Diff of the two buildlogs: -- --- b1/build.log 2024-02-09 17:30:30.802845723 +0000 +++ b2/build.log 2024-02-09 18:31:03.389940716 +0000 @@ -1,6 +1,6 @@ I: pbuilder: network access will be disabled during build -I: Current time: Fri Feb 9 04:55:35 -12 2024 -I: pbuilder-time-stamp: 1707497735 +I: Current time: Sat Feb 10 07:30:47 +14 2024 +I: pbuilder-time-stamp: 1707499847 I: Building the build Environment I: extracting base tarball [/var/cache/pbuilder/bookworm-reproducible-base.tgz] I: copying local configuration @@ -16,7 +16,7 @@ I: copying [./milib_2.2.0+dfsg.orig.tar.xz] I: copying [./milib_2.2.0+dfsg-1.debian.tar.xz] I: Extracting source -gpgv: Signature made Fri Dec 30 02:08:01 2022 -12 +gpgv: Signature made Sat Dec 31 04:08:01 2022 +14 gpgv: using RSA key 33CB284313E90BD27DCB4523600316A6DC277476 gpgv: Can't check signature: No public key dpkg-source: warning: cannot verify inline signature for ./milib_2.2.0+dfsg-1.dsc: no acceptable signature found @@ -30,135 +30,167 @@ dpkg-source: info: applying flaky_test.patch I: Not using root during the build. I: Installing the build-deps -I: user script /srv/workspace/pbuilder/10537/tmp/hooks/D02_print_environment starting +I: user script /srv/workspace/pbuilder/28295/tmp/hooks/D01_modify_environment starting +debug: Running on cbxi4b. +I: Changing host+domainname to test build reproducibility +I: Adding a custom variable just for the fun of it... +I: Changing /bin/sh to bash +'/bin/sh' -> '/bin/bash' +lrwxrwxrwx 1 root root 9 Feb 10 07:31 /bin/sh -> /bin/bash +I: Setting pbuilder2's login shell to /bin/bash +I: Setting pbuilder2's GECOS to second user,second room,second work-phone,second home-phone,second other +I: user script /srv/workspace/pbuilder/28295/tmp/hooks/D01_modify_environment finished +I: user script /srv/workspace/pbuilder/28295/tmp/hooks/D02_print_environment starting I: set - BUILDDIR='/build/reproducible-path' - BUILDUSERGECOS='first user,first room,first work-phone,first home-phone,first other' - BUILDUSERNAME='pbuilder1' - BUILD_ARCH='armhf' - DEBIAN_FRONTEND='noninteractive' - DEB_BUILD_OPTIONS='buildinfo=+all reproducible=+all parallel=3 ' - DISTRIBUTION='bookworm' - HOME='/root' - HOST_ARCH='armhf' + BASH=/bin/sh + BASHOPTS=checkwinsize:cmdhist:complete_fullquote:extquote:force_fignore:globasciiranges:globskipdots:hostcomplete:interactive_comments:patsub_replacement:progcomp:promptvars:sourcepath + BASH_ALIASES=() + BASH_ARGC=() + BASH_ARGV=() + BASH_CMDS=() + BASH_LINENO=([0]="12" [1]="0") + BASH_LOADABLES_PATH=/usr/local/lib/bash:/usr/lib/bash:/opt/local/lib/bash:/usr/pkg/lib/bash:/opt/pkg/lib/bash:. + BASH_SOURCE=([0]="/tmp/hooks/D02_print_environment" [1]="/tmp/hooks/D02_print_environment") + BASH_VERSINFO=([0]="5" [1]="2" [2]="15" [3]="1" [4]="release" [5]="arm-unknown-linux-gnueabihf") + BASH_VERSION='5.2.15(1)-release' + BUILDDIR=/build/reproducible-path + BUILDUSERGECOS='second user,second room,second work-phone,second home-phone,second other' + BUILDUSERNAME=pbuilder2 + BUILD_ARCH=armhf + DEBIAN_FRONTEND=noninteractive + DEB_BUILD_OPTIONS='buildinfo=+all reproducible=+all parallel=4 ' + DIRSTACK=() + DISTRIBUTION=bookworm + EUID=0 + FUNCNAME=([0]="Echo" [1]="main") + GROUPS=() + HOME=/root + HOSTNAME=i-capture-the-hostname + HOSTTYPE=arm + HOST_ARCH=armhf IFS=' ' - INVOCATION_ID='340a6a52256546fe800640f5eceb04be' - LANG='C' - LANGUAGE='en_US:en' - LC_ALL='C' - MAIL='/var/mail/root' - OPTIND='1' - PATH='/usr/sbin:/usr/bin:/sbin:/bin:/usr/games' - PBCURRENTCOMMANDLINEOPERATION='build' - PBUILDER_OPERATION='build' - PBUILDER_PKGDATADIR='/usr/share/pbuilder' - PBUILDER_PKGLIBDIR='/usr/lib/pbuilder' - PBUILDER_SYSCONFDIR='/etc' - PPID='10537' - PS1='# ' - PS2='> ' + INVOCATION_ID=1d3dd9102ea04150b886a99cfd666e22 + LANG=C + LANGUAGE=it_CH:it + LC_ALL=C + MACHTYPE=arm-unknown-linux-gnueabihf + MAIL=/var/mail/root + OPTERR=1 + OPTIND=1 + OSTYPE=linux-gnueabihf + PATH=/usr/sbin:/usr/bin:/sbin:/bin:/usr/games:/i/capture/the/path + PBCURRENTCOMMANDLINEOPERATION=build + PBUILDER_OPERATION=build + PBUILDER_PKGDATADIR=/usr/share/pbuilder + PBUILDER_PKGLIBDIR=/usr/lib/pbuilder + PBUILDER_SYSCONFDIR=/etc + PIPESTATUS=([0]="0") + POSIXLY_CORRECT=y + PPID=28295 PS4='+ ' - PWD='/' - SHELL='/bin/bash' - SHLVL='2' - SUDO_COMMAND='/usr/bin/timeout -k 18.1h 18h /usr/bin/ionice -c 3 /usr/bin/nice /usr/sbin/pbuilder --build --configfile /srv/reproducible-results/rbuild-debian/r-b-build.2Tb7xQys/pbuilderrc_m5Vi --distribution bookworm --hookdir /etc/pbuilder/first-build-hooks --debbuildopts -b --basetgz /var/cache/pbuilder/bookworm-reproducible-base.tgz --buildresult /srv/reproducible-results/rbuild-debian/r-b-build.2Tb7xQys/b1 --logfile b1/build.log milib_2.2.0+dfsg-1.dsc' - SUDO_GID='114' - SUDO_UID='108' - SUDO_USER='jenkins' - TERM='unknown' - TZ='/usr/share/zoneinfo/Etc/GMT+12' - USER='root' - _='/usr/bin/systemd-run' - http_proxy='http://10.0.0.15:3142/' + PWD=/ + SHELL=/bin/bash + SHELLOPTS=braceexpand:errexit:hashall:interactive-comments:posix + SHLVL=3 + SUDO_COMMAND='/usr/bin/timeout -k 24.1h 24h /usr/bin/ionice -c 3 /usr/bin/nice -n 11 /usr/bin/unshare --uts -- /usr/sbin/pbuilder --build --configfile /srv/reproducible-results/rbuild-debian/r-b-build.2Tb7xQys/pbuilderrc_FPwt --distribution bookworm --hookdir /etc/pbuilder/rebuild-hooks --debbuildopts -b --basetgz /var/cache/pbuilder/bookworm-reproducible-base.tgz --buildresult /srv/reproducible-results/rbuild-debian/r-b-build.2Tb7xQys/b2 --logfile b2/build.log milib_2.2.0+dfsg-1.dsc' + SUDO_GID=116 + SUDO_UID=112 + SUDO_USER=jenkins + TERM=unknown + TZ=/usr/share/zoneinfo/Etc/GMT-14 + UID=0 + USER=root + _='I: set' + http_proxy=http://10.0.0.15:3142/ I: uname -a - Linux virt64a 6.1.0-17-arm64 #1 SMP Debian 6.1.69-1 (2023-12-30) aarch64 GNU/Linux + Linux i-capture-the-hostname 6.1.0-17-armmp #1 SMP Debian 6.1.69-1 (2023-12-30) armv7l GNU/Linux I: ls -l /bin total 4964 - -rwxr-xr-x 1 root root 838488 Apr 23 2023 bash - -rwxr-xr-x 3 root root 67144 Sep 18 2022 bunzip2 - -rwxr-xr-x 3 root root 67144 Sep 18 2022 bzcat - lrwxrwxrwx 1 root root 6 Sep 18 2022 bzcmp -> bzdiff - -rwxr-xr-x 1 root root 2225 Sep 18 2022 bzdiff - lrwxrwxrwx 1 root root 6 Sep 18 2022 bzegrep -> bzgrep - -rwxr-xr-x 1 root root 4893 Nov 27 2021 bzexe - lrwxrwxrwx 1 root root 6 Sep 18 2022 bzfgrep -> bzgrep - -rwxr-xr-x 1 root root 3775 Sep 18 2022 bzgrep - -rwxr-xr-x 3 root root 67144 Sep 18 2022 bzip2 - -rwxr-xr-x 1 root root 67112 Sep 18 2022 bzip2recover - lrwxrwxrwx 1 root root 6 Sep 18 2022 bzless -> bzmore - -rwxr-xr-x 1 root root 1297 Sep 18 2022 bzmore - -rwxr-xr-x 1 root root 67632 Sep 20 2022 cat - -rwxr-xr-x 1 root root 67676 Sep 20 2022 chgrp - -rwxr-xr-x 1 root root 67644 Sep 20 2022 chmod - -rwxr-xr-x 1 root root 67684 Sep 20 2022 chown - -rwxr-xr-x 1 root root 133532 Sep 20 2022 cp - -rwxr-xr-x 1 root root 132868 Jan 5 2023 dash - -rwxr-xr-x 1 root root 133220 Sep 20 2022 date - -rwxr-xr-x 1 root root 67732 Sep 20 2022 dd - -rwxr-xr-x 1 root root 68104 Sep 20 2022 df - -rwxr-xr-x 1 root root 133632 Sep 20 2022 dir - -rwxr-xr-x 1 root root 59128 Mar 22 2023 dmesg - lrwxrwxrwx 1 root root 8 Dec 19 2022 dnsdomainname -> hostname - lrwxrwxrwx 1 root root 8 Dec 19 2022 domainname -> hostname - -rwxr-xr-x 1 root root 67560 Sep 20 2022 echo - -rwxr-xr-x 1 root root 41 Jan 24 2023 egrep - -rwxr-xr-x 1 root root 67548 Sep 20 2022 false - -rwxr-xr-x 1 root root 41 Jan 24 2023 fgrep - -rwxr-xr-x 1 root root 55748 Mar 22 2023 findmnt - -rwsr-xr-x 1 root root 26208 Mar 22 2023 fusermount - -rwxr-xr-x 1 root root 128608 Jan 24 2023 grep - -rwxr-xr-x 2 root root 2346 Apr 9 2022 gunzip - -rwxr-xr-x 1 root root 6447 Apr 9 2022 gzexe - -rwxr-xr-x 1 root root 64220 Apr 9 2022 gzip - -rwxr-xr-x 1 root root 67032 Dec 19 2022 hostname - -rwxr-xr-x 1 root root 67720 Sep 20 2022 ln - -rwxr-xr-x 1 root root 35132 Mar 22 2023 login - -rwxr-xr-x 1 root root 133632 Sep 20 2022 ls - -rwxr-xr-x 1 root root 136808 Mar 22 2023 lsblk - -rwxr-xr-x 1 root root 67800 Sep 20 2022 mkdir - -rwxr-xr-x 1 root root 67764 Sep 20 2022 mknod - -rwxr-xr-x 1 root root 67596 Sep 20 2022 mktemp - -rwxr-xr-x 1 root root 38504 Mar 22 2023 more - -rwsr-xr-x 1 root root 38496 Mar 22 2023 mount - -rwxr-xr-x 1 root root 9824 Mar 22 2023 mountpoint - -rwxr-xr-x 1 root root 133532 Sep 20 2022 mv - lrwxrwxrwx 1 root root 8 Dec 19 2022 nisdomainname -> hostname - lrwxrwxrwx 1 root root 14 Apr 2 2023 pidof -> /sbin/killall5 - -rwxr-xr-x 1 root root 67608 Sep 20 2022 pwd - lrwxrwxrwx 1 root root 4 Apr 23 2023 rbash -> bash - -rwxr-xr-x 1 root root 67600 Sep 20 2022 readlink - -rwxr-xr-x 1 root root 67672 Sep 20 2022 rm - -rwxr-xr-x 1 root root 67600 Sep 20 2022 rmdir - -rwxr-xr-x 1 root root 14152 Jul 28 2023 run-parts - -rwxr-xr-x 1 root root 133372 Jan 5 2023 sed - lrwxrwxrwx 1 root root 4 Jan 5 2023 sh -> dash - -rwxr-xr-x 1 root root 67584 Sep 20 2022 sleep - -rwxr-xr-x 1 root root 67644 Sep 20 2022 stty - -rwsr-xr-x 1 root root 50800 Mar 22 2023 su - -rwxr-xr-x 1 root root 67584 Sep 20 2022 sync - -rwxr-xr-x 1 root root 336764 Apr 6 2023 tar - -rwxr-xr-x 1 root root 9800 Jul 28 2023 tempfile - -rwxr-xr-x 1 root root 133224 Sep 20 2022 touch - -rwxr-xr-x 1 root root 67548 Sep 20 2022 true - -rwxr-xr-x 1 root root 9768 Mar 22 2023 ulockmgr_server - -rwsr-xr-x 1 root root 22108 Mar 22 2023 umount - -rwxr-xr-x 1 root root 67572 Sep 20 2022 uname - -rwxr-xr-x 2 root root 2346 Apr 9 2022 uncompress - -rwxr-xr-x 1 root root 133632 Sep 20 2022 vdir - -rwxr-xr-x 1 root root 42608 Mar 22 2023 wdctl - lrwxrwxrwx 1 root root 8 Dec 19 2022 ypdomainname -> hostname - -rwxr-xr-x 1 root root 1984 Apr 9 2022 zcat - -rwxr-xr-x 1 root root 1678 Apr 9 2022 zcmp - -rwxr-xr-x 1 root root 6460 Apr 9 2022 zdiff - -rwxr-xr-x 1 root root 29 Apr 9 2022 zegrep - -rwxr-xr-x 1 root root 29 Apr 9 2022 zfgrep - -rwxr-xr-x 1 root root 2081 Apr 9 2022 zforce - -rwxr-xr-x 1 root root 8103 Apr 9 2022 zgrep - -rwxr-xr-x 1 root root 2206 Apr 9 2022 zless - -rwxr-xr-x 1 root root 1842 Apr 9 2022 zmore - -rwxr-xr-x 1 root root 4577 Apr 9 2022 znew -I: user script /srv/workspace/pbuilder/10537/tmp/hooks/D02_print_environment finished + -rwxr-xr-x 1 root root 838488 Apr 24 2023 bash + -rwxr-xr-x 3 root root 67144 Sep 19 2022 bunzip2 + -rwxr-xr-x 3 root root 67144 Sep 19 2022 bzcat + lrwxrwxrwx 1 root root 6 Sep 19 2022 bzcmp -> bzdiff + -rwxr-xr-x 1 root root 2225 Sep 19 2022 bzdiff + lrwxrwxrwx 1 root root 6 Sep 19 2022 bzegrep -> bzgrep + -rwxr-xr-x 1 root root 4893 Nov 28 2021 bzexe + lrwxrwxrwx 1 root root 6 Sep 19 2022 bzfgrep -> bzgrep + -rwxr-xr-x 1 root root 3775 Sep 19 2022 bzgrep + -rwxr-xr-x 3 root root 67144 Sep 19 2022 bzip2 + -rwxr-xr-x 1 root root 67112 Sep 19 2022 bzip2recover + lrwxrwxrwx 1 root root 6 Sep 19 2022 bzless -> bzmore + -rwxr-xr-x 1 root root 1297 Sep 19 2022 bzmore + -rwxr-xr-x 1 root root 67632 Sep 21 2022 cat + -rwxr-xr-x 1 root root 67676 Sep 21 2022 chgrp + -rwxr-xr-x 1 root root 67644 Sep 21 2022 chmod + -rwxr-xr-x 1 root root 67684 Sep 21 2022 chown + -rwxr-xr-x 1 root root 133532 Sep 21 2022 cp + -rwxr-xr-x 1 root root 132868 Jan 6 2023 dash + -rwxr-xr-x 1 root root 133220 Sep 21 2022 date + -rwxr-xr-x 1 root root 67732 Sep 21 2022 dd + -rwxr-xr-x 1 root root 68104 Sep 21 2022 df + -rwxr-xr-x 1 root root 133632 Sep 21 2022 dir + -rwxr-xr-x 1 root root 59128 Mar 23 2023 dmesg + lrwxrwxrwx 1 root root 8 Dec 20 2022 dnsdomainname -> hostname + lrwxrwxrwx 1 root root 8 Dec 20 2022 domainname -> hostname + -rwxr-xr-x 1 root root 67560 Sep 21 2022 echo + -rwxr-xr-x 1 root root 41 Jan 25 2023 egrep + -rwxr-xr-x 1 root root 67548 Sep 21 2022 false + -rwxr-xr-x 1 root root 41 Jan 25 2023 fgrep + -rwxr-xr-x 1 root root 55748 Mar 23 2023 findmnt + -rwsr-xr-x 1 root root 26208 Mar 23 2023 fusermount + -rwxr-xr-x 1 root root 128608 Jan 25 2023 grep + -rwxr-xr-x 2 root root 2346 Apr 10 2022 gunzip + -rwxr-xr-x 1 root root 6447 Apr 10 2022 gzexe + -rwxr-xr-x 1 root root 64220 Apr 10 2022 gzip + -rwxr-xr-x 1 root root 67032 Dec 20 2022 hostname + -rwxr-xr-x 1 root root 67720 Sep 21 2022 ln + -rwxr-xr-x 1 root root 35132 Mar 23 2023 login + -rwxr-xr-x 1 root root 133632 Sep 21 2022 ls + -rwxr-xr-x 1 root root 136808 Mar 23 2023 lsblk + -rwxr-xr-x 1 root root 67800 Sep 21 2022 mkdir + -rwxr-xr-x 1 root root 67764 Sep 21 2022 mknod + -rwxr-xr-x 1 root root 67596 Sep 21 2022 mktemp + -rwxr-xr-x 1 root root 38504 Mar 23 2023 more + -rwsr-xr-x 1 root root 38496 Mar 23 2023 mount + -rwxr-xr-x 1 root root 9824 Mar 23 2023 mountpoint + -rwxr-xr-x 1 root root 133532 Sep 21 2022 mv + lrwxrwxrwx 1 root root 8 Dec 20 2022 nisdomainname -> hostname + lrwxrwxrwx 1 root root 14 Apr 3 2023 pidof -> /sbin/killall5 + -rwxr-xr-x 1 root root 67608 Sep 21 2022 pwd + lrwxrwxrwx 1 root root 4 Apr 24 2023 rbash -> bash + -rwxr-xr-x 1 root root 67600 Sep 21 2022 readlink + -rwxr-xr-x 1 root root 67672 Sep 21 2022 rm + -rwxr-xr-x 1 root root 67600 Sep 21 2022 rmdir + -rwxr-xr-x 1 root root 14152 Jul 29 2023 run-parts + -rwxr-xr-x 1 root root 133372 Jan 6 2023 sed + lrwxrwxrwx 1 root root 9 Feb 10 07:31 sh -> /bin/bash + -rwxr-xr-x 1 root root 67584 Sep 21 2022 sleep + -rwxr-xr-x 1 root root 67644 Sep 21 2022 stty + -rwsr-xr-x 1 root root 50800 Mar 23 2023 su + -rwxr-xr-x 1 root root 67584 Sep 21 2022 sync + -rwxr-xr-x 1 root root 336764 Apr 7 2023 tar + -rwxr-xr-x 1 root root 9800 Jul 29 2023 tempfile + -rwxr-xr-x 1 root root 133224 Sep 21 2022 touch + -rwxr-xr-x 1 root root 67548 Sep 21 2022 true + -rwxr-xr-x 1 root root 9768 Mar 23 2023 ulockmgr_server + -rwsr-xr-x 1 root root 22108 Mar 23 2023 umount + -rwxr-xr-x 1 root root 67572 Sep 21 2022 uname + -rwxr-xr-x 2 root root 2346 Apr 10 2022 uncompress + -rwxr-xr-x 1 root root 133632 Sep 21 2022 vdir + -rwxr-xr-x 1 root root 42608 Mar 23 2023 wdctl + lrwxrwxrwx 1 root root 8 Dec 20 2022 ypdomainname -> hostname + -rwxr-xr-x 1 root root 1984 Apr 10 2022 zcat + -rwxr-xr-x 1 root root 1678 Apr 10 2022 zcmp + -rwxr-xr-x 1 root root 6460 Apr 10 2022 zdiff + -rwxr-xr-x 1 root root 29 Apr 10 2022 zegrep + -rwxr-xr-x 1 root root 29 Apr 10 2022 zfgrep + -rwxr-xr-x 1 root root 2081 Apr 10 2022 zforce + -rwxr-xr-x 1 root root 8103 Apr 10 2022 zgrep + -rwxr-xr-x 1 root root 2206 Apr 10 2022 zless + -rwxr-xr-x 1 root root 1842 Apr 10 2022 zmore + -rwxr-xr-x 1 root root 4577 Apr 10 2022 znew +I: user script /srv/workspace/pbuilder/28295/tmp/hooks/D02_print_environment finished -> Attempting to satisfy build-dependencies -> Creating pbuilder-satisfydepends-dummy package Package: pbuilder-satisfydepends-dummy @@ -564,7 +596,7 @@ Get: 334 http://deb.debian.org/debian bookworm/main armhf libmockito-java all 2.23.0-2 [479 kB] Get: 335 http://deb.debian.org/debian bookworm/main armhf libredberry-pipe-java all 1.0.0~alpha0-3 [62.7 kB] Get: 336 http://deb.debian.org/debian bookworm/main armhf libtrove3-java all 3.0.3-5 [2146 kB] -Fetched 295 MB in 10s (29.3 MB/s) +Fetched 295 MB in 40s (7345 kB/s) debconf: delaying package configuration, since apt-utils is not installed Selecting previously unselected package libpython3.11-minimal:armhf. (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 19288 files and directories currently installed.) @@ -2119,7 +2151,11 @@ Building tag database... -> Finished parsing the build-deps I: Building the package -I: Running cd /build/reproducible-path/milib-2.2.0+dfsg/ && env PATH="/usr/sbin:/usr/bin:/sbin:/bin:/usr/games" HOME="/nonexistent/first-build" dpkg-buildpackage -us -uc -b && env PATH="/usr/sbin:/usr/bin:/sbin:/bin:/usr/games" HOME="/nonexistent/first-build" dpkg-genchanges -S > ../milib_2.2.0+dfsg-1_source.changes +I: user script /srv/workspace/pbuilder/28295/tmp/hooks/A99_set_merged_usr starting +Not re-configuring usrmerge for bookworm +I: user script /srv/workspace/pbuilder/28295/tmp/hooks/A99_set_merged_usr finished +hostname: Name or service not known +I: Running cd /build/reproducible-path/milib-2.2.0+dfsg/ && env PATH="/usr/sbin:/usr/bin:/sbin:/bin:/usr/games:/i/capture/the/path" HOME="/nonexistent/second-build" dpkg-buildpackage -us -uc -b && env PATH="/usr/sbin:/usr/bin:/sbin:/bin:/usr/games:/i/capture/the/path" HOME="/nonexistent/second-build" dpkg-genchanges -S > ../milib_2.2.0+dfsg-1_source.changes dpkg-buildpackage: info: source package milib dpkg-buildpackage: info: source version 2.2.0+dfsg-1 dpkg-buildpackage: info: source distribution unstable @@ -2153,7 +2189,7 @@ dh_auto_build mkdir -p .gradle/init.d cp /usr/share/gradle-debian-helper/init.gradle .gradle/init.d/ - gradle --info --console plain --offline --stacktrace --no-daemon --refresh-dependencies --gradle-user-home .gradle -Duser.home=. -Duser.name=debian -Ddebian.package=milib -Dfile.encoding=UTF-8 --parallel --max-workers=3 jar + gradle --info --console plain --offline --stacktrace --no-daemon --refresh-dependencies --gradle-user-home .gradle -Duser.home=. -Duser.name=debian -Ddebian.package=milib -Dfile.encoding=UTF-8 --parallel --max-workers=4 jar openjdk version "17.0.9" 2023-10-17 OpenJDK Runtime Environment (build 17.0.9+9-Debian-1deb12u1) OpenJDK Server VM (build 17.0.9+9-Debian-1deb12u1, mixed mode, sharing) @@ -2161,12 +2197,12 @@ To honour the JVM settings for this build a new JVM will be forked. Please consider using the daemon: https://docs.gradle.org/4.4.1/userguide/gradle_daemon.html. Starting process 'Gradle build daemon'. Working directory: /build/reproducible-path/milib-2.2.0+dfsg/.gradle/daemon/4.4.1 Command: /usr/lib/jvm/java-17-openjdk-armhf/bin/java --add-opens java.base/java.lang=ALL-UNNAMED -Xbootclasspath/a:/usr/share/java/gradle-helper-hook.jar:/usr/share/java/maven-repo-helper.jar -Dfile.encoding=UTF-8 -Duser.country=US -Duser.language=en -Duser.variant -cp /usr/share/gradle/lib/gradle-launcher-4.4.1.jar org.gradle.launcher.daemon.bootstrap.GradleDaemon 4.4.1 Successfully started process 'Gradle build daemon' -An attempt to start the daemon took 5.714 secs. -The client will now receive all logging from the daemon (pid: 28777). The daemon log file: /build/reproducible-path/milib-2.2.0+dfsg/.gradle/daemon/4.4.1/daemon-28777.out.log +An attempt to start the daemon took 12.094 secs. +The client will now receive all logging from the daemon (pid: 4068). The daemon log file: /build/reproducible-path/milib-2.2.0+dfsg/.gradle/daemon/4.4.1/daemon-4068.out.log Daemon will be stopped at the end of the build stopping after processing Closing daemon's stdin at end of input. The daemon will no longer process any standard input. -Using 3 worker leases. +Using 4 worker leases. Creating new cache for fileHashes, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/caches/4.4.1/fileHashes/fileHashes.bin, access org.gradle.cache.internal.DefaultCacheAccess@171efdb Creating new cache for resourceHashesCache, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/caches/4.4.1/fileHashes/resourceHashesCache.bin, access org.gradle.cache.internal.DefaultCacheAccess@171efdb Creating new cache for fileHashes, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/4.4.1/fileHashes/fileHashes.bin, access org.gradle.cache.internal.DefaultCacheAccess@149252e @@ -2196,8 +2232,8 @@ Creating new cache for outputFiles, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/buildOutputCleanup/outputFiles.bin, access org.gradle.cache.internal.DefaultCacheAccess@118445b :compileJava (Thread[Task worker for ':',5,main]) started. :compileJava -Putting task artifact state for task ':compileJava' into context took 0.019 secs. -Creating new cache for metadata-2.36/module-metadata, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/caches/modules-2/metadata-2.36/module-metadata.bin, access org.gradle.cache.internal.DefaultCacheAccess@16a4502 +Putting task artifact state for task ':compileJava' into context took 0.06 secs. +Creating new cache for metadata-2.36/module-metadata, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/caches/modules-2/metadata-2.36/module-metadata.bin, access org.gradle.cache.internal.DefaultCacheAccess@1c78cd1 Loading the Maven rules... Replacing org.apache.commons:commons-math3:jar:3.6.1 -> org.apache.commons:commons-math3:jar:debian Replacing cc.redberry:pipe:jar:1.3.0 -> cc.redberry:pipe:jar:1.0.0-alpha0 @@ -2269,7 +2305,7 @@ at java.base/java.util.concurrent.ThreadPoolExecutor$Worker.run(ThreadPoolExecutor.java:635) at org.gradle.internal.concurrent.ThreadFactoryImpl$ManagedThreadRunnable.run(ThreadFactoryImpl.java:55) at java.base/java.lang.Thread.run(Thread.java:840) -Up-to-date check for task ':compileJava' took 19.086 secs. It is not up-to-date because: +Up-to-date check for task ':compileJava' took 58.68 secs. It is not up-to-date because: No history is available. All input files are considered out-of-date for incremental task ':compileJava'. Compiling with JDK Java compiler API. @@ -2277,37 +2313,37 @@ Note: Recompile with -Xlint:deprecation for details. Note: Some input files use unchecked or unsafe operations. Note: Recompile with -Xlint:unchecked for details. -:compileJava (Thread[Task worker for ':',5,main]) completed. Took 57.176 secs. +:compileJava (Thread[Task worker for ':',5,main]) completed. Took 3 mins 34.991 secs. :processResources (Thread[Task worker for ':',5,main]) started. :processResources Putting task artifact state for task ':processResources' into context took 0.0 secs. -Up-to-date check for task ':processResources' took 0.11 secs. It is not up-to-date because: +Up-to-date check for task ':processResources' took 0.095 secs. It is not up-to-date because: No history is available. -:processResources (Thread[Task worker for ':',5,main]) completed. Took 0.221 secs. +:processResources (Thread[Task worker for ':',5,main]) completed. Took 0.381 secs. :classes (Thread[Task worker for ':',5,main]) started. :classes Skipping task ':classes' as it has no actions. -:classes (Thread[Task worker for ':',5,main]) completed. Took 0.008 secs. +:classes (Thread[Task worker for ':',5,main]) completed. Took 0.011 secs. :debianMavenPom (Thread[Task worker for ':',5,main]) started. :debianMavenPom Putting task artifact state for task ':debianMavenPom' into context took 0.0 secs. -Up-to-date check for task ':debianMavenPom' took 0.003 secs. It is not up-to-date because: +Up-to-date check for task ':debianMavenPom' took 0.009 secs. It is not up-to-date because: No history is available. Generating pom file /build/reproducible-path/milib-2.2.0+dfsg/build/debian/milib.pom -:debianMavenPom (Thread[Task worker for ':',5,main]) completed. Took 0.333 secs. +:debianMavenPom (Thread[Task worker for ':',5,main]) completed. Took 1.156 secs. :jar (Thread[Task worker for ':',5,main]) started. :jar Putting task artifact state for task ':jar' into context took 0.0 secs. -Up-to-date check for task ':jar' took 0.16 secs. It is not up-to-date because: +Up-to-date check for task ':jar' took 0.587 secs. It is not up-to-date because: No history is available. -:jar (Thread[Task worker for ':',5,main]) completed. Took 1.147 secs. +:jar (Thread[Task worker for ':',5,main]) completed. Took 4.876 secs. -BUILD SUCCESSFUL in 1m 28s +BUILD SUCCESSFUL in 4m 47s 4 actionable tasks: 4 executed dh_auto_test mkdir -p .gradle/init.d cp /usr/share/gradle-debian-helper/init.gradle .gradle/init.d/ - gradle --info --console plain --offline --stacktrace --no-daemon --refresh-dependencies --gradle-user-home .gradle -Duser.home=. -Duser.name=debian -Ddebian.package=milib -Dfile.encoding=UTF-8 --parallel --max-workers=3 test + gradle --info --console plain --offline --stacktrace --no-daemon --refresh-dependencies --gradle-user-home .gradle -Duser.home=. -Duser.name=debian -Ddebian.package=milib -Dfile.encoding=UTF-8 --parallel --max-workers=4 test openjdk version "17.0.9" 2023-10-17 OpenJDK Runtime Environment (build 17.0.9+9-Debian-1deb12u1) OpenJDK Server VM (build 17.0.9+9-Debian-1deb12u1, mixed mode, sharing) @@ -2315,12 +2351,12 @@ To honour the JVM settings for this build a new JVM will be forked. Please consider using the daemon: https://docs.gradle.org/4.4.1/userguide/gradle_daemon.html. Starting process 'Gradle build daemon'. Working directory: /build/reproducible-path/milib-2.2.0+dfsg/.gradle/daemon/4.4.1 Command: /usr/lib/jvm/java-17-openjdk-armhf/bin/java --add-opens java.base/java.lang=ALL-UNNAMED -Xbootclasspath/a:/usr/share/java/gradle-helper-hook.jar:/usr/share/java/maven-repo-helper.jar -Dfile.encoding=UTF-8 -Duser.country=US -Duser.language=en -Duser.variant -cp /usr/share/gradle/lib/gradle-launcher-4.4.1.jar org.gradle.launcher.daemon.bootstrap.GradleDaemon 4.4.1 Successfully started process 'Gradle build daemon' -An attempt to start the daemon took 3.961 secs. -The client will now receive all logging from the daemon (pid: 2902). The daemon log file: /build/reproducible-path/milib-2.2.0+dfsg/.gradle/daemon/4.4.1/daemon-2902.out.log +An attempt to start the daemon took 21.285 secs. +The client will now receive all logging from the daemon (pid: 5194). The daemon log file: /build/reproducible-path/milib-2.2.0+dfsg/.gradle/daemon/4.4.1/daemon-5194.out.log Daemon will be stopped at the end of the build stopping after processing Closing daemon's stdin at end of input. The daemon will no longer process any standard input. -Using 3 worker leases. +Using 4 worker leases. Creating new cache for fileHashes, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/caches/4.4.1/fileHashes/fileHashes.bin, access org.gradle.cache.internal.DefaultCacheAccess@1e51ee4 Creating new cache for resourceHashesCache, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/caches/4.4.1/fileHashes/resourceHashesCache.bin, access org.gradle.cache.internal.DefaultCacheAccess@1e51ee4 Creating new cache for fileHashes, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/4.4.1/fileHashes/fileHashes.bin, access org.gradle.cache.internal.DefaultCacheAccess@1605d8e @@ -2339,15 +2375,15 @@ Linking the generated javadoc to the system JDK API documentation All projects evaluated. Selected primary task 'test' from project : -Creating new cache for annotation-processors, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/4.4.1/fileContent/annotation-processors.bin, access org.gradle.cache.internal.DefaultCacheAccess@7b862a +Creating new cache for annotation-processors, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/4.4.1/fileContent/annotation-processors.bin, access org.gradle.cache.internal.DefaultCacheAccess@aeccc5 Tasks to be executed: [task ':compileJava', task ':processResources', task ':classes', task ':compileTestJava', task ':processTestResources', task ':testClasses', task ':test'] Creating new cache for resourceHashesCache, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/4.4.1/fileHashes/resourceHashesCache.bin, access org.gradle.cache.internal.DefaultCacheAccess@1605d8e -Creating new cache for taskHistory, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/4.4.1/taskHistory/taskHistory.bin, access org.gradle.cache.internal.DefaultCacheAccess@feab16 -Creating new cache for outputFiles, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/buildOutputCleanup/outputFiles.bin, access org.gradle.cache.internal.DefaultCacheAccess@19c63f8 -:compileJava (Thread[Task worker for ':',5,main]) started. +Creating new cache for taskHistory, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/4.4.1/taskHistory/taskHistory.bin, access org.gradle.cache.internal.DefaultCacheAccess@b34035 +Creating new cache for outputFiles, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/buildOutputCleanup/outputFiles.bin, access org.gradle.cache.internal.DefaultCacheAccess@13dc097 +:compileJava (Thread[Task worker for ':' Thread 2,5,main]) started. :compileJava -Putting task artifact state for task ':compileJava' into context took 0.017 secs. -Creating new cache for metadata-2.36/module-metadata, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/caches/modules-2/metadata-2.36/module-metadata.bin, access org.gradle.cache.internal.DefaultCacheAccess@1e385ba +Putting task artifact state for task ':compileJava' into context took 0.117 secs. +Creating new cache for metadata-2.36/module-metadata, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/caches/modules-2/metadata-2.36/module-metadata.bin, access org.gradle.cache.internal.DefaultCacheAccess@c1285b Loading the Maven rules... Replacing org.apache.commons:commons-math3:jar:3.6.1 -> org.apache.commons:commons-math3:jar:debian Replacing cc.redberry:pipe:jar:1.3.0 -> cc.redberry:pipe:jar:1.0.0-alpha0 @@ -2371,21 +2407,21 @@ Passing through org.jsr-305:jsr305:jar:0.x Passing through com.google.errorprone:error_prone_annotations:jar:debian Passing through com.google.errorprone:error_prone_parent:jar:debian -Skipping task ':compileJava' as it is up-to-date (took 5.545 secs). +Skipping task ':compileJava' as it is up-to-date (took 13.996 secs). :compileJava UP-TO-DATE -:compileJava (Thread[Task worker for ':',5,main]) completed. Took 5.667 secs. -:processResources (Thread[Task worker for ':',5,main]) started. +:compileJava (Thread[Task worker for ':' Thread 2,5,main]) completed. Took 14.695 secs. +:processResources (Thread[Task worker for ':' Thread 2,5,main]) started. :processResources Putting task artifact state for task ':processResources' into context took 0.0 secs. -Skipping task ':processResources' as it is up-to-date (took 0.035 secs). +Skipping task ':processResources' as it is up-to-date (took 0.119 secs). :processResources UP-TO-DATE -:processResources (Thread[Task worker for ':',5,main]) completed. Took 0.045 secs. -:classes (Thread[Task worker for ':',5,main]) started. +:processResources (Thread[Task worker for ':' Thread 2,5,main]) completed. Took 0.167 secs. +:classes (Thread[Task worker for ':' Thread 2,5,main]) started. :classes Skipping task ':classes' as it has no actions. :classes UP-TO-DATE -:classes (Thread[Task worker for ':',5,main]) completed. Took 0.003 secs. -:compileTestJava (Thread[Task worker for ':',5,main]) started. +:classes (Thread[Task worker for ':' Thread 2,5,main]) completed. Took 0.013 secs. +:compileTestJava (Thread[Task worker for ':' Thread 2,5,main]) started. :compileTestJava Putting task artifact state for task ':compileTestJava' into context took 0.0 secs. Replacing junit:junit:jar:4.13.2 -> junit:junit:jar:4.x @@ -2401,7 +2437,7 @@ Passing through net.bytebuddy:byte-buddy-dep:jar:debian Passing through org.ow2.asm:asm:jar:debian Passing through org.ow2.asm:asm-commons:jar:debian -Up-to-date check for task ':compileTestJava' took 21.607 secs. It is not up-to-date because: +Up-to-date check for task ':compileTestJava' took 56.355 secs. It is not up-to-date because: No history is available. All input files are considered out-of-date for incremental task ':compileTestJava'. Compiling with JDK Java compiler API. @@ -2409,398 +2445,148 @@ Note: Recompile with -Xlint:deprecation for details. Note: Some input files use unchecked or unsafe operations. Note: Recompile with -Xlint:unchecked for details. -:compileTestJava (Thread[Task worker for ':',5,main]) completed. Took 1 mins 8.354 secs. -:processTestResources (Thread[Task worker for ':',5,main]) started. +:compileTestJava (Thread[Task worker for ':' Thread 2,5,main]) completed. Took 3 mins 8.137 secs. +:processTestResources (Thread[Task worker for ':' Thread 2,5,main]) started. :processTestResources Putting task artifact state for task ':processTestResources' into context took 0.0 secs. -Up-to-date check for task ':processTestResources' took 0.134 secs. It is not up-to-date because: +Up-to-date check for task ':processTestResources' took 0.235 secs. It is not up-to-date because: No history is available. -:processTestResources (Thread[Task worker for ':',5,main]) completed. Took 0.356 secs. -:testClasses (Thread[Daemon worker,5,main]) started. +:processTestResources (Thread[Task worker for ':' Thread 2,5,main]) completed. Took 0.746 secs. +:testClasses (Thread[Task worker for ':' Thread 2,5,main]) started. :testClasses Skipping task ':testClasses' as it has no actions. -:testClasses (Thread[Daemon worker,5,main]) completed. Took 0.002 secs. -:test (Thread[Daemon worker,5,main]) started. +:testClasses (Thread[Task worker for ':' Thread 2,5,main]) completed. Took 0.016 secs. +:test (Thread[Task worker for ':' Thread 2,5,main]) started. :test Putting task artifact state for task ':test' into context took 0.0 secs. -Up-to-date check for task ':test' took 5.323 secs. It is not up-to-date because: +Up-to-date check for task ':test' took 15.31 secs. It is not up-to-date because: No history is available. -Starting process 'Gradle Test Executor 1'. Working directory: /build/reproducible-path/milib-2.2.0+dfsg Command: /usr/lib/jvm/java-17-openjdk-armhf/bin/java -Dorg.gradle.native=false @/tmp/gradle-worker-classpath14115665275392845916txt -Xms1024m -Xmx2048m -Dfile.encoding=UTF-8 -Duser.country=US -Duser.language=en -Duser.variant -ea worker.org.gradle.process.internal.worker.GradleWorkerMain 'Gradle Test Executor 1' +Starting process 'Gradle Test Executor 1'. Working directory: /build/reproducible-path/milib-2.2.0+dfsg Command: /usr/lib/jvm/java-17-openjdk-armhf/bin/java -Dorg.gradle.native=false @/tmp/gradle-worker-classpath3667783785035859980txt -Xms1024m -Xmx2048m -Dfile.encoding=UTF-8 -Duser.country=US -Duser.language=en -Duser.variant -ea worker.org.gradle.process.internal.worker.GradleWorkerMain 'Gradle Test Executor 1' Successfully started process 'Gradle Test Executor 1' Gradle Test Executor 1 started executing tests. -com.milaboratory.core.tree.PrimerGenerator > generate SKIPPED - -com.milaboratory.core.tree.SequenceTreeMapTest > testCase9 STANDARD_OUT - Hit 1 - 0 ac-gacTtgactg 11 - 0 acTgac-tgactg 11 - - Hit 2 - 0 ac-gactTgactg 11 - 0 acTgact-gactg 11 - - -com.milaboratory.core.tree.SequenceTreeMapTest > optimalityAndScopeTest STANDARD_OUT - --NW alignments-- - CASSLAPGATN-KLFF - CASS-APGATNEKLFF - - CASSLAPGATN-KLFF - CASSLAPG-TNEKLFF - - CASSLAPGATN-KLfF - CASSLAPG-TNEKLyF - - --STM alignments-- - CASSLAPGATN-KLFF - CASS-APGATNEKLFF - - CASSLAPGATN-KLFF - CASSLAPG-TNEKLFF - - CASSlAPGATN-KLFF - CASSa-PGATNEKLFF - - CASSLAPGaTN-KLFF - CASSLAPGt-NEKLFF - - CASSlAPGATN-KLFF - CA-SsAPGATNEKLFF - - CASSlAPGATN-KLFF - CAS-sAPGATNEKLFF - - CASSLAPGATNk-LFF - CASS-APGATNeKLFF - - CASSLAPGaTN-KLFF - CASSLAP-gTNEKLFF - - CASSLAPGATNk-LFF - CASSLAPG-TNeKLFF - - CASSLAPGATN-KLfF - CASSLAPG-TNEKLyF - - ------------------ - -com.milaboratory.core.sequence.AminoAcidSequenceTest > testName STANDARD_OUT - 3 - -com.milaboratory.core.sequence.AminoAcidSequenceTest > testConvertPositionSync1 STANDARD_OUT - FromCenter - 2 - 3 - 4 - 5 - 6 - 7 - 8 - 9 - 10 - 11 - 12 - 13 - 14 - 15 - 16 - 17 - 18 - 19 - FromLeftWithoutIncompleteCodon - 2 - 3 - 4 - 5 - 6 - 7 - 8 - 9 - 10 - 11 - 12 - 13 - 14 - 15 - 16 - 17 - 18 - 19 - FromLeftWithIncompleteCodon - 2 - 3 - 4 - 5 - 6 - 7 - 8 - 9 - 10 - 11 - 12 - 13 - 14 - 15 - 16 - 17 - 18 - 19 - FromRightWithoutIncompleteCodon - 2 - 3 - 4 - 5 - 6 - 7 - 8 - 9 - 10 - 11 - 12 - 13 - 14 - 15 - 16 - 17 - 18 - 19 - FromRightWithIncompleteCodon - 2 - 3 - 4 - 5 - 6 - 7 - 8 - 9 - 10 - 11 - 12 - 13 - 14 - 15 - 16 - 17 - 18 - 19 - -com.milaboratory.core.sequence.AminoAcidAlphabetTest > testCalculateMatches SKIPPED - -com.milaboratory.core.sequence.GeneticCodeTest > generateExtendedGeneticCode SKIPPED - -com.milaboratory.core.sequence.quality.QualityTrimmerTest > testParametersSerialization0 STANDARD_OUT +com.milaboratory.core.merger.MergerParametersTest > test2 STANDARD_OUT { - "averageQualityThreshold": 7.0, - "windowSize": 6 + "qualityMergingAlgorithm": "SumSubtraction", + "partsLayout": "Collinear", + "minimalOverlap": 15, + "maxQuality": 50, + "minimalIdentity": 0.8, + "identityType": "Unweighted" } -com.milaboratory.core.sequence.quality.QualityAggregatorTest > test1 STANDARD_OUT - 47 - -com.milaboratory.core.sequence.quality.QualityAggregatorTest > test2 STANDARD_OUT - 620 - -com.milaboratory.core.sequence.quality.QualityAggregatorTest > test3 STANDARD_OUT - 2563 +com.milaboratory.core.RangeTest > test23e14 STANDARD_OUT + 1000001 + 1010100 + 1000111 + 1000011 -com.milaboratory.core.sequence.NucleotideAlphabetTest > testCalculateIntersections SKIPPED + 1000010 -com.milaboratory.core.sequence.ShortSequenceSetTest > test1 STANDARD_OUT - 99928 elements with 366.26KiB in raw nucleotide entropy serialized into 273.22KiB +com.milaboratory.core.io.util.IOUtilTest > test111 STANDARD_OUT + 3 + 3 + -2147483648 + -9223372036854775808 com.milaboratory.core.io.sequence.fasta.RandomAccessFastaReaderTest > test1nt STANDARD_ERROR - Indexing milib_713ff7c6e43e35527b40829a028d37e40c2967928342464011866949722.fasta: 0% - Indexing milib_713ff7c6e43e35527b40829a028d37e40c2967928342464011866949722.fasta: done + Indexing milib_1ab7881d98e5767c31f2a5f914477e6ac815682117040635664392534376.fasta: 0% + Indexing milib_1ab7881d98e5767c31f2a5f914477e6ac815682117040635664392534376.fasta: done com.milaboratory.core.io.sequence.fasta.RandomAccessFastaReaderTest > test1 STANDARD_ERROR - Indexing milib_713ff7c6e43e35527b40829a028d37e40c2967928342464011866949722.fasta: 0% - Indexing milib_713ff7c6e43e35527b40829a028d37e40c2967928342464011866949722.fasta: done + Indexing milib_1ab7881d98e5767c31f2a5f914477e6ac815682117040635664392534376.fasta: 0% + Indexing milib_1ab7881d98e5767c31f2a5f914477e6ac815682117040635664392534376.fasta: done com.milaboratory.core.io.sequence.fasta.RandomAccessFastaReaderTest > test2 STANDARD_ERROR - Indexing milib_0cfce7ad22a5466d4046b9bd368d3677aa3f823c6758219618182737869.tmp: 0% - Indexing milib_0cfce7ad22a5466d4046b9bd368d3677aa3f823c6758219618182737869.tmp: done + Indexing milib_deb73ebe80719a0fb16aef20d2fcff591f26029b9293800781503564500.tmp: 0% + Indexing milib_deb73ebe80719a0fb16aef20d2fcff591f26029b9293800781503564500.tmp: 69.1% + Indexing milib_deb73ebe80719a0fb16aef20d2fcff591f26029b9293800781503564500.tmp: done -com.milaboratory.core.io.util.IOUtilTest > test111 STANDARD_OUT - 3 - 3 - -2147483648 - -9223372036854775808 +com.milaboratory.core.alignment.AlignmentHelperTest > test1 STANDARD_OUT + 0 GAGGTGCAGCTGGTGGAGTCTGGGGGAGGC 29 + |||||||||||||||||||||||||||||| + 0 GAGGTGCAGCTGGTGGAGTCTGGGGGAGGC 29 -com.milaboratory.core.mutations.MutationTest > exportRegexps STANDARD_OUT - S([\QAGCTNRYSWKMBDHV\E])(\d+)([\QAGCTNRYSWKMBDHV\E])|D([\QAGCTNRYSWKMBDHV\E])(\d+)|I(\d+)([\QAGCTNRYSWKMBDHV\E]) - S([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E])(\d+)([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E])|D([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E])(\d+)|I(\d+)([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E]) + 30 TTGGT-ACAGCCTGGGGGGTCCCTGAGACT 58 + |||| | |||||||||||||| |||||| + 30 CTGGTCA-AGCCTGGGGGGTCCATGAGACA 58 -com.milaboratory.core.mutations.MutationsUtilTest > test1111 STANDARD_OUT - S([\QAGCTNRYSWKMBDHV\E])(\d+)([\QAGCTNRYSWKMBDHV\E])|D([\QAGCTNRYSWKMBDHV\E])(\d+)|I(\d+)([\QAGCTNRYSWKMBDHV\E]) - S([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E])(\d+)([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E])|D([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E])(\d+)|I(\d+)([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E]) + 59 CTCCTGTGCAGCCTCTGGATTCACCTTCAG 88 + |||||||||||||||||||||| ||||||| + 59 CTCCTGTGCAGCCTCTGGATTCCCCTTCAG 88 -com.milaboratory.core.mutations.MutationsUtilTest > nt2AAWithMappingManual1 STANDARD_OUT - [I2C::SM0I, I2G::I1A, I2C::I1A, SG2C:SM0I:I1A] + 89 TAGC-TATAGCATGAACTGGGTCCGCCAGG 117 + || | ||||||||||||||||||||||||| + 89 TA-CTTATAGCATGAACTGGGTCCGCCAGG 117 -com.milaboratory.core.mutations.MutationsUtilTest > nt2AAWithMappingManual2 STANDARD_OUT - [S0:T->N,D13:V,S14:S->Y,S15:P->R,S16:W->P,S17:Y->G,S18:D->T,S19:P->I,S20:G->P,S21:D->A,S22:K->T,S23:A->K,S24:F->R,S25:G->S,S26:P->D,I27:S] - [-1, -1, 9, 15] + 118 CTCCAGGGAAGGGGCTGGAGTGGGTTTCAT 147 + ||||||||||||||||||||||||| |||| + 118 CTCCAGGGAAGGGGCTGGAGTGGGTCTCAT 147 -com.milaboratory.core.mutations.MutationsUtilTest > nt2AAWithMappingManual3 STANDARD_OUT - 0 CAGGTTCAGCTGGTGCAGTCTGGAGCTGAGGTGAAGAAGCCTGGGGCCTCAGTGAAGGTCTCCTGCAAGGCTTCTGGTTACACCTTTACCAGCTACGGTATCAGCTGGGTGCGACAGGCCCCTGGACAAGGGCTTGAGTGGATGGGATGGATCAGCGCTTACAATGGTAACACAAACTATGCACAGAAGCTCCAGGGCAGAGTCACCATGACCACAGACACATCCACGAGCACAGCCTACATGGAGCTGAGGAGCCTGAGATCTGACGACACGGCCGTGTATTACTGTGCGAGAGA 295 - |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||| ||||| ||||||||||||||||||||||||||||| ||||||||| ||||||||| ||||||||||||||||||| || ||||| ||| || |||||||||||||| - 0 CAGGTTCAGCTGGTGCAGTCTGGAGCTGAGGTGAAGAAGCCTGGGGCCTCAGTGAAGGTCTCCTGCAAGGCTTCTGGTTACACCTTTACCAGCTACGGTATCAGCTGGGTGCGACAGGCCCCTGGACAAGGGCTTGAGTGGATGGGATGGATCAGCGCTTACAATGGTAACACATTCTATGCAGAGAAGTTCCAGGGCAGAGTCACCATGACCACAGACGCATCCACGACCACAGCCTATATGGAGCTGAGGAGCCTGACATTTGACG-----GCCACATACTACTGTGCGAGAGA 290 - [S58:N->F,S61:Q->E,S63:L->F,S73:T->A,S76:S->T,S86:R->T,S87:S->F,S89:D->G,D90:T,D91:A,S92:V->H,S93:Y->I,S94:Y->L,S95:C->L,S96:A->C,S97:R->E,S98:_->R] - QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYGISWVRQAPGQGLEWMGWISAYNGNTFYAEKFQGRVTMTTDASTTTAYMELRSLTFDGHILLCER - QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYGISWVRQAPGQGLEWMGWISAYNGNTFYAEKFQGRVTMTTDASTTTAYMELRSLTFDGHILLCER - [S58:N->F,S61:Q->E,S63:L->F,S73:T->A,S76:S->T,S86:R->T,S87:S->F,S89:D->G,D90:T,D91:A,S92:V->H,S93:Y->I,S94:Y->L,S95:C->L,S96:A->C,S97:R->E,S98:_->R] - [0, 0, 1, 2, 3, 4, -1, 5, 6, 7, 7, 8, 8, 8, 10, 10, 11, 12] + 148 ACATTAGTAGTAGTAGTAG-TACCATATAC 176 + |||||||||| ||||||| || |||||| + 148 CCATTAGTAGTGGTAGTAGTTA-CATATAT 176 -com.milaboratory.core.mutations.MutationsUtilTest > nt2AAWithMappingManual4 STANDARD_OUT - [S3:S->M,D4:D,S5:_->I] + 177 TACGCAGACTCTGTGAAGGGCCGATTCACC 206 + ||||||||||| |||||||||||||||||| + 177 TACGCAGACTCCGTGAAGGGCCGATTCACC 206 -com.milaboratory.core.mutations.MutationsTest > testCanonical1 STANDARD_OUT - GTTGCCCGGGACCCTTCAGGCCCGTAAAAGCATCGTGTGTTCCTGCATGCCTTCCGCTTCGGAATAGCTGGTGGATGGCATACTTACACTCACGGCTGGTATTCGCTACTACTTCCTGCATATCCGATCCCCTTGATGGGGGCACCAATACTATTATCCGGGGGTAGTTATCACTGTCCGTTAACCCTTGAAAACGCGTTAGGTTTCGAAAGAGCACTTAGTCCTTGGGCGTCAAGCAATTTGTGCGGCCTTCAAACAACGACCGTGTCCTAGCGATTAACCGTATTTGTCAGAGCGGCAGGATTATTGCTGACGACCTCTCCAACATGTAGTGCAGTTGTAGGTATGGCGGCGAAGGTTATGAGGCTTAGGTGCAAAGAATTGTTAAAACTCTATAACATCGGTTTAGGTTGGTACGAGTAAGCCACTTCGAGACGTGTGGTGAGTGTCTATTGCTGAATGTAGCCCCCATTTGTCTGGTCTCAATCAGAAGTGTGAGATCTATAAATATCCCCGTATTTACATTCATAATTGGAATTATACGGTACAAACCGGTATTTAGCGCGATAGTCCGTGCGAATGAGATGGACAGTGTGGCGTCTTTGTCGGCGGAACTACAATGCGTCAGATTGCGTAAAAATCATTGACATACGTCGGGAATCACCACTTCGCCGTCATATCTTTAGATGGTATCGATGGAGATATGTTGGTAACCCAGAGGGTAACTCCGCGAATTCTTTGGGACGCATTATTATCAGCGTTAAGCCGGTGTTTTGGCTCGTCGCAGCTTCCC - GTTGCCCGGGCCCTTCAGGCCCGTAAAAGCATCGTTGTTCCTGCATGCCTCGCTGTCGGAATAGCGGTGGATGGCATATTACACTCTCCGGCTGGTATTCGCTTCTACTTCCTGATATCGATCCGCCTTGATGGGGCTCCAACACTACTATCCGGGGTAGTTACCACTGTCCGTTTACTCTTAGAAAACGGTTAGGTTTCGAAAAACATTGTCCTTGGGCTACAAGCAATTTGGCGGCCTTCTAACTAACGACCGTGTCCTAGCGATTCAACCGTCATTTGTCAGAGCGCAGGATCATTGCTGACGACCTCTCCAACATGTAGTGCAGTTCTAGGTATGGCGGCGTAAGGTTATGAGGCTTAGGGCAAAGAATTGTTAAATCCTATAACATCGGTTAGGTTGTCAGTAAGCCACTCGAGACGTTGGTGAGTGTCTATTCTGAATGTAGCCCCCATTTGTCGGTCAATCAGAAGTGTGAGATCTATAAATATCCCCGTATTTTACATCCTTATTGGATTTACGGGTCTAACCGGATTTAGCGCGATAGTCCGTGCGAATGAGTGACGTGTGGCGTCTTTGTCGGGCGGAACACAATGCGTCAGATTGCGTAAAAATCATTGACATACGTCGGGTATCACCACTTCGCCGTCATCTTTATATGTATCGATAGGAGATATGTTGGTAACCCAGAGGTAACTCCGCAATTCTTGTGCGACATTATTATCAGCGTTAAGCCGGTGTTTTGGCTCGTCGAGCTTCCT - GTTGCCCGGGCCTTCGGCCCGTAAAGCACGTTGTTCTCCATGCCTGCTGTCGATAGGTGGATGGATATTACATCTCCGGCTGGTATTCGCTTCTCTTCCTGTATCGATCGCCTTGATTGGGGCTCCAACACTACTATCCTGGGATAGTTACCATGTCCGTTTACTCTTAGAAAACGGTTATGTTTCGAAAACATTGTCCTTGGGCTACAAGCAATTTGGCGGCCTTCTAGGCTAACGCCGTGTCCTGAGCGATTCAACCGTCATTTTCAGAGCTCAGGATACATTGCTGACGACCCTCATCCAACATGTAGTGCAGTTCTAGGTATGTCGCGTAAGGCTATGAGGCTTAGGGCAAAGAATGTTAATCCTATAACATCGGTTAGGTTTCATAAGCCACTGAGACGTTGTGGTGTCATAGTTCTGATGTACCCCCATTTGTCGGTCAATCAAAGTGTGAGTCTATAAATATCCCCGTATTTCACCTTATTGGATTTATGGGTCTAACCGATTTGAGCGCGATAGTCCGTGCGAATGAGTGACGTGTGGCGTCTTGTCGGGGGAGCACAATGCGTCAGATTGCGTTTAAATCATGAATCGTCGGGTATCACCACTTCGCCGTCATTCTTTATATGTATCATTAGGAGATATGTTGGTGACCACAGAGTACTCCGCATTCTGTGCGACATTATTATCAGCGTTAAGCCGGGTTTTGTTCGTCGACTTCCT - 0 GTTGCCCGGG--CCTTC-GGCCCGT-AAAGCA-CGT-TGTT-CTCCATGCC-T--GCTGTC-G-ATA---GGTGGATGG-ATA-TTACATCTC-CGGCTGGTATTCGCTTCT-CTTCCTG--TAT-CGATCGCCTTGATTGGGGCTCCAACACTACTATCCTGGGATAGTTACCA-TGTCCGTTTACTCTTAGAAAACG-GTTATGTTTCGAAA-A-CA-TT-GTCCTTGGGC-TACAAGCAATTTG-GCGGCCTTCTAGGCTAACG-CCGTGTCCTGAGCGATTCAACCGTCATTT-TCAGAGC-TCAGGATACATTGCTGACGACCCTCATCCAACATGTAGTGCAGTTCTAGGTATGTC-GCGTAAGGCTATGAGGCTTAGG-GCAAAGAA-TGTT-AATC-CTATAACATCGG-TTAGGTT--T-C-A-TAAGCCAC-T-GAGACGT-T-GTG-GTGTCATAGTT-CTG-ATGTA-CCCCCATTTGTC-GG--TCAATCA-AAGTGTGAG-TCTATAAATATCCCCGTATTT-CA--CCTTATTGGATTTAT-GGGT-CTAACC-G-ATTTGAGCGCGATAGTCCGTGCGAATGAG-T-GAC-GTGTGGCGTC-TTGTCGGGGGAGC-ACAATGCGTCAGATTGCGTTTAAATCA-TGA-AT-CGTCGGGTATCACCACTTCGCCGTCAT-TCTTTATAT-GTATC-ATTAGGAGATATGTTGGTGACCACAGA--GT-ACTCCGC--ATTCTGTGCGA--CATTATTATCAGCGTTAAGCCGG-GTTTT-GTTCGTCG-A-CTTCCT 725 - |||||||||| ||||| ||||||| |||||| ||| |||| || |||||| | ||| || | ||| ||||||||| ||| ||||| ||| ||||||||||||||| || ||||||| ||| ||||| ||||||| ||||| |||| |||| ||||| ||| |||||| || |||||||| || ||| ||||||| |||| ||||||||| | || || |||||||||| | ||||||||||| ||||||||| | | |||| ||||||||| ||||||| |||||| |||| ||||||| |||||| ||||||||||| |||| ||||||||||||||||||| |||||||| | ||| |||| ||||||||||||| |||||||| |||| || | |||||||||||| ||||||| | | | |||||||| | ||||||| | ||| ||||| || || ||| ||||| |||||||||||| || ||||||| ||||||||| ||||||||||||||||||||| || | | |||||| |||| ||| | |||| | |||| |||||||||||||||||||||||| | ||| |||||||||| ||||||| ||| | ||||||||||||||||||| |||||| ||| || ||||||| ||||||||||||||||||| |||||| || ||||| | | |||||||||||||| ||| |||| || ||||||| ||||| || || ||||||||||||||||||||||| ||||| | |||||| | ||||| - 0 GTTGCCCGGGACCCTTCAGGCCCGTAAAAGCATCGTGTGTTCCTGCATGCCTTCCGCT-TCGGAATAGCTGGTGGATGGCATACTTACA-CTCACGGCTGGTATTCGCTACTACTTCCTGCATATCