGTACTCAATGAA-TGAAA-GCTCGAGCAACAACTGGTCCACTTAGAT-CTTTTGTT-GCAA-AAACGTGC-TGTCCTCTGCCTA-TACTTTGTA-C-ATTG-AGCTCTA-GTAT--TACTGCACG-ACCCGATCAAAAAGCCC-TGGTTAGGCTCGCCTATCCCGGACAATCTTGAAAGTGCACA-ACTTGTAAAGA-CCTACGATTCA-CGT-TATTCGGGGTACGCCG--TA-ACGGTAGGGTGG-ATAT-TCAGCACAACTTT-GGAAAGCACCAAGT-ATCGAACAT-GTGAT--CCC 413 |||||| || |||| |||||||| |||| ||||||| ||||| | ||| || ||||||||| |||| ||||||||| || || ||||| |||||||||||| ||| |||||| |||| |||||||| ||||||| | || |||||||||| ||||||| |||| || ||||| |||||||||| ||||||||||| ||||| |||||||| |||| |||||||| | ||||||||||| |||||| || | |||| | || || |||| |||||||| ||||| | ||||||||| ||||||||||||||||||||||||||||||||||||||||| || |||||||| || ||||| || ||| |||||||||||||||| || ||||||||| || |||| |||| |||||||| || ||||||||||| ||||||||| ||| | ||| 0 TTATGGTCT-TTAGATCAGGATCAAGACGGTGCGTGTTAGGGCGTAGCTGGA-TAAAAACAG-TGGGCTCTCCATTACCCTGAAACGAAGACGGGTCCGCCCACCCTCC-ATGGACGGGTATACGAAGTGAATTCGTCTAACGGCGGTCAAATCCTGCTGTACCCAAT-AAGTGAAACGCTCGAGCAA-AACTGGTCCAC-TAGATGCTTTTGTTCGCAACAAACGTGCATATCCTCTGCCTATTACTTT-TATCGATTGAAACT-TAGGTATGACACTGCACGTACCCG-T-AAAAAGCCCATGGTTAGGCTCGCCTATCCCGGACAATCTTGAAAGTGCACATACCTGTAAAGACCCCACGATGCAGCGTCTATTCGGGGTACGCCGAATACACGGTAGGGGGGAATATATCAGTACAACTTTAGG-AAGCACCAAGTAATCGAACATGGTG-TCGCCC 447 [I6:T,I6:C,D7:C,D8:T,I35:T,D36:T,I77:T,I77:G,S77:T->A,D78:G,S81:A->C,D82:C,I88:C,S88:C->G,D89:G,I252:A,D253:A,I264:G,I264:A,S264:G->C,D267:A,D268:C,I345:C,D346:C,I378:A,D379:A,D412:T,S414:A->T,I415:A,D417:A,I419:A,I428:A,D429:A,I443:C,I443:G,D444:G,D447:C] 0 TTATGG--TCTTTAGATCAGGATCAAGACGGTGCGTG-TTAGGGCGTAGCTGGATAAAAACAGTGGGCTCTCCATTACCC--TGAAACGAAGA-CGGGTCCGCCCACCCTCCATGGACGGGTATACGAAGTGAATTCGTCTAACGGCGGTCAAATCCTGCTGTACCCAATAAGTGAAACGCTCGAGCAAAACTGGTCCACTAGATGCTTTTGTTCGCAACAAACGTGCATATCCTCTGCCTATTACTTTTATCGATTG-AAACTTAGGTAT--GACACTGCACGTACCCGTAAAAAGCCCATGGTTAGGCTCGCCTATCCCGGACAATCTTGAAAGTGCACATACCTGTAAAGA-CCCCACGATGCAGCGTCTATTCGGGGTACGCCG-AATACACGGTAGGGGGGAATATATCAGTACAACTTTA-GGAA-GCACCAAGT-AATCGAACATGGTGT--CGCCC 447 |||||| | |||||||||||||||||||||||||| | |||||||||||||||||||||||||||||||||||||||| || ||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| | |||||||||| || |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| | ||||||||||||||||||||||||||||||| | |||||||||||||||||||||||||||||||| | || | ||||||||| | ||||||||||||| | || 0 TTATGGTCT--TTAGATCAGGATCAAGACGGTGCGTGTT-AGGGCGTAGCTGGATAAAAACAGTGGGCTCTCCATTACCCTGA-AAC-GAAGACG-GGTCCGCCCACCCTCCATGGACGGGTATACGAAGTGAATTCGTCTAACGGCGGTCAAATCCTGCTGTACCCAATAAGTGAAACGCTCGAGCAAAACTGGTCCACTAGATGCTTTTGTTCGCAACAAACGTGCATATCCTCTGCCTATTACTTTTATCGATTGAA-ACTTAGGTATGACAC--TGCACGTACCCGTAAAAAGCCCATGGTTAGGCTCGCCTATCCCGGACAATCTTGAAAGTGCACATACCTGTAAAGACC-CCACGATGCAGCGTCTATTCGGGGTACGCCGAA-TACACGGTAGGGGGGAATATATCAGTACAACT-TTAGG-AAGCACCAAGTAA-TCGAACATGGTGTCGC-CC- 447 com.milaboratory.core.alignment.kaligner2.KAligner2Test > testBoundaries STANDARD_OUT 4965 com.milaboratory.core.alignment.kaligner2.KAligner2Test > caseJ1 STANDARD_OUT 52 0 TGATGCTTTTGATATCTGGGGCCAAGGGACAATGGTCACCGTCTCTTCAGGA 51 ||||||||||||||||||||||||||||||||||||||||||||||||||| 55 TGATGCTTTTGATATCTGGGGCCAAGGGACAATGGTCACCGTCTCTTCAGGG 106 [S51:A->G] (0->52) (55->107) com.milaboratory.core.alignment.kaligner2.KAligner2Test > testCase0 SKIPPED com.milaboratory.core.alignment.kaligner2.KAligner2Test > testSimpleRandomTest STANDARD_OUT Time per query: 1.43ms Processed queries: 28 Bad percent: 0.0 False positive percent: 0.64 Scoring error percent: 0.0 com.milaboratory.core.alignment.kaligner2.OffsetPacksAccumulatorTest > testScoreCorrection2 SKIPPED com.milaboratory.core.alignment.kaligner2.KMapper2Test > test11112 STANDARD_OUT ID: 0 Score: 1818 Cluster 0: Q 27 -> T 15 - -12 Q 30 -> T 18 - -12 Q 39 -> T 28 - -11 Q 42 -> T 31 - -11 Q 45 -> T 34 - -11 Q 48 -> T 37 - -11 Q 51 -> T 40 - -11 Cluster 1: Q 84 -> T 50 - -34 Q 87 -> T 53 - -34 Q 90 -> T 56 - -34 Q 93 -> T 59 - -34 Q 96 -> T 62 - -34 Q 99 -> T 65 - -34 Q 102 -> T 68 - -34 Q 111 -> T 79 - -32 Q 114 -> T 82 - -32 Q 117 -> T 85 - -32 Cluster 2: Q 150 -> T 92 - -58 Q 153 -> T 95 - -58 Q 156 -> T 98 - -58 Q 159 -> T 101 - -58 Cluster 3: Q 198 -> T 120 - -78 Q 201 -> T 123 - -78 Q 204 -> T 126 - -78 Q 207 -> T 129 - -78 Q 216 -> T 139 - -77 Q 219 -> T 142 - -77 Q 222 -> T 145 - -77 Q 231 -> T 153 - -78 Q 234 -> T 156 - -78 Q 237 -> T 159 - -78 Q 240 -> T 162 - -78 Cluster 4: Q 249 -> T 181 - -68 Q 252 -> T 184 - -68 Q 255 -> T 187 - -68 Q 258 -> T 190 - -68 Q 261 -> T 193 - -68 Q 262 -> T 194 - -68 com.milaboratory.core.alignment.kaligner2.KMapper2Test > test1111 STANDARD_OUT ID: 0 Score: 1308 Cluster 0: Q 9 -> T 15 - 6 Q 12 -> T 18 - 6 Q 15 -> T 21 - 6 Q 18 -> T 24 - 6 Q 21 -> T 27 - 6 Q 24 -> T 30 - 6 Q 27 -> T 33 - 6 Q 30 -> T 36 - 6 Cluster 1: Q 57 -> T 48 - -9 Q 60 -> T 51 - -9 Q 69 -> T 61 - -8 Q 72 -> T 64 - -8 Q 81 -> T 72 - -9 Q 84 -> T 75 - -9 Q 87 -> T 78 - -9 Cluster 2: Q 123 -> T 89 - -34 Q 126 -> T 92 - -34 Q 129 -> T 95 - -34 Q 132 -> T 98 - -34 Q 135 -> T 101 - -34 Q 150 -> T 116 - -34 Q 168 -> T 132 - -36 Q 171 -> T 135 - -36 Q 174 -> T 138 - -36 Q 177 -> T 141 - -36 Q 180 -> T 144 - -36 Q 183 -> T 147 - -36 Q 185 -> T 149 - -36 com.milaboratory.core.alignment.kaligner2.KMapper2Test > testRandom1 STANDARD_OUT noHits: 253 noHits2: 0 noHits3: 0 wrongTopHit: 46 wrongTopHitS: 38 noCorrectHitInList: 28 Timings: DescriptiveStatistics: n: 100000 min: 12339.0 max: 4.54497914E8 mean: 224368.37700994892 std dev: 4067982.3752048886 median: 106780.5 skewness: 98.0577615037179 kurtosis: 9994.450246724107 Clusters basicSize DescriptiveStatistics: n: 99701 min: 1.0 max: 6.0 mean: 2.862238091894764 std dev: 1.1024038664556184 median: 3.0 skewness: 0.3087025112402562 kurtosis: -0.6700933079314897 Top Delta DescriptiveStatistics: n: 99719 min: -13.0 max: 0.0 mean: -9.9278973916704E-4 std dev: 0.10592761395242115 median: 0.0 skewness: -114.00306505299204 kurtosis: 13423.838822552585 com.milaboratory.core.alignment.batch.SimpleBatchAlignerTest > test1 STANDARD_OUT 4 hits. com.milaboratory.core.alignment.blast.BlastDBBuilderTest > test1 SKIPPED com.milaboratory.core.alignment.blast.BlastAlignerExtTest > test16SMicrobial1 SKIPPED com.milaboratory.core.alignment.blast.BlastAlignerExtTest > test1 SKIPPED com.milaboratory.core.alignment.blast.BlastAlignerTest > test1 SKIPPED com.milaboratory.core.alignment.blast.BlastAlignerTest > simpleRandomTestT1 SKIPPED com.milaboratory.core.alignment.blast.BlastAlignerTest > simpleRandomTestT2 SKIPPED com.milaboratory.core.alignment.blast.BlastAlignerTest > simpleRandomTestT3 SKIPPED com.milaboratory.core.alignment.kaligner1.KMapperTest > testBestOffset2 STANDARD_OUT -205 com.milaboratory.core.alignment.kaligner1.KAlignerTest > testRandomCorrectness STANDARD_OUT C=1182;I=0;M=0;ScE=0;R=0.0 AlignmentTime = 780.45us C=1642;I=1;M=0;ScE=0;R=0.0 AlignmentTime = 501.05us C=2048;I=0;M=0;ScE=0;R=0.0 AlignmentTime = 434.57us C=2142;I=0;M=0;ScE=0;R=8.333333333333333E-7 AlignmentTime = 245.77us com.milaboratory.core.alignment.kaligner1.KAlignerTest > testRandom1 STANDARD_OUT ##teamcity[buildStatisticValue key='kmFound' value='0.9449'] ##teamcity[buildStatisticValue key='kmWrong' value='1.0E-4'] ##teamcity[buildStatisticValue key='kmFalse' value='0.0058'] com.milaboratory.core.alignment.kaligner1.KAlignerTest > testRandomCorrectnessConcurrent STANDARD_OUT C=3000;I=0;M=0;ScE=1;R=0.0 AlignmentTime = 367.68us C=2997;I=0;M=2;ScE=0;R=0.0 AlignmentTime = 290.57us C=2999;I=0;M=0;ScE=1;R=0.0 AlignmentTime = 327.32us C=2995;I=0;M=0;ScE=0;R=8.333333333333333E-7 AlignmentTime = 328.81us com.milaboratory.core.alignment.BandedAffineAlignerTest > test11 STANDARD_OUT 0 --------------------- -1 0 ATAAAAAAAAAAACGAGCTAG 20 0 --------------------- -1 0 ATAAAAAAAAAAACGAGCTAG 20 com.milaboratory.core.alignment.BandedAffineAlignerTest > test23 STANDARD_OUT 0 atgcggggatgc 11 0 atgcggggatgc 11 com.milaboratory.core.alignment.BandedAffineAlignerTest > test1 STANDARD_OUT 0 at-----------cgagctagTTTTTTTTTTT 20 0 atAAAAAAAAAAAcgagctag----------- 20 0 at-----------cgagctagTTTTTTTTTTT 20 0 atAAAAAAAAAAAcgagctag----------- 20 com.milaboratory.core.alignment.BandedAffineAlignerTest > test2 STANDARD_OUT 0 atgcGGGGatgc 11 0 atgcTA--atgc 9 0 atgcGGGGatgc----------- 11 0 atgcTA--atgcTTTTTTTTTTT 20 com.milaboratory.core.alignment.BandedAffineAlignerTest > test3 STANDARD_OUT 0 cgtaGGGGcgta 11 11 cgta--ATcgta 20 0 -----------cgtaGGGGcgta 11 0 TTTTTTTTTTTcgtaAT--cgta 20 com.milaboratory.core.alignment.BandedAffineAlignerTest > test4 STANDARD_OUT 0 atgcggggat-gTTTTT 15 0 atgcggggatAg----- 11 0 atgcggggat-gTTTTTTT 17 0 atgcggggatAg------- 11 com.milaboratory.core.alignment.BandedAffineAlignerTest > test5 STANDARD_OUT 7 g-taggggcgta 17 0 gAtaggggcgta 11 0 TTTTTTTg-taggggcgta 17 0 -------gAtaggggcgta 11 com.milaboratory.core.alignment.BandedAffineAlignerTest > test6 STANDARD_OUT 0 0 0 0 com.milaboratory.core.alignment.BandedAffineAlignerTest > semiGlobalLeft1 STANDARD_OUT 0 gCccTtgtgatgacccagactccagcctccgtgGAGgCaGctgtgggaggcacagtcaccatcaagtgccaggccagtcagagcattagcaacctcttaGCCTGGTATCAGCAGAAACCAGGGCAGCCTCCCAAGCTCCTGATCTATTATGCATCCGATCTGGcatctggggtctcatcaaggttcaaaggcagtggatctgggacagagtAcactctcaccatcagTggcgtgcagtgtgccgatgctgccacttactac 260 1 gAccCtgtgatgacccagactccagcctccgtgTCTgAaCctgtgggaggcacagtcaccatcaagtgccaggccagtcagagcattagcaacctctta-------------------------------------------------------------NNNcatctggggtctcatcaaggttcaaaggcagtggatctgggacagagtTcactctcaccatcagCggcgtgcagtgtgccgatgctgccacttactac 200 com.milaboratory.core.alignment.MultiAlignmentHelperTest > test1 STANDARD_OUT 8 AGACACAGATACA 20 ||||||| ||||| 0 AGACACATATACA 12 0 GATACATTAGACACAGATACA--- 20 ||||||| ||||| 0 --------AGACACATATACACAG 15 0 GATACATTAGA---CACAGATACA 20 ||||||||||| |||||||||| 5 GATACATTAGAGACCACAGATACA 28 0 GATAC-----ATTAGA---CACAGATACA 20 ||||| |||||| |||||||||| 0 GATACGATACATTAGAGACCACAGATACA 28 Quality 78778 878777 7778887878 Subject 0 GATAC-----ATTAGA---CACAGATACA--- 20 Query0 0 aga---cacaTataca 12 Query1 0 -------------aga---cacaTatacaCAG 15 Query2 5 gatac-----attagaGACcacagataca 28 Query3 0 gatacGATACattagaGACcacagataca 28 Quality 78778 Subject 0 GATAC 4 Query1 0 ----- 0 Query2 5 gatac 9 Query3 0 gatac 4 Quality Subject 5 ----- 5 Query1 0 ----- 0 Query2 10 ----- 10 Query3 5 GATAC 9 Quality 87877 Subject 5 ATTAG 9 Query0 0 ag 1 Query1 0 ---ag 1 Query2 10 attag 14 Query3 10 attag 14 Quality 7 7 Subject 10 A---C 11 Query0 2 a---c 3 Query1 2 a---c 3 Query2 15 aGACc 19 Query3 15 aGACc 19 Quality 77888 Subject 12 ACAGA 16 Query0 4 acaTa 8 Query1 4 acaTa 8 Query2 20 acaga 24 Query3 20 acaga 24 Quality 7878 Subject 17 TACA- 20 Query0 9 taca 12 Query1 9 tacaC 13 Query2 25 taca 28 Query3 25 taca 28 Quality Subject 21 -- 21 Query1 14 AG 15 0 GATAC-----ATTAGA---CACAGATACA--- 20 0 ...---....T..... 12 0 -------------...---....T.....CAG 15 5 .....-----......GAC.......... 28 0 .....GATAC......GAC.......... 28 787788787777778887878 0 GATACATTAGACACAGATACA 20 com.milaboratory.core.alignment.MultiAlignmentHelperTest > test2 STANDARD_OUT 15 TATAGGGAGAACTCCGATCGACATCG 40 ||||||||| ||||||||||||||| 0 TATAGGGAG--CTCCGATCGACATCG 23 56 CGATCC--CGGTGACAAAGCGTTCGGACC 82 |||||| ||||||||||||||||||||| 0 CGATCCTTCGGTGACAAAGCGTTCGGACC 28 36 CATCGGGTATCGCCCTGGTACG 57 |||| ||||||||||||||||| 0 CATCAGGTATCGCCCTGGTACG 21 0 AACGATGGGCGCAAATATAGGGAGAACTCCGATCGACATCGGGTATCGCCCTGGTACGATCC--CGGTGACAAAGCGTTCGGACCTGTCTGGACGCTAGAACGC 101 0 tatagggag--ctccgatcgacatcg 23 0 cgatccTTcggtgacaaagcgttcggacc 28 0 catcAggtatcgccctggtacg 21 com.milaboratory.core.alignment.AlignmentHelperTest > test1 STANDARD_OUT 0 GAGGTGCAGCTGGTGGAGTCTGGGGGAGGC 29 |||||||||||||||||||||||||||||| 0 GAGGTGCAGCTGGTGGAGTCTGGGGGAGGC 29 30 TTGGT-ACAGCCTGGGGGGTCCCTGAGACT 58 |||| | |||||||||||||| |||||| 30 CTGGTCA-AGCCTGGGGGGTCCATGAGACA 58 59 CTCCTGTGCAGCCTCTGGATTCACCTTCAG 88 |||||||||||||||||||||| ||||||| 59 CTCCTGTGCAGCCTCTGGATTCCCCTTCAG 88 89 TAGC-TATAGCATGAACTGGGTCCGCCAGG 117 || | ||||||||||||||||||||||||| 89 TA-CTTATAGCATGAACTGGGTCCGCCAGG 117 118 CTCCAGGGAAGGGGCTGGAGTGGGTTTCAT 147 ||||||||||||||||||||||||| |||| 118 CTCCAGGGAAGGGGCTGGAGTGGGTCTCAT 147 148 ACATTAGTAGTAGTAGTAG-TACCATATAC 176 |||||||||| ||||||| || |||||| 148 CCATTAGTAGTGGTAGTAGTTA-CATATAT 176 177 TACGCAGACTCTGTGAAGGGCCGATTCACC 206 ||||||||||| |||||||||||||||||| 177 TACGCAGACTCCGTGAAGGGCCGATTCACC 206 207 ATCTCCAGAGACAATGCCAAGAACTCACTG 236 |||||||||||||| ||||||||||||||| 207 ATCTCCAGAGACAACGCCAAGAACTCACTG 236 237 TATCTGCAAATGAACAGCCTGAGAGACGAG 266 ||||||||||||||||||||||||| |||| 237 TATCTGCAAATGAACAGCCTGAGAGCCGAG 266 267 GACACGGCTGTGTATTACTGTGC 289 ||||||||||||||||||||||| 267 GACACGGCTGTGTATTACTGTGC 289 com.milaboratory.core.alignment.AlignmentTrimmerTest > testRandom1 STANDARD_OUT lTrimmed = 1667 rTrimmed = 1660 lTrimmed = 2821 rTrimmed = 2722 com.milaboratory.core.alignment.AlignmentIteratorTest > test1 STANDARD_OUT 0 -ATT-AGACA-- 7 ||| || | 0 AATTGGGA-ATT 10 I0AI3GSA3GDC6I8TI8T com.milaboratory.core.alignment.BandedLinearAlignerTest > testCase1 STANDARD_OUT GCGTGAAGACTGCAGGCATTGAGTACGTTACTAGTCCAGTGGGGCCCAACCGTAACATTGCGTGTGACTGGTTGCTTAGCGGGTGACGGCGTTTCAGGTTACGCCCTCTGTGCATCACCGATAGCGTTGTTTGAGCTTTCTAACGTCTCAAACCTGCTTGCGCCCTACGGTTTCTCTATATATACACGAAAGGGGCTGGTCGCAACCTCGCAATTCTATCCCTCCAACCTCCCTCGAATTTTT AAAGCGTGAAGACTTGCAGGCATTGGTACGTTATTAGTCCAGTGGGGCCACAACCGTAACATTGCGTGTGACTGGTGCTTAGCGGGTGACGGCGTTCAGGTTACGCCCTCTGTGCATCACCGATTAGCGTTGTCTGAGCTTTCTAACGTCTCAAACCTGCTTGCGCCCTACGGTTTCTCTATAGTATCACGAAAGGGTCTGGTCGCAACCTCGCAATTCTATCCCTCCAACCTCCCTTGAATTTTTCTA com.milaboratory.core.alignment.BandedLinearAlignerTest > testGlobal1 STANDARD_OUT 1 AATTGACA 8 |||||| 0 TATTGACT 7 com.milaboratory.core.alignment.BandedLinearAlignerTest > testGlobal2 STANDARD_OUT 1 AATTGACAG 9 |||||| | 0 TATTGAC-G 7 com.milaboratory.core.alignment.BandedLinearAlignerTest > testGlobal3 STANDARD_OUT 0 TATTGACT 7 |||||| 1 AATTGACA 8 com.milaboratory.core.alignment.BandedLinearAlignerTest > testGlobal4 STANDARD_OUT 0 TATTGAC-G 7 |||||| | 1 AATTGACAG 9 com.milaboratory.core.alignment.AlignerTest > testCalculateScore1 STANDARD_OUT 7.73us 7.02us 8.03us com.milaboratory.core.alignment.AlignerCustomTest > testSemiLocal0 STANDARD_OUT 29.0 2 c----cccTTgaa---tgTtaGTa-----taacta--tct 27 0 cAGTTccc--gaaACCtgCta--aGCTCTtaactaCTtct 35 29.0 2 c----cccTTgaa---tgTtaGTa-----taacta--tct 27 0 cAGTTccc--gaaACCtgCta--aGCTCTtaactaCTtct 35 com.milaboratory.core.alignment.AlignmentTest > testInvert STANDARD_OUT 8 AGACACAGATACA 20 ||||||| ||||| 0 AGACACATATACA 12 0 AGACACATATACA 12 ||||||| ||||| 8 AGACACAGATACA 20 0 GATACATTAGACACAGATACA--- 20 ||||||| ||||| 0 --------AGACACATATACACAG 15 0 --------AGACACATATACACAG 15 ||||||| ||||| 0 GATACATTAGACACAGATACA--- 20 0 GATACATTAGA---CACAGATACA 20 ||||||||||| |||||||||| 5 GATACATTAGAGACCACAGATACA 28 5 GATACATTAGAGACCACAGATACA 28 ||||||||||| |||||||||| 0 GATACATTAGA---CACAGATACA 20 0 GATAC-----ATTAGA---CACAGATACA 20 ||||| |||||| |||||||||| 0 GATACGATACATTAGAGACCACAGATACA 28 0 GATACGATACATTAGAGACCACAGATACA 28 ||||| |||||| |||||||||| 0 GATAC-----ATTAGA---CACAGATACA 20 com.milaboratory.core.io.sequence.fasta.RandomAccessFastaReaderTest > test1nt STANDARD_ERROR Indexing milib_b6404d36028577cb33f0333ddd2f299870dd9bfc3309619293034468743.fasta: 0% Indexing milib_b6404d36028577cb33f0333ddd2f299870dd9bfc3309619293034468743.fasta: done com.milaboratory.core.io.sequence.fasta.RandomAccessFastaReaderTest > test1 STANDARD_ERROR Indexing milib_b6404d36028577cb33f0333ddd2f299870dd9bfc3309619293034468743.fasta: 0% Indexing milib_b6404d36028577cb33f0333ddd2f299870dd9bfc3309619293034468743.fasta: done com.milaboratory.core.io.sequence.fasta.RandomAccessFastaReaderTest > test2 STANDARD_ERROR Indexing milib_c87d6652523dc0ec0a35ca054a2d1242c85af14c10624241891490862285.tmp: 0% Indexing milib_c87d6652523dc0ec0a35ca054a2d1242c85af14c10624241891490862285.tmp: done com.milaboratory.core.io.util.IOUtilTest > test111 STANDARD_OUT 3 3 -2147483648 -9223372036854775808 com.milaboratory.core.tree.PrimerGenerator > generate SKIPPED com.milaboratory.core.tree.SequenceTreeMapTest > testCase9 STANDARD_OUT Hit 1 0 ac-gacTtgactg 11 0 acTgac-tgactg 11 Hit 2 0 ac-gactTgactg 11 0 acTgact-gactg 11 com.milaboratory.core.tree.SequenceTreeMapTest > optimalityAndScopeTest STANDARD_OUT --NW alignments-- CASSLAPGATN-KLFF CASS-APGATNEKLFF CASSLAPGATN-KLFF CASSLAPG-TNEKLFF CASSLAPGATN-KLfF CASSLAPG-TNEKLyF --STM alignments-- CASSLAPGATN-KLFF CASS-APGATNEKLFF CASSLAPGATN-KLFF CASSLAPG-TNEKLFF CASSlAPGATN-KLFF CASSa-PGATNEKLFF CASSLAPGaTN-KLFF CASSLAPGt-NEKLFF CASSlAPGATN-KLFF CA-SsAPGATNEKLFF CASSlAPGATN-KLFF CAS-sAPGATNEKLFF CASSLAPGATNk-LFF CASS-APGATNeKLFF CASSLAPGaTN-KLFF CASSLAP-gTNEKLFF CASSLAPGATNk-LFF CASSLAPG-TNeKLFF CASSLAPGATN-KLfF CASSLAPG-TNEKLyF ------------------ com.milaboratory.core.merger.MergerParametersTest > test2 STANDARD_OUT { "qualityMergingAlgorithm": "SumSubtraction", "partsLayout": "Collinear", "minimalOverlap": 15, "maxQuality": 50, "minimalIdentity": 0.8, "identityType": "Unweighted" } com.milaboratory.util.sorting.HashSorterTest > testSingleton STANDARD_OUT /tmp/milib_bac7eb5c8db1dd5f740bf13f57a4f17e7320ea926781687382009792448 timeInCollate: 11.6s timeInCollatorInit: 7.46s timeAwaitingO: 29.01ms timeAwaitingI: 2.43s timeInFinalSorting1: 0ns timeInFinalSorting2: 204.57ms timeInFinalSorting3: 125.08ms /22S (5|27|32): objs=50000 size=2.95MiB com.milaboratory.util.sorting.HashSorterTest > test1 STANDARD_OUT /tmp/milib_54ea880ec83eb6297fb512bfe009dc3c2d5d5a201612093031252092627 timeInCollate: 1.2m timeInCollatorInit: 13.97s timeAwaitingO: 2.42s timeAwaitingI: 20.33s timeInFinalSorting1: 9.01s timeInFinalSorting2: 4.05s timeInFinalSorting3: 1.49s /0N (5|27|32): objs=155525 size=8.58MiB /1N (5|27|32): objs=152815 size=8.42MiB /2N (5|27|32): objs=153845 size=8.94MiB /3N (5|27|32): objs=152456 size=8.5MiB /4N (5|27|32): objs=160226 size=8.86MiB /5N (5|27|32): objs=157141 size=8.92MiB /6N (5|27|32): objs=155767 size=8.97MiB /7N (5|27|32): objs=149979 size=8.32MiB /8N (5|27|32): objs=156455 size=9.01MiB /9N (5|27|32): objs=152873 size=8.49MiB /10N (5|27|32): objs=159609 size=9.26MiB /11N (5|27|32): objs=155155 size=9MiB /12N (5|27|32): objs=155235 size=8.83MiB /13N (5|27|32): objs=153033 size=8.53MiB /14N (5|27|32): objs=156868 size=8.74MiB /15N (5|27|32): objs=152840 size=8.64MiB /16N (5|27|32): objs=154369 size=8.51MiB /17N (5|27|32): objs=153783 size=8.86MiB /18N (5|27|32): objs=156888 size=8.98MiB /19N (5|27|32): objs=158346 size=9MiB /20N (5|27|32): objs=162205 size=9.21MiB /21N (5|27|32): objs=162815 size=9.38MiB /22N (5|27|32): objs=160745 size=9.14MiB /23N (5|27|32): objs=157083 size=8.58MiB /24N (5|27|32): objs=153127 size=8.56MiB /25N (5|27|32): objs=156869 size=8.82MiB /26N (5|27|32): objs=160210 size=9.23MiB /27N (5|27|32): objs=153310 size=8.84MiB /28N (5|27|32): objs=157185 size=8.95MiB /29N (5|27|32): objs=152716 size=8.56MiB /30N (5|27|32): objs=161961 size=9.11MiB /31N (5|27|32): objs=158566 size=9MiB /0/0N (2|25|36): objs=38644 size=796.21KiB /0/1N (2|25|36): objs=37017 size=721.72KiB /0/2N (2|25|36): objs=37485 size=702.98KiB /0/3N (2|25|36): objs=8983 size=49.67KiB /0/4S (2|25|36): objs=160 size=165B /0/5N (2|25|36): objs=1796 size=7.43KiB /0/6S (2|25|36): objs=139 size=119B /0/7N (2|25|36): objs=4258 size=20.07KiB /0/8S (2|25|36): objs=151 size=308B /0/9N (2|25|36): objs=919 size=3.88KiB /0/10S (2|25|36): objs=167 size=197B /0/11N (2|25|36): objs=1137 size=4.78KiB /0/12S (2|25|36): objs=139 size=297B /0/13N (2|25|36): objs=1495 size=6.55KiB /0/14S (2|25|36): objs=141 size=96B /0/15N (2|25|36): objs=3760 size=16.9KiB /0/16S (2|25|36): objs=141 size=233B /0/17N (2|25|36): objs=3536 size=15.12KiB /0/18S (2|25|36): objs=148 size=198B /0/19N (2|25|36): objs=1199 size=4.9KiB /0/20S (2|25|36): objs=144 size=318B /0/21N (2|25|36): objs=416 size=1.54KiB /0/22S (2|25|36): objs=187 size=309B /0/23N (2|25|36): objs=4384 size=19.54KiB /0/24S (2|25|36): objs=149 size=289B /0/25S (2|25|36): objs=152 size=285B /0/26S (2|25|36): objs=185 size=329B /0/27N (2|25|36): objs=1089 size=4.19KiB /0/28S (2|25|36): objs=159 size=298B /0/29S (2|25|36): objs=133 size=276B /0/30S (2|25|36): objs=170 size=348B /0/31N (2|25|36): objs=3388 size=15.52KiB /0/32S (2|25|36): objs=135 size=169B /0/33N (2|25|36): objs=1201 size=4.56KiB /0/34S (2|25|36): objs=162 size=97B /0/35N (2|25|36): objs=2056 size=8.63KiB /1/0N (2|25|36): objs=38186 size=866.03KiB /1/1N (2|25|36): objs=37862 size=760.89KiB /1/2N (2|25|36): objs=12282 size=67.97KiB /1/3S (2|25|36): objs=164 size=126B /1/4N (2|25|36): objs=15909 size=95.65KiB /1/5S (2|25|36): objs=158 size=347B /1/6N (2|25|36): objs=10788 size=59.29KiB /1/7S (2|25|36): objs=148 size=153B /1/8S (2|25|36): objs=171 size=272B /1/9S (2|25|36): objs=130 size=229B /1/10N (2|25|36): objs=316 size=1.01KiB /1/11N (2|25|36): objs=2622 size=11.48KiB /1/12S (2|25|36): objs=149 size=251B /1/13N (2|25|36): objs=740 size=2.92KiB /1/14S (2|25|36): objs=179 size=221B /1/15N (2|25|36): objs=2596 size=11.06KiB /1/16S (2|25|36): objs=148 size=130B /1/18S (2|25|36): objs=153 size=142B /1/19N (2|25|36): objs=7618 size=36.52KiB /1/20S (2|25|36): objs=126 size=142B /1/21N (2|25|36): objs=1364 size=5.7KiB /1/22S (2|25|36): objs=166 size=193B /1/23N (2|25|36): objs=324 size=936B /1/24S (2|25|36): objs=161 size=348B /1/25N (2|25|36): objs=4101 size=19.79KiB /1/26S (2|25|36): objs=161 size=267B /1/27N (2|25|36): objs=802 size=2.98KiB /1/28S (2|25|36): objs=148 size=334B /1/29N (2|25|36): objs=1534 size=6.31KiB /1/30S (2|25|36): objs=150 size=221B /1/31N (2|25|36): objs=598 size=2.03KiB /1/32S (2|25|36): objs=152 size=180B /1/33N (2|25|36): objs=11942 size=71.68KiB /1/34S (2|25|36): objs=140 size=182B /1/35N (2|25|36): objs=627 size=2.23KiB /2/0N (2|25|36): objs=13106 size=82.15KiB /2/1S (2|25|36): objs=168 size=268B /2/2N (2|25|36): objs=20319 size=235.81KiB /2/3N (2|25|36): objs=41737 size=1008.13KiB /2/4N (2|25|36): objs=37064 size=826.13KiB /2/5N (2|25|36): objs=16162 size=144.09KiB /2/6S (2|25|36): objs=164 size=336B /2/7N (2|25|36): objs=2237 size=9.38KiB /2/8S (2|25|36): objs=172 size=210B /2/9N (2|25|36): objs=3226 size=14.02KiB /2/10S (2|25|36): objs=158 size=318B /2/11N (2|25|36): objs=880 size=3.54KiB /2/12S (2|25|36): objs=146 size=256B /2/13N (2|25|36): objs=934 size=3.71KiB /2/14S (2|25|36): objs=184 size=366B /2/15N (2|25|36): objs=2884 size=12.23KiB /2/16S (2|25|36): objs=141 size=92B /2/17N (2|25|36): objs=434 size=1.51KiB /2/18S (2|25|36): objs=149 size=274B /2/20S (2|25|36): objs=131 size=261B /2/21N (2|25|36): objs=3118 size=13.47KiB /2/22S (2|25|36): objs=150 size=141B /2/23N (2|25|36): objs=787 size=2.87KiB /2/24S (2|25|36): objs=158 size=330B /2/25N (2|25|36): objs=2779 size=11.78KiB /2/26S (2|25|36): objs=152 size=121B /2/27N (2|25|36): objs=924 size=3.67KiB /2/28S (2|25|36): objs=148 size=332B /2/29N (2|25|36): objs=2611 size=11.37KiB /2/30S (2|25|36): objs=151 size=196B /2/31S (2|25|36): objs=169 size=142B /2/32S (2|25|36): objs=164 size=93B /2/33N (2|25|36): objs=1986 size=8.15KiB /2/34S (2|25|36): objs=152 size=125B /3/0N (2|25|36): objs=37632 size=878.7KiB /3/1N (2|25|36): objs=23673 size=344.33KiB /3/2S (2|25|36): objs=170 size=189B /3/3N (2|25|36): objs=16262 size=108.02KiB /3/4N (2|25|36): objs=34627 size=594.66KiB /3/5N (2|25|36): objs=12143 size=77.76KiB /3/6S (2|25|36): objs=190 size=150B /3/7N (2|25|36): objs=4469 size=20.25KiB /3/8S (2|25|36): objs=158 size=292B /3/9N (2|25|36): objs=1187 size=4.82KiB /3/10S (2|25|36): objs=161 size=205B /3/11N (2|25|36): objs=487 size=1.54KiB /3/12S (2|25|36): objs=179 size=165B /3/13N (2|25|36): objs=793 size=3.19KiB /3/14S (2|25|36): objs=156 size=253B /3/15N (2|25|36): objs=2154 size=8.83KiB /3/16S (2|25|36): objs=158 size=310B /3/17S (2|25|36): objs=155 size=186B /3/18S (2|25|36): objs=148 size=93B /3/19N (2|25|36): objs=1867 size=7.55KiB /3/20S (2|25|36): objs=153 size=161B /3/21N (2|25|36): objs=7261 size=38.64KiB /3/22S (2|25|36): objs=138 size=282B /3/23N (2|25|36): objs=909 size=3.5KiB /3/24S (2|25|36): objs=145 size=278B /3/25N (2|25|36): objs=2856 size=12.25KiB /3/26S (2|25|36): objs=159 size=171B /3/27N (2|25|36): objs=750 size=2.8KiB /3/28S (2|25|36): objs=145 size=181B /3/29N (2|25|36): objs=612 size=2.17KiB /3/30S (2|25|36): objs=160 size=281B /3/32S (2|25|36): objs=154 size=256B /3/33N (2|25|36): objs=1056 size=4.35KiB /3/34S (2|25|36): objs=144 size=196B /3/35N (2|25|36): objs=1045 size=4.41KiB /4/0N (2|25|36): objs=37290 size=759.27KiB /4/1N (2|25|36): objs=42268 size=851.57KiB /4/2N (2|25|36): objs=39692 size=862.44KiB /4/3N (2|25|36): objs=9998 size=49.68KiB /4/4S (2|25|36): objs=146 size=139B /4/5S (2|25|36): objs=157 size=159B /4/6S (2|25|36): objs=146 size=173B /4/7N (2|25|36): objs=2740 size=11.82KiB /4/8S (2|25|36): objs=157 size=183B /4/9N (2|25|36): objs=306 size=813B /4/10S (2|25|36): objs=162 size=106B /4/12S (2|25|36): objs=148 size=117B /4/13N (2|25|36): objs=3158 size=13.43KiB /4/14S (2|25|36): objs=164 size=286B /4/15N (2|25|36): objs=4664 size=21.91KiB /4/16S (2|25|36): objs=151 size=121B /4/17N (2|25|36): objs=1513 size=6.11KiB /4/18S (2|25|36): objs=159 size=285B /4/19N (2|25|36): objs=1415 size=5.82KiB /4/20S (2|25|36): objs=142 size=172B /4/21N (2|25|36): objs=1973 size=8.22KiB /4/22S (2|25|36): objs=155 size=337B /4/23N (2|25|36): objs=1693 size=7.06KiB /4/24S (2|25|36): objs=152 size=315B /4/25N (2|25|36): objs=5504 size=25.76KiB /4/26S (2|25|36): objs=150 size=184B /4/27N (2|25|36): objs=1822 size=7.66KiB /4/28S (2|25|36): objs=140 size=333B /4/29S (2|25|36): objs=143 size=295B /4/30S (2|25|36): objs=153 size=132B /4/31N (2|25|36): objs=2266 size=9.81KiB /4/32S (2|25|36): objs=135 size=126B /4/33N (2|25|36): objs=289 size=829B /4/34S (2|25|36): objs=167 size=226B /4/35N (2|25|36): objs=908 size=3.42KiB /5/0N (2|25|36): objs=37977 size=746.11KiB /5/1N (2|25|36): objs=37944 size=752.52KiB /5/2N (2|25|36): objs=40550 size=928.42KiB /5/3N (2|25|36): objs=7165 size=34.84KiB /5/4S (2|25|36): objs=146 size=235B /5/6S (2|25|36): objs=150 size=267B /5/7N (2|25|36): objs=774 size=2.79KiB /5/8S (2|25|36): objs=163 size=196B /5/9N (2|25|36): objs=267 size=955B /5/10S (2|25|36): objs=160 size=272B /5/11N (2|25|36): objs=893 size=3.34KiB /5/12S (2|25|36): objs=149 size=271B /5/13S (2|25|36): objs=163 size=92B /5/14S (2|25|36): objs=145 size=216B /5/15N (2|25|36): objs=1084 size=4.19KiB /5/16S (2|25|36): objs=168 size=202B /5/17N (2|25|36): objs=8628 size=43.92KiB /5/18S (2|25|36): objs=155 size=151B /5/19N (2|25|36): objs=477 size=1.82KiB /5/20S (2|25|36): objs=148 size=103B /5/21N (2|25|36): objs=3535 size=15.07KiB /5/22S (2|25|36): objs=151 size=195B /5/23N (2|25|36): objs=957 size=3.69KiB /5/24S (2|25|36): objs=150 size=170B /5/25N (2|25|36): objs=931 size=3.61KiB /5/26S (2|25|36): objs=163 size=106B /5/27N (2|25|36): objs=3004 size=13.48KiB /5/28S (2|25|36): objs=159 size=169B /5/29N (2|25|36): objs=3678 size=17.67KiB /5/30S (2|25|36): objs=177 size=93B /5/31N (2|25|36): objs=3198 size=15.39KiB /5/32S (2|25|36): objs=140 size=233B /5/33N (2|25|36): objs=2614 size=10.95KiB /5/34S (2|25|36): objs=153 size=94B /5/35N (2|25|36): objs=825 size=2.88KiB /6/0N (2|25|36): objs=34466 size=685.76KiB /6/1N (2|25|36): objs=41559 size=1.02MiB /6/2N (2|25|36): objs=30218 size=525.78KiB /6/3S (2|25|36): objs=142 size=297B /6/4N (2|25|36): objs=10802 size=61.43KiB /6/5N (2|25|36): objs=929 size=3.67KiB /6/6S (2|25|36): objs=150 size=325B /6/7N (2|25|36): objs=743 size=2.63KiB /6/8S (2|25|36): objs=172 size=155B /6/9N (2|25|36): objs=4575 size=20.39KiB /6/10S (2|25|36): objs=144 size=141B /6/11N (2|25|36): objs=2657 size=11.83KiB /6/12S (2|25|36): objs=146 size=121B /6/13N (2|25|36): objs=4240 size=20.24KiB /6/14S (2|25|36): objs=171 size=262B /6/15N (2|25|36): objs=2523 size=10.85KiB /6/16S (2|25|36): objs=166 size=334B /6/17S (2|25|36): objs=150 size=186B /6/18S (2|25|36): objs=161 size=114B /6/19N (2|25|36): objs=608 size=2.21KiB /6/20S (2|25|36): objs=140 size=137B /6/21N (2|25|36): objs=1073 size=4.09KiB /6/22S (2|25|36): objs=172 size=103B /6/23N (2|25|36): objs=1943 size=7.99KiB /6/24S (2|25|36): objs=160 size=151B /6/25N (2|25|36): objs=2250 size=9.5KiB /6/26S (2|25|36): objs=151 size=336B /6/27N (2|25|36): objs=4647 size=23.19KiB /6/28S (2|25|36): objs=150 size=264B /6/29N (2|25|36): objs=3614 size=16.79KiB /6/30S (2|25|36): objs=149 size=221B /6/31N (2|25|36): objs=4221 size=18.36KiB /6/32S (2|25|36): objs=150 size=322B /6/33N (2|25|36): objs=1441 size=6.07KiB /6/34S (2|25|36): objs=163 size=257B /6/35N (2|25|36): objs=621 size=2.25KiB /7/0N (2|25|36): objs=38622 size=853.26KiB /7/1N (2|25|36): objs=35860 size=687.75KiB /7/2N (2|25|36): objs=38329 size=868.69KiB /7/3N (2|25|36): objs=13014 size=90.44KiB /7/4S (2|25|36): objs=147 size=249B /7/5N (2|25|36): objs=608 size=2.2KiB /7/6S (2|25|36): objs=137 size=98B /7/7N (2|25|36): objs=294 size=889B /7/8S (2|25|36): objs=170 size=316B /7/9S (2|25|36): objs=153 size=118B /7/10S (2|25|36): objs=143 size=289B /7/11N (2|25|36): objs=610 size=2.14KiB /7/12S (2|25|36): objs=125 size=239B /7/13N (2|25|36): objs=1680 size=7.04KiB /7/14S (2|25|36): objs=185 size=333B /7/15N (2|25|36): objs=1369 size=5.66KiB /7/16S (2|25|36): objs=145 size=194B /7/17N (2|25|36): objs=1227 size=4.7KiB /7/18S (2|25|36): objs=145 size=126B /7/19N (2|25|36): objs=4082 size=17.98KiB /7/20S (2|25|36): objs=141 size=163B /7/21N (2|25|36): objs=3056 size=13.5KiB /7/22S (2|25|36): objs=144 size=254B /7/23N (2|25|36): objs=1623 size=7.04KiB /7/24S (2|25|36): objs=132 size=83B /7/25N (2|25|36): objs=3423 size=14.25KiB /7/26S (2|25|36): objs=146 size=226B /7/27N (2|25|36): objs=2225 size=9.69KiB /7/28S (2|25|36): objs=160 size=208B /7/29N (2|25|36): objs=332 size=957B /7/30S (2|25|36): objs=159 size=106B /7/31N (2|25|36): objs=795 size=2.85KiB /7/32S (2|25|36): objs=141 size=237B /7/33S (2|25|36): objs=140 size=143B /7/34S (2|25|36): objs=145 size=292B /7/35S (2|25|36): objs=172 size=337B /8/0N (2|25|36): objs=37558 size=789.38KiB /8/1N (2|25|36): objs=44865 size=1.18MiB /8/2N (2|25|36): objs=38646 size=779.18KiB /8/3N (2|25|36): objs=4205 size=20.39KiB /8/4S (2|25|36): objs=162 size=306B /8/6S (2|25|36): objs=145 size=199B /8/7N (2|25|36): objs=2651 size=11.15KiB /8/8S (2|25|36): objs=136 size=212B /8/10S (2|25|36): objs=154 size=219B /8/11N (2|25|36): objs=983 size=3.83KiB /8/12S (2|25|36): objs=160 size=172B /8/13N (2|25|36): objs=656 size=2.43KiB /8/14S (2|25|36): objs=142 size=185B /8/15N (2|25|36): objs=605 size=2.18KiB /8/16S (2|25|36): objs=151 size=141B /8/17N (2|25|36): objs=4818 size=21.58KiB /8/18S (2|25|36): objs=182 size=182B /8/19N (2|25|36): objs=2081 size=9.09KiB /8/20S (2|25|36): objs=179 size=187B /8/21N (2|25|36): objs=2086 size=8.59KiB /8/22S (2|25|36): objs=161 size=192B /8/23N (2|25|36): objs=3180 size=13.5KiB /8/24S (2|25|36): objs=172 size=250B /8/25N (2|25|36): objs=1568 size=6.39KiB /8/26S (2|25|36): objs=160 size=127B /8/27N (2|25|36): objs=1283 size=5.28KiB /8/28S (2|25|36): objs=154 size=229B /8/29N (2|25|36): objs=3729 size=16.46KiB /8/30S (2|25|36): objs=130 size=143B /8/31N (2|25|36): objs=288 size=874B /8/32S (2|25|36): objs=162 size=238B /8/33N (2|25|36): objs=3237 size=14.05KiB /8/34S (2|25|36): objs=174 size=223B /8/35N (2|25|36): objs=1492 size=6.15KiB /9/0N (2|25|36): objs=38628 size=825.58KiB /9/1N (2|25|36): objs=39695 size=855.62KiB /9/2N (2|25|36): objs=30708 size=560.48KiB /9/3S (2|25|36): objs=149 size=290B /9/4N (2|25|36): objs=431 size=1.44KiB /9/5S (2|25|36): objs=155 size=138B /9/6N (2|25|36): objs=3587 size=15.77KiB /9/7S (2|25|36): objs=154 size=227B /9/8N (2|25|36): objs=324 size=869B /9/9S (2|25|36): objs=157 size=230B /9/10N (2|25|36): objs=2226 size=9.34KiB /9/11N (2|25|36): objs=6019 size=33.51KiB /9/12S (2|25|36): objs=157 size=317B /9/13N (2|25|36): objs=510 size=1.79KiB /9/14S (2|25|36): objs=167 size=193B /9/15N (2|25|36): objs=1474 size=5.93KiB /9/16S (2|25|36): objs=165 size=235B /9/17N (2|25|36): objs=1732 size=7.17KiB /9/18S (2|25|36): objs=161 size=193B /9/19N (2|25|36): objs=5963 size=26.54KiB /9/20S (2|25|36): objs=144 size=336B /9/21N (2|25|36): objs=1695 size=7.06KiB /9/22S (2|25|36): objs=125 size=254B /9/23N (2|25|36): objs=2553 size=11.42KiB /9/24S (2|25|36): objs=152 size=159B /9/25N (2|25|36): objs=3867 size=17.72KiB /9/26S (2|25|36): objs=143 size=222B /9/27N (2|25|36): objs=2134 size=8.84KiB /9/28S (2|25|36): objs=149 size=317B /9/29N (2|25|36): objs=5468 size=25.46KiB /9/30S (2|25|36): objs=152 size=231B /9/31N (2|25|36): objs=3138 size=13.33KiB /9/32S (2|25|36): objs=160 size=230B /9/33S (2|25|36): objs=125 size=211B /9/34S (2|25|36): objs=154 size=179B /9/35S (2|25|36): objs=152 size=129B /10/0N (2|25|36): objs=37475 size=827.97KiB /10/1N (2|25|36): objs=45338 size=1.12MiB /10/2N (2|25|36): objs=36694 size=803.08KiB /10/3N (2|25|36): objs=2621 size=12.04KiB /10/4S (2|25|36): objs=169 size=247B /10/6S (2|25|36): objs=150 size=273B /10/7N (2|25|36): objs=2840 size=12.98KiB /10/8S (2|25|36): objs=157 size=231B /10/9N (2|25|36): objs=5831 size=29.74KiB /10/10S (2|25|36): objs=136 size=115B /10/11N (2|25|36): objs=1491 size=5.97KiB /10/12S (2|25|36): objs=151 size=95B /10/13N (2|25|36): objs=5642 size=27.85KiB /10/14S (2|25|36): objs=177 size=284B /10/15S (2|25|36): objs=170 size=234B /10/16S (2|25|36): objs=161 size=297B /10/17N (2|25|36): objs=2096 size=9.05KiB /10/18S (2|25|36): objs=159 size=130B /10/19N (2|25|36): objs=3004 size=14.79KiB /10/20S (2|25|36): objs=156 size=191B /10/21N (2|25|36): objs=442 size=1.56KiB /10/22S (2|25|36): objs=129 size=231B /10/23N (2|25|36): objs=5066 size=23.18KiB /10/24S (2|25|36): objs=143 size=97B /10/25S (2|25|36): objs=151 size=313B /10/26S (2|25|36): objs=166 size=127B /10/27N (2|25|36): objs=2382 size=9.75KiB /10/28S (2|25|36): objs=156 size=90B /10/29N (2|25|36): objs=2841 size=12.05KiB /10/30S (2|25|36): objs=153 size=299B /10/31N (2|25|36): objs=1094 size=4.44KiB /10/32S (2|25|36): objs=148 size=259B /10/34S (2|25|36): objs=146 size=135B /10/35N (2|25|36): objs=1974 size=8.15KiB /11/0N (2|25|36): objs=39180 size=881.85KiB /11/1N (2|25|36): objs=20484 size=221.96KiB /11/2S (2|25|36): objs=167 size=266B /11/3N (2|25|36): objs=18363 size=127.33KiB /11/4N (2|25|36): objs=38828 size=944.18KiB /11/5N (2|25|36): objs=1355 size=5.53KiB /11/6S (2|25|36): objs=133 size=182B /11/7N (2|25|36): objs=859 size=3.49KiB /11/8S (2|25|36): objs=157 size=349B /11/9N (2|25|36): objs=7640 size=41.54KiB /11/10S (2|25|36): objs=161 size=262B /11/11N (2|25|36): objs=1999 size=8.91KiB /11/12S (2|25|36): objs=160 size=209B /11/13N (2|25|36): objs=2017 size=8.45KiB /11/14S (2|25|36): objs=157 size=313B /11/15N (2|25|36): objs=1364 size=5.59KiB /11/16S (2|25|36): objs=152 size=329B /11/17N (2|25|36): objs=1686 size=6.96KiB /11/18S (2|25|36): objs=146 size=141B /11/19N (2|25|36): objs=6622 size=31.06KiB /11/20S (2|25|36): objs=154 size=246B /11/21N (2|25|36): objs=2745 size=11.83KiB /11/22S (2|25|36): objs=131 size=271B /11/23N (2|25|36): objs=1821 size=7.5KiB /11/24S (2|25|36): objs=139 size=183B /11/25N (2|25|36): objs=578 size=2.21KiB /11/26S (2|25|36): objs=141 size=91B /11/27N (2|25|36): objs=578 size=2.19KiB /11/28S (2|25|36): objs=140 size=194B /11/29N (2|25|36): objs=311 size=917B /11/30S (2|25|36): objs=168 size=133B /11/31N (2|25|36): objs=5254 size=26.09KiB /11/32S (2|25|36): objs=135 size=203B /11/33N (2|25|36): objs=1077 size=4.32KiB /11/34S (2|25|36): objs=153 size=202B /12/0N (2|25|36): objs=37953 size=872.82KiB /12/1N (2|25|36): objs=39161 size=912.26KiB /12/2N (2|25|36): objs=36380 size=803.1KiB /12/4S (2|25|36): objs=146 size=111B /12/5N (2|25|36): objs=3346 size=14.48KiB /12/6S (2|25|36): objs=160 size=96B /12/7N (2|25|36): objs=1622 size=6.97KiB /12/8S (2|25|36): objs=164 size=315B /12/9N (2|25|36): objs=1516 size=6.12KiB /12/10S (2|25|36): objs=146 size=220B /12/11N (2|25|36): objs=1387 size=5.64KiB /12/12S (2|25|36): objs=153 size=108B /12/13N (2|25|36): objs=1036 size=3.95KiB /12/14S (2|25|36): objs=153 size=316B /12/15N (2|25|36): objs=1822 size=7.44KiB /12/16S (2|25|36): objs=144 size=114B /12/17N (2|25|36): objs=6917 size=33.29KiB /12/18S (2|25|36): objs=174 size=146B /12/19N (2|25|36): objs=1827 size=7.58KiB /12/20S (2|25|36): objs=165 size=239B /12/21N (2|25|36): objs=3389 size=14.17KiB /12/22S (2|25|36): objs=154 size=257B /12/23N (2|25|36): objs=3698 size=17.2KiB /12/24S (2|25|36): objs=147 size=260B /12/25N (2|25|36): objs=1821 size=7.94KiB /12/26S (2|25|36): objs=167 size=285B /12/27N (2|25|36): objs=1082 size=4.35KiB /12/28S (2|25|36): objs=171 size=118B /12/29N (2|25|36): objs=3791 size=16.05KiB /12/30S (2|25|36): objs=153 size=222B /12/32S (2|25|36): objs=168 size=323B /12/33N (2|25|36): objs=2596 size=11.35KiB /12/34S (2|25|36): objs=141 size=137B /12/35N (2|25|36): objs=3385 size=15.96KiB /13/0N (2|25|36): objs=43126 size=1018.24KiB /13/1N (2|25|36): objs=39486 size=781.21KiB /13/2N (2|25|36): objs=2293 size=9.56KiB /13/3S (2|25|36): objs=162 size=258B /13/4N (2|25|36): objs=30699 size=510.32KiB /13/5N (2|25|36): objs=13278 size=78.51KiB /13/6S (2|25|36): objs=187 size=372B /13/7N (2|25|36): objs=497 size=1.53KiB /13/8S (2|25|36): objs=140 size=150B /13/9N (2|25|36): objs=2232 size=9.26KiB /13/10S (2|25|36): objs=135 size=307B /13/12S (2|25|36): objs=136 size=219B /13/13S (2|25|36): objs=143 size=181B /13/14S (2|25|36): objs=161 size=125B /13/16S (2|25|36): objs=133 size=148B /13/17N (2|25|36): objs=1208 size=4.84KiB /13/18S (2|25|36): objs=150 size=279B /13/19N (2|25|36): objs=492 size=1.56KiB /13/20S (2|25|36): objs=134 size=301B /13/21N (2|25|36): objs=4236 size=21.06KiB /13/22S (2|25|36): objs=137 size=185B /13/23N (2|25|36): objs=2826 size=13.35KiB /13/24S (2|25|36): objs=155 size=312B /13/25S (2|25|36): objs=137 size=202B /13/26S (2|25|36): objs=149 size=323B /13/27N (2|25|36): objs=618 size=2.27KiB /13/28S (2|25|36): objs=154 size=304B /13/29N (2|25|36): objs=5947 size=27.27KiB /13/30S (2|25|36): objs=143 size=163B /13/31N (2|25|36): objs=337 size=932B /13/32S (2|25|36): objs=163 size=280B /13/33N (2|25|36): objs=2932 size=14.19KiB /13/34S (2|25|36): objs=144 size=236B /13/35S (2|25|36): objs=163 size=219B /14/0N (2|25|36): objs=43593 size=1.01MiB /14/1N (2|25|36): objs=38479 size=772.79KiB /14/2N (2|25|36): objs=20999 size=267.71KiB /14/3S (2|25|36): objs=154 size=193B /14/4N (2|25|36): objs=16215 size=98.98KiB /14/5N (2|25|36): objs=11555 size=69.88KiB /14/6S (2|25|36): objs=151 size=192B /14/7N (2|25|36): objs=5800 size=27.11KiB /14/8S (2|25|36): objs=158 size=183B /14/9N (2|25|36): objs=4411 size=20.09KiB /14/10S (2|25|36): objs=151 size=99B /14/11N (2|25|36): objs=748 size=2.85KiB /14/12S (2|25|36): objs=133 size=261B /14/13S (2|25|36): objs=121 size=211B /14/14S (2|25|36): objs=134 size=162B /14/16S (2|25|36): objs=140 size=286B /14/17N (2|25|36): objs=2190 size=9.25KiB /14/18S (2|25|36): objs=147 size=336B /14/19N (2|25|36): objs=300 size=851B /14/20S (2|25|36): objs=145 size=109B /14/21N (2|25|36): objs=803 size=3.29KiB /14/22S (2|25|36): objs=176 size=287B /14/23N (2|25|36): objs=2023 size=9.05KiB /14/24S (2|25|36): objs=169 size=340B /14/26S (2|25|36): objs=154 size=309B /14/27N (2|25|36): objs=2493 size=10.5KiB /14/28S (2|25|36): objs=137 size=329B /14/29N (2|25|36): objs=1050 size=4.12KiB /14/30S (2|25|36): objs=145 size=331B /14/31N (2|25|36): objs=734 size=2.7KiB /14/32S (2|25|36): objs=143 size=108B /14/33N (2|25|36): objs=2689 size=11.47KiB /14/34S (2|25|36): objs=157 size=99B /14/35N (2|25|36): objs=271 size=914B /15/0N (2|25|36): objs=37275 size=791.07KiB /15/1N (2|25|36): objs=37338 size=763.68KiB /15/2N (2|25|36): objs=36754 size=820.84KiB /15/3S (2|25|36): objs=141 size=87B /15/4N (2|25|36): objs=646 size=2.27KiB /15/5S (2|25|36): objs=144 size=183B /15/6N (2|25|36): objs=1642 size=7.13KiB /15/8S (2|25|36): objs=176 size=115B /15/9N (2|25|36): objs=6551 size=29.53KiB /15/10S (2|25|36): objs=152 size=138B /15/11N (2|25|36): objs=577 size=2.26KiB /15/12S (2|25|36): objs=156 size=277B /15/13N (2|25|36): objs=2445 size=10.33KiB /15/14S (2|25|36): objs=146 size=318B /15/15S (2|25|36): objs=157 size=224B /15/16S (2|25|36): objs=152 size=193B /15/17N (2|25|36): objs=3231 size=14.46KiB /15/18S (2|25|36): objs=145 size=183B /15/19N (2|25|36): objs=3446 size=15.95KiB /15/20S (2|25|36): objs=151 size=274B /15/21N (2|25|36): objs=4194 size=19.18KiB /15/22S (2|25|36): objs=155 size=315B /15/23N (2|25|36): objs=3834 size=17.84KiB /15/24S (2|25|36): objs=156 size=158B /15/25N (2|25|36): objs=2704 size=12.22KiB /15/26S (2|25|36): objs=158 size=262B /15/27N (2|25|36): objs=1700 size=6.8KiB /15/28S (2|25|36): objs=162 size=128B /15/29N (2|25|36): objs=749 size=2.77KiB /15/30S (2|25|36): objs=163 size=133B /15/31N (2|25|36): objs=4367 size=20.54KiB /15/32S (2|25|36): objs=174 size=128B /15/33N (2|25|36): objs=1669 size=7.09KiB /15/34S (2|25|36): objs=149 size=299B /15/35N (2|25|36): objs=1081 size=4.25KiB /16/0N (2|25|36): objs=41967 size=926.03KiB /16/1N (2|25|36): objs=39172 size=959.83KiB /16/2N (2|25|36): objs=37194 size=742.05KiB /16/3N (2|25|36): objs=3559 size=15.28KiB /16/4S (2|25|36): objs=162 size=149B /16/5N (2|25|36): objs=1079 size=4.07KiB /16/6S (2|25|36): objs=160 size=122B /16/7N (2|25|36): objs=633 size=2.36KiB /16/8S (2|25|36): objs=153 size=263B /16/9N (2|25|36): objs=903 size=3.42KiB /16/10S (2|25|36): objs=149 size=204B /16/11N (2|25|36): objs=1270 size=5.18KiB /16/12S (2|25|36): objs=172 size=207B /16/13N (2|25|36): objs=5613 size=26.92KiB /16/14S (2|25|36): objs=152 size=303B /16/15N (2|25|36): objs=5683 size=26.22KiB /16/16S (2|25|36): objs=163 size=289B /16/17S (2|25|36): objs=156 size=111B /16/18S (2|25|36): objs=157 size=234B /16/19N (2|25|36): objs=3026 size=13.05KiB /16/20S (2|25|36): objs=162 size=226B /16/21N (2|25|36): objs=1682 size=7.2KiB /16/22S (2|25|36): objs=150 size=113B /16/23N (2|25|36): objs=2254 size=9.4KiB /16/24S (2|25|36): objs=154 size=214B /16/25N (2|25|36): objs=810 size=3.24KiB /16/26S (2|25|36): objs=150 size=282B /16/27N (2|25|36): objs=637 size=2.29KiB /16/28S (2|25|36): objs=136 size=114B /16/29N (2|25|36): objs=1642 size=7.09KiB /16/30S (2|25|36): objs=131 size=321B /16/31N (2|25|36): objs=1097 size=4.38KiB /16/32S (2|25|36): objs=167 size=279B /16/33N (2|25|36): objs=2301 size=9.43KiB /16/34S (2|25|36): objs=145 size=331B /16/35N (2|25|36): objs=1228 size=5.05KiB /17/0N (2|25|36): objs=34831 size=589.92KiB /17/1N (2|25|36): objs=41285 size=939.79KiB /17/2N (2|25|36): objs=38260 size=890.53KiB /17/3N (2|25|36): objs=7078 size=33.02KiB /17/4S (2|25|36): objs=141 size=242B /17/5N (2|25|36): objs=4094 size=17.92KiB /17/6S (2|25|36): objs=145 size=250B /17/7N (2|25|36): objs=6944 size=30.96KiB /17/8S (2|25|36): objs=141 size=318B /17/9N (2|25|36): objs=926 size=3.87KiB /17/10S (2|25|36): objs=143 size=85B /17/11N (2|25|36): objs=910 size=3.47KiB /17/12S (2|25|36): objs=164 size=219B /17/13N (2|25|36): objs=1741 size=7.06KiB /17/14S (2|25|36): objs=133 size=261B /17/15N (2|25|36): objs=789 size=2.91KiB /17/16S (2|25|36): objs=156 size=345B /17/17N (2|25|36): objs=2772 size=11.65KiB /17/18S (2|25|36): objs=149 size=143B /17/19N (2|25|36): objs=1193 size=5.38KiB /17/20S (2|25|36): objs=149 size=264B /17/21S (2|25|36): objs=163 size=280B /17/22S (2|25|36): objs=152 size=200B /17/23N (2|25|36): objs=1852 size=7.66KiB /17/24S (2|25|36): objs=145 size=247B /17/25N (2|25|36): objs=2100 size=9.18KiB /17/26S (2|25|36): objs=149 size=129B /17/27N (2|25|36): objs=1341 size=5.71KiB /17/28S (2|25|36): objs=150 size=343B /17/29N (2|25|36): objs=644 size=2.41KiB /17/30S (2|25|36): objs=154 size=330B /17/31N (2|25|36): objs=737 size=3.02KiB /17/32S (2|25|36): objs=165 size=126B /17/33N (2|25|36): objs=2312 size=9.97KiB /17/34S (2|25|36): objs=137 size=296B /17/35N (2|25|36): objs=1438 size=6.59KiB /18/0N (2|25|36): objs=41786 size=1.06MiB /18/1N (2|25|36): objs=43505 size=1.1MiB /18/2N (2|25|36): objs=35952 size=745.62KiB /18/3N (2|25|36): objs=11438 size=63.9KiB /18/4S (2|25|36): objs=148 size=240B /18/5N (2|25|36): objs=1654 size=6.66KiB /18/6S (2|25|36): objs=154 size=216B /18/7N (2|25|36): objs=590 size=2.12KiB /18/8S (2|25|36): objs=150 size=176B /18/9N (2|25|36): objs=1500 size=6.23KiB /18/10S (2|25|36): objs=169 size=315B /18/12S (2|25|36): objs=149 size=275B /18/13N (2|25|36): objs=5332 size=24.19KiB /18/14S (2|25|36): objs=145 size=112B /18/16S (2|25|36): objs=154 size=125B /18/17N (2|25|36): objs=957 size=3.99KiB /18/18S (2|25|36): objs=141 size=164B /18/19N (2|25|36): objs=1647 size=7.08KiB /18/20S (2|25|36): objs=161 size=224B /18/21N (2|25|36): objs=445 size=1.56KiB /18/22S (2|25|36): objs=147 size=234B /18/23N (2|25|36): objs=1167 size=5.03KiB /18/24S (2|25|36): objs=159 size=198B /18/25N (2|25|36): objs=2462 size=10.45KiB /18/26S (2|25|36): objs=133 size=83B /18/27N (2|25|36): objs=473 size=1.56KiB /18/28S (2|25|36): objs=164 size=190B /18/29N (2|25|36): objs=718 size=2.63KiB /18/30S (2|25|36): objs=165 size=294B /18/31N (2|25|36): objs=865 size=3.13KiB /18/32S (2|25|36): objs=176 size=177B /18/33N (2|25|36): objs=3021 size=13.48KiB /18/34S (2|25|36): objs=136 size=323B /18/35N (2|25|36): objs=925 size=3.53KiB /19/0N (2|25|36): objs=42250 size=1.04MiB /19/1N (2|25|36): objs=39467 size=870.94KiB /19/2N (2|25|36): objs=35514 size=663.13KiB /19/3S (2|25|36): objs=161 size=164B /19/4N (2|25|36): objs=310 size=819B /19/5S (2|25|36): objs=151 size=132B /19/6N (2|25|36): objs=3332 size=15.3KiB /19/7N (2|25|36): objs=2141 size=8.79KiB /19/8S (2|25|36): objs=150 size=157B /19/9N (2|25|36): objs=783 size=3.03KiB /19/10S (2|25|36): objs=143 size=215B /19/12S (2|25|36): objs=166 size=255B /19/13S (2|25|36): objs=166 size=203B /19/14S (2|25|36): objs=136 size=84B /19/15N (2|25|36): objs=470 size=1.47KiB /19/16S (2|25|36): objs=154 size=335B /19/17N (2|25|36): objs=1049 size=4.14KiB /19/18S (2|25|36): objs=189 size=95B /19/19N (2|25|36): objs=896 size=3.38KiB /19/20S (2|25|36): objs=139 size=206B /19/21N (2|25|36): objs=5457 size=28.96KiB /19/22S (2|25|36): objs=128 size=181B /19/23N (2|25|36): objs=762 size=2.99KiB /19/24S (2|25|36): objs=146 size=150B /19/25N (2|25|36): objs=2253 size=9.5KiB /19/26S (2|25|36): objs=152 size=126B /19/27N (2|25|36): objs=1752 size=7.34KiB /19/28S (2|25|36): objs=146 size=230B /19/29N (2|25|36): objs=4353 size=20.54KiB /19/30S (2|25|36): objs=166 size=338B /19/31N (2|25|36): objs=1712 size=6.74KiB /19/32S (2|25|36): objs=171 size=91B /19/33N (2|25|36): objs=6972 size=32.25KiB /19/34S (2|25|36): objs=166 size=205B /19/35N (2|25|36): objs=6243 size=29.58KiB /20/0N (2|25|36): objs=39254 size=862.54KiB /20/1N (2|25|36): objs=39619 size=832.93KiB /20/2N (2|25|36): objs=40921 size=992.1KiB /20/3S (2|25|36): objs=154 size=337B /20/4N (2|25|36): objs=2345 size=10.69KiB /20/5N (2|25|36): objs=1224 size=4.82KiB /20/6S (2|25|36): objs=138 size=94B /20/7N (2|25|36): objs=302 size=985B /20/8S (2|25|36): objs=156 size=322B /20/9N (2|25|36): objs=4661 size=21.56KiB /20/10S (2|25|36): objs=145 size=228B /20/11N (2|25|36): objs=1084 size=4.36KiB /20/12S (2|25|36): objs=159 size=290B /20/14S (2|25|36): objs=155 size=108B /20/15N (2|25|36): objs=3438 size=14.79KiB /20/16S (2|25|36): objs=153 size=330B /20/17N (2|25|36): objs=2433 size=10.47KiB /20/18S (2|25|36): objs=171 size=118B /20/19N (2|25|36): objs=5586 size=25.24KiB /20/20S (2|25|36): objs=165 size=345B /20/21N (2|25|36): objs=1063 size=4.31KiB /20/22S (2|25|36): objs=140 size=105B /20/23N (2|25|36): objs=6876 size=43.08KiB /20/24S (2|25|36): objs=142 size=102B /20/25N (2|25|36): objs=1979 size=8.25KiB /20/26S (2|25|36): objs=136 size=302B /20/27N (2|25|36): objs=1964 size=8.2KiB /20/28S (2|25|36): objs=153 size=141B /20/29N (2|25|36): objs=2483 size=10.62KiB /20/30S (2|25|36): objs=149 size=307B /20/31N (2|25|36): objs=3035 size=12.97KiB /20/32S (2|25|36): objs=136 size=279B /20/33N (2|25|36): objs=624 size=2.28KiB /20/34S (2|25|36): objs=151 size=326B /20/35N (2|25|36): objs=911 size=3.81KiB /21/0N (2|25|36): objs=42699 size=958.25KiB /21/1N (2|25|36): objs=38789 size=959.01KiB /21/2N (2|25|36): objs=40113 size=934.13KiB /21/3N (2|25|36): objs=2905 size=13.8KiB /21/4S (2|25|36): objs=149 size=94B /21/5N (2|25|36): objs=7156 size=34.92KiB /21/6S (2|25|36): objs=143 size=110B /21/7N (2|25|36): objs=813 size=2.97KiB /21/8S (2|25|36): objs=137 size=177B /21/9N (2|25|36): objs=3335 size=15.96KiB /21/10S (2|25|36): objs=124 size=296B /21/11N (2|25|36): objs=462 size=1.6KiB /21/12S (2|25|36): objs=155 size=249B /21/13N (2|25|36): objs=2434 size=12.03KiB /21/14S (2|25|36): objs=144 size=181B /21/15N (2|25|36): objs=1683 size=6.97KiB /21/16S (2|25|36): objs=151 size=84B /21/17N (2|25|36): objs=1193 size=4.82KiB /21/18S (2|25|36): objs=155 size=155B /21/19N (2|25|36): objs=443 size=1.56KiB /21/20S (2|25|36): objs=140 size=299B /21/21N (2|25|36): objs=1680 size=7KiB /21/22S (2|25|36): objs=177 size=211B /21/23N (2|25|36): objs=490 size=1.81KiB /21/24S (2|25|36): objs=157 size=329B /21/25N (2|25|36): objs=1467 size=6.03KiB /21/26S (2|25|36): objs=148 size=204B /21/27N (2|25|36): objs=2615 size=11.28KiB /21/28S (2|25|36): objs=160 size=193B /21/29N (2|25|36): objs=2184 size=9.05KiB /21/30S (2|25|36): objs=153 size=190B /21/31N (2|25|36): objs=6835 size=34.34KiB /21/32S (2|25|36): objs=147 size=244B /21/33S (2|25|36): objs=158 size=232B /21/34S (2|25|36): objs=165 size=220B /21/35N (2|25|36): objs=2956 size=12.54KiB /22/0N (2|25|36): objs=13765 size=99.42KiB /22/1S (2|25|36): objs=170 size=226B /22/2N (2|25|36): objs=27185 size=319.56KiB /22/3N (2|25|36): objs=41161 size=969.38KiB /22/4N (2|25|36): objs=42896 size=1.02MiB /22/5N (2|25|36): objs=5022 size=24.41KiB /22/6S (2|25|36): objs=169 size=351B /22/8S (2|25|36): objs=150 size=329B /22/9N (2|25|36): objs=4477 size=22.14KiB /22/10S (2|25|36): objs=164 size=205B /22/11N (2|25|36): objs=296 size=712B /22/12S (2|25|36): objs=156 size=167B /22/13N (2|25|36): objs=2443 size=10.35KiB /22/14S (2|25|36): objs=158 size=280B /22/15N (2|25|36): objs=4538 size=21.39KiB /22/16S (2|25|36): objs=152 size=262B /22/17N (2|25|36): objs=2534 size=11.02KiB /22/18S (2|25|36): objs=127 size=106B /22/20S (2|25|36): objs=146 size=212B /22/21N (2|25|36): objs=4835 size=21.62KiB /22/22S (2|25|36): objs=153 size=234B /22/23N (2|25|36): objs=1590 size=6.42KiB /22/24S (2|25|36): objs=138 size=127B /22/25N (2|25|36): objs=1050 size=4.13KiB /22/26S (2|25|36): objs=161 size=350B /22/27N (2|25|36): objs=310 size=983B /22/28S (2|25|36): objs=143 size=242B /22/29N (2|25|36): objs=335 size=1.01KiB /22/30S (2|25|36): objs=154 size=292B /22/31N (2|25|36): objs=2015 size=8.28KiB /22/32S (2|25|36): objs=154 size=95B /22/33N (2|25|36): objs=3015 size=12.83KiB /22/34S (2|25|36): objs=191 size=329B /22/35N (2|25|36): objs=792 size=3.03KiB /23/0N (2|25|36): objs=44679 size=1.01MiB /23/1N (2|25|36): objs=38360 size=829.34KiB /23/2N (2|25|36): objs=37072 size=627.77KiB /23/3N (2|25|36): objs=5188 size=25.34KiB /23/4S (2|25|36): objs=159 size=222B /23/5N (2|25|36): objs=321 size=923B /23/6S (2|25|36): objs=141 size=98B /23/7S (2|25|36): objs=145 size=248B /23/8S (2|25|36): objs=178 size=116B /23/9N (2|25|36): objs=2898 size=12.17KiB /23/10S (2|25|36): objs=148 size=102B /23/11N (2|25|36): objs=1075 size=4.23KiB /23/12S (2|25|36): objs=152 size=234B /23/13N (2|25|36): objs=3287 size=14.76KiB /23/14S (2|25|36): objs=143 size=95B /23/15N (2|25|36): objs=1809 size=7.35KiB /23/16S (2|25|36): objs=161 size=320B /23/17N (2|25|36): objs=283 size=763B /23/18S (2|25|36): objs=149 size=338B /23/20S (2|25|36): objs=165 size=147B /23/21N (2|25|36): objs=3822 size=16.17KiB /23/22S (2|25|36): objs=170 size=96B /23/23N (2|25|36): objs=473 size=1.63KiB /23/24S (2|25|36): objs=134 size=143B /23/25N (2|25|36): objs=1139 size=4.52KiB /23/26S (2|25|36): objs=148 size=274B /23/28S (2|25|36): objs=145 size=179B /23/29N (2|25|36): objs=5034 size=21.51KiB /23/30S (2|25|36): objs=147 size=133B /23/31N (2|25|36): objs=4865 size=21.98KiB /23/32S (2|25|36): objs=178 size=188B /23/33N (2|25|36): objs=3878 size=19.48KiB /23/34S (2|25|36): objs=146 size=247B /23/35N (2|25|36): objs=291 size=778B /24/0N (2|25|36): objs=37549 size=788.15KiB /24/1N (2|25|36): objs=38051 size=806.01KiB /24/2N (2|25|36): objs=33411 size=700.86KiB /24/3S (2|25|36): objs=149 size=253B /24/4N (2|25|36): objs=7529 size=36.77KiB /24/5N (2|25|36): objs=8122 size=42.19KiB /24/6S (2|25|36): objs=147 size=277B /24/7S (2|25|36): objs=156 size=143B /24/8S (2|25|36): objs=156 size=129B /24/9N (2|25|36): objs=1675 size=7.07KiB /24/10S (2|25|36): objs=148 size=231B /24/12S (2|25|36): objs=156 size=342B /24/13N (2|25|36): objs=588 size=2.06KiB /24/14S (2|25|36): objs=162 size=135B /24/15N (2|25|36): objs=7197 size=33.51KiB /24/16S (2|25|36): objs=163 size=255B /24/17N (2|25|36): objs=920 size=3.76KiB /24/18S (2|25|36): objs=166 size=141B /24/19S (2|25|36): objs=151 size=322B /24/20S (2|25|36): objs=159 size=225B /24/21N (2|25|36): objs=3406 size=15.42KiB /24/22S (2|25|36): objs=159 size=196B /24/23N (2|25|36): objs=4373 size=18.92KiB /24/24S (2|25|36): objs=163 size=98B /24/25N (2|25|36): objs=1657 size=6.98KiB /24/26S (2|25|36): objs=164 size=219B /24/27N (2|25|36): objs=1075 size=4.32KiB /24/28S (2|25|36): objs=149 size=108B /24/29N (2|25|36): objs=2514 size=10.73KiB /24/30S (2|25|36): objs=158 size=177B /24/32S (2|25|36): objs=156 size=128B /24/33N (2|25|36): objs=781 size=2.72KiB /24/34S (2|25|36): objs=150 size=264B /24/35N (2|25|36): objs=1467 size=6.11KiB /25/0N (2|25|36): objs=37303 size=769.94KiB /25/1N (2|25|36): objs=41345 size=996.06KiB /25/2N (2|25|36): objs=38531 size=780.92KiB /25/3N (2|25|36): objs=15971 size=112.22KiB /25/4S (2|25|36): objs=146 size=320B /25/5N (2|25|36): objs=1336 size=5.56KiB /25/6S (2|25|36): objs=155 size=93B /25/7N (2|25|36): objs=294 size=910B /25/8S (2|25|36): objs=167 size=107B /25/9N (2|25|36): objs=780 size=2.92KiB /25/10S (2|25|36): objs=138 size=278B /25/12S (2|25|36): objs=166 size=265B /25/13N (2|25|36): objs=4530 size=20.25KiB /25/14S (2|25|36): objs=151 size=125B /25/15N (2|25|36): objs=2574 size=10.77KiB /25/16S (2|25|36): objs=161 size=211B /25/17N (2|25|36): objs=1652 size=6.67KiB /25/18S (2|25|36): objs=140 size=278B /25/19N (2|25|36): objs=310 size=1.04KiB /25/20S (2|25|36): objs=140 size=330B /25/21N (2|25|36): objs=1614 size=6.84KiB /25/22S (2|25|36): objs=154 size=132B /25/23N (2|25|36): objs=593 size=2.21KiB /25/24S (2|25|36): objs=147 size=154B /25/25N (2|25|36): objs=1090 size=4.06KiB /25/26S (2|25|36): objs=168 size=294B /25/27N (2|25|36): objs=2275 size=9.66KiB /25/28S (2|25|36): objs=167 size=91B /25/29S (2|25|36): objs=153 size=201B /25/30S (2|25|36): objs=146 size=316B /25/32S (2|25|36): objs=134 size=258B /25/33N (2|25|36): objs=3336 size=15.42KiB /25/34S (2|25|36): objs=152 size=179B /25/35N (2|25|36): objs=750 size=2.72KiB /26/0N (2|25|36): objs=37022 size=761.43KiB /26/1N (2|25|36): objs=42236 size=1.03MiB /26/2N (2|25|36): objs=40201 size=848.04KiB /26/3S (2|25|36): objs=156 size=193B /26/4N (2|25|36): objs=470 size=1.64KiB /26/5N (2|25|36): objs=944 size=3.6KiB /26/6S (2|25|36): objs=131 size=183B /26/7N (2|25|36): objs=4539 size=20.18KiB /26/8S (2|25|36): objs=138 size=309B /26/9N (2|25|36): objs=2032 size=8.29KiB /26/10S (2|25|36): objs=166 size=269B /26/11N (2|25|36): objs=1487 size=6.31KiB /26/12S (2|25|36): objs=135 size=231B /26/13N (2|25|36): objs=1889 size=7.89KiB /26/14S (2|25|36): objs=153 size=199B /26/15N (2|25|36): objs=3804 size=16.8KiB /26/16S (2|25|36): objs=156 size=165B /26/17N (2|25|36): objs=3329 size=14.34KiB /26/18S (2|25|36): objs=159 size=217B /26/19N (2|25|36): objs=856 size=3.38KiB /26/20S (2|25|36): objs=156 size=264B /26/21N (2|25|36): objs=1063 size=4.04KiB /26/22S (2|25|36): objs=129 size=100B /26/23N (2|25|36): objs=1051 size=4.21KiB /26/24S (2|25|36): objs=146 size=263B /26/25N (2|25|36): objs=1219 size=4.81KiB /26/26S (2|25|36): objs=167 size=306B /26/27N (2|25|36): objs=8919 size=46.1KiB /26/28S (2|25|36): objs=186 size=296B /26/29N (2|25|36): objs=1391 size=5.67KiB /26/30S (2|25|36): objs=133 size=270B /26/31N (2|25|36): objs=745 size=2.88KiB /26/32S (2|25|36): objs=142 size=231B /26/33N (2|25|36): objs=3990 size=18.42KiB /26/34S (2|25|36): objs=163 size=327B /26/35N (2|25|36): objs=607 size=2.23KiB /27/0N (2|25|36): objs=39530 size=1.01MiB /27/1N (2|25|36): objs=35263 size=741.62KiB /27/2N (2|25|36): objs=33664 size=627.94KiB /27/3S (2|25|36): objs=159 size=126B /27/4N (2|25|36): objs=472 size=1.76KiB /27/5S (2|25|36): objs=133 size=216B /27/6N (2|25|36): objs=3630 size=16.79KiB /27/7N (2|25|36): objs=3405 size=15.22KiB /27/8S (2|25|36): objs=172 size=345B /27/9N (2|25|36): objs=1876 size=7.8KiB /27/10S (2|25|36): objs=155 size=337B /27/11N (2|25|36): objs=2690 size=11.98KiB /27/12S (2|25|36): objs=171 size=110B /27/13N (2|25|36): objs=2010 size=8.5KiB /27/14S (2|25|36): objs=124 size=117B /27/15N (2|25|36): objs=6253 size=29.07KiB /27/16S (2|25|36): objs=154 size=269B /27/17N (2|25|36): objs=578 size=2.08KiB /27/18S (2|25|36): objs=155 size=197B /27/19N (2|25|36): objs=1494 size=6.25KiB /27/20S (2|25|36): objs=154 size=92B /27/21N (2|25|36): objs=5643 size=28.51KiB /27/22S (2|25|36): objs=144 size=298B /27/23N (2|25|36): objs=2732 size=11.69KiB /27/24S (2|25|36): objs=154 size=317B /27/25N (2|25|36): objs=1142 size=4.64KiB /27/26S (2|25|36): objs=154 size=202B /27/27N (2|25|36): objs=1821 size=7.45KiB /27/28S (2|25|36): objs=158 size=218B /27/29N (2|25|36): objs=477 size=1.53KiB /27/30S (2|25|36): objs=161 size=90B /27/31N (2|25|36): objs=2446 size=10.46KiB /27/32S (2|25|36): objs=147 size=94B /27/33N (2|25|36): objs=1112 size=4.53KiB /27/34S (2|25|36): objs=150 size=338B /27/35N (2|25|36): objs=4627 size=21.06KiB /28/0N (2|25|36): objs=38823 size=824.06KiB /28/1N (2|25|36): objs=41143 size=982.32KiB /28/2N (2|25|36): objs=35925 size=737.78KiB /28/3N (2|25|36): objs=16377 size=111.98KiB /28/4S (2|25|36): objs=153 size=334B /28/5S (2|25|36): objs=145 size=99B /28/6S (2|25|36): objs=156 size=320B /28/7N (2|25|36): objs=1430 size=5.47KiB /28/8S (2|25|36): objs=162 size=237B /28/9N (2|25|36): objs=622 size=2.23KiB /28/10S (2|25|36): objs=135 size=138B /28/11N (2|25|36): objs=1226 size=5.06KiB /28/12S (2|25|36): objs=149 size=339B /28/13N (2|25|36): objs=1428 size=5.83KiB /28/14S (2|25|36): objs=176 size=355B /28/15N (2|25|36): objs=1448 size=6.05KiB /28/16S (2|25|36): objs=138 size=300B /28/17N (2|25|36): objs=603 size=2.25KiB /28/18S (2|25|36): objs=138 size=158B /28/19N (2|25|36): objs=574 size=1.97KiB /28/20S (2|25|36): objs=151 size=94B /28/21N (2|25|36): objs=906 size=3.54KiB /28/22S (2|25|36): objs=176 size=240B /28/23N (2|25|36): objs=579 size=2KiB /28/24S (2|25|36): objs=158 size=209B /28/25N (2|25|36): objs=3320 size=14.73KiB /28/26S (2|25|36): objs=141 size=125B /28/27N (2|25|36): objs=1388 size=5.76KiB /28/28S (2|25|36): objs=165 size=100B /28/29N (2|25|36): objs=4364 size=19.38KiB /28/30S (2|25|36): objs=164 size=128B /28/31N (2|25|36): objs=1444 size=5.98KiB /28/32S (2|25|36): objs=173 size=137B /28/33N (2|25|36): objs=2485 size=11.36KiB /28/34S (2|25|36): objs=156 size=121B /28/35N (2|25|36): objs=464 size=1.44KiB /29/0N (2|25|36): objs=42051 size=1.08MiB /29/1N (2|25|36): objs=34950 size=653.31KiB /29/2N (2|25|36): objs=39213 size=850.74KiB /29/3N (2|25|36): objs=6378 size=31.97KiB /29/4S (2|25|36): objs=167 size=234B /29/5S (2|25|36): objs=182 size=202B /29/6S (2|25|36): objs=144 size=116B /29/7N (2|25|36): objs=3086 size=14.28KiB /29/8S (2|25|36): objs=148 size=286B /29/9N (2|25|36): objs=3061 size=12.84KiB /29/10S (2|25|36): objs=142 size=122B /29/11N (2|25|36): objs=6755 size=30.57KiB /29/12S (2|25|36): objs=163 size=182B /29/13N (2|25|36): objs=1939 size=8.01KiB /29/14S (2|25|36): objs=165 size=330B /29/15N (2|25|36): objs=937 size=3.73KiB /29/16S (2|25|36): objs=155 size=312B /29/17N (2|25|36): objs=1844 size=7.61KiB /29/18S (2|25|36): objs=147 size=233B /29/20S (2|25|36): objs=142 size=151B /29/22S (2|25|36): objs=151 size=220B /29/23N (2|25|36): objs=1483 size=6.47KiB /29/24S (2|25|36): objs=168 size=190B /29/25N (2|25|36): objs=1212 size=4.62KiB /29/26S (2|25|36): objs=154 size=277B /29/27N (2|25|36): objs=4717 size=20.66KiB /29/28S (2|25|36): objs=166 size=159B /29/29S (2|25|36): objs=150 size=258B /29/30S (2|25|36): objs=148 size=285B /29/31N (2|25|36): objs=773 size=2.85KiB /29/32S (2|25|36): objs=133 size=262B /29/33N (2|25|36): objs=1550 size=6.6KiB /29/34S (2|25|36): objs=142 size=316B /30/0N (2|25|36): objs=40324 size=934.07KiB /30/1N (2|25|36): objs=41033 size=932.5KiB /30/2N (2|25|36): objs=27568 size=331.68KiB /30/3S (2|25|36): objs=161 size=106B /30/4N (2|25|36): objs=12255 size=73.49KiB /30/5N (2|25|36): objs=3332 size=15.05KiB /30/6S (2|25|36): objs=152 size=109B /30/7N (2|25|36): objs=8011 size=37.58KiB /30/8S (2|25|36): objs=158 size=141B /30/9N (2|25|36): objs=639 size=2.44KiB /30/10S (2|25|36): objs=145 size=222B /30/11N (2|25|36): objs=578 size=2.23KiB /30/12S (2|25|36): objs=154 size=237B /30/13N (2|25|36): objs=6012 size=30.48KiB /30/14S (2|25|36): objs=124 size=181B /30/15N (2|25|36): objs=755 size=2.83KiB /30/16S (2|25|36): objs=154 size=229B /30/18S (2|25|36): objs=152 size=135B /30/19N (2|25|36): objs=7213 size=34.73KiB /30/20S (2|25|36): objs=144 size=266B /30/21N (2|25|36): objs=456 size=1.44KiB /30/22S (2|25|36): objs=173 size=93B /30/23N (2|25|36): objs=1013 size=4.11KiB /30/24S (2|25|36): objs=160 size=177B /30/25N (2|25|36): objs=3326 size=15.12KiB /30/26S (2|25|36): objs=168 size=237B /30/27N (2|25|36): objs=284 size=792B /30/28S (2|25|36): objs=150 size=286B /30/29N (2|25|36): objs=1034 size=4.12KiB /30/30S (2|25|36): objs=169 size=99B /30/31N (2|25|36): objs=1619 size=6.79KiB /30/32S (2|25|36): objs=147 size=195B /30/33S (2|25|36): objs=148 size=226B /30/34S (2|25|36): objs=148 size=136B /30/35N (2|25|36): objs=3902 size=16.97KiB /31/0N (2|25|36): objs=37858 size=728.3KiB /31/1N (2|25|36): objs=40873 size=808.11KiB /31/2N (2|25|36): objs=39136 size=942.81KiB /31/3N (2|25|36): objs=3852 size=17.29KiB /31/4S (2|25|36): objs=171 size=172B /31/5N (2|25|36): objs=3686 size=16.11KiB /31/6S (2|25|36): objs=150 size=190B /31/7N (2|25|36): objs=626 size=2.25KiB /31/8S (2|25|36): objs=156 size=179B /31/9S (2|25|36): objs=175 size=285B /31/10S (2|25|36): objs=154 size=316B /31/11N (2|25|36): objs=1347 size=5.46KiB /31/12S (2|25|36): objs=137 size=285B /31/13N (2|25|36): objs=2873 size=12.45KiB /31/14S (2|25|36): objs=158 size=228B /31/16S (2|25|36): objs=156 size=237B /31/17N (2|25|36): objs=970 size=3.82KiB /31/18S (2|25|36): objs=156 size=293B /31/19N (2|25|36): objs=2464 size=10.39KiB /31/20S (2|25|36): objs=144 size=242B /31/21N (2|25|36): objs=1690 size=7.04KiB /31/22S (2|25|36): objs=161 size=173B /31/23N (2|25|36): objs=5969 size=30.08KiB /31/24S (2|25|36): objs=130 size=319B /31/25N (2|25|36): objs=2580 size=10.68KiB /31/26S (2|25|36): objs=150 size=249B /31/27N (2|25|36): objs=293 size=891B /31/28S (2|25|36): objs=144 size=164B /31/29N (2|25|36): objs=864 size=3.39KiB /31/30S (2|25|36): objs=144 size=112B /31/31N (2|25|36): objs=5713 size=28.28KiB /31/32S (2|25|36): objs=159 size=336B /31/33N (2|25|36): objs=1406 size=5.93KiB /31/34S (2|25|36): objs=167 size=240B /31/35N (2|25|36): objs=3754 size=17.78KiB com.milaboratory.util.sorting.HashSorterTest > test2 SKIPPED com.milaboratory.util.sorting.SortingUtilTest > test1 STANDARD_OUT Collation: 566.71ms Sorting: 232.64ms 1 217 41457 99541 99998 com.milaboratory.util.AtomicEnumHistogramTest > test1 STANDARD_OUT {"labels":["A","B","C","null"],"hist":[1,2,0,1]} com.milaboratory.util.VersionInfoTest > test3 SKIPPED com.milaboratory.util.ByteStringTest > testSpeed1 STANDARD_OUT Time per hash: 518ns Addition to hash set (per operation): 1.2us Hash set removal (per operation): 549ns b com.milaboratory.util.CacheTest > test1 STANDARD_OUT Cache misses:400 Cache hits:800 com.milaboratory.util.IntCombinationsTest > test1 STANDARD_OUT [0, 1] [0, 2] [1, 2] com.milaboratory.util.RemoveActionTest > test1 STANDARD_OUT /tmp/milib_501dbd34ad07fedd21ff2a6bac6c0d3d688e748917046778436138472044 com.milaboratory.util.RemoveActionTest > test2 STANDARD_OUT /tmp/milib_f179f6332af7e765dc5275bcab5bca844291fe5a17498799260265647594.tmp com.milaboratory.util.NSequenceWithQualityPrintHelperTest > test1 SKIPPED com.milaboratory.util.JsonOverriderTest > test1 STANDARD_OUT WARNING: unnecessary override -Ob= with the same value. Gradle is still running, please be patient... WARNING: A terminally deprecated method in java.lang.System has been called WARNING: System::setSecurityManager has been called by org.gradle.api.internal.tasks.testing.worker.TestWorker (file:/usr/share/gradle/lib/plugins/gradle-testing-base-4.4.1.jar) WARNING: Please consider reporting this to the maintainers of org.gradle.api.internal.tasks.testing.worker.TestWorker WARNING: System::setSecurityManager will be removed in a future release Gradle Test Executor 1 finished executing tests. Finished generating test XML results (0.987 secs) into: /build/milib-2.2.0+dfsg/build/test-results/test Generating HTML test report... Finished generating test html results (1.317 secs) into: /build/milib-2.2.0+dfsg/build/reports/tests/test :test (Thread[Task worker for ':',5,main]) completed. Took 9 mins 28.318 secs. BUILD SUCCESSFUL in 10m 21s 5 actionable tasks: 3 executed, 2 up-to-date create-stamp debian/debhelper-build-stamp dh_prep dh_auto_install --destdir=debian/libmilib-java/ mh_install jh_installjavadoc dh_installdocs dh_installchangelogs dh_perl dh_link jh_installlibs jh_classpath jh_manifest jh_depends dh_strip_nondeterminism dh_compress dh_fixperms dh_missing dh_installdeb dh_gencontrol dh_md5sums dh_builddeb dpkg-deb: building package 'libmilib-java' in '../libmilib-java_2.2.0+dfsg-1_all.deb'. dpkg-genbuildinfo --build=binary -O../milib_2.2.0+dfsg-1_i386.buildinfo dpkg-genchanges --build=binary -O../milib_2.2.0+dfsg-1_i386.changes dpkg-genchanges: info: binary-only upload (no source code included) dpkg-source --after-build . dpkg-buildpackage: info: binary-only upload (no source included) dpkg-genchanges: info: including full source code in upload I: copying local configuration I: unmounting dev/ptmx filesystem I: unmounting dev/pts filesystem I: unmounting dev/shm filesystem I: unmounting proc filesystem I: unmounting sys filesystem I: cleaning the build env I: removing directory /srv/workspace/pbuilder/960 and its subdirectories I: Current time: Wed May 10 11:26:33 -12 2023 I: pbuilder-time-stamp: 1683761193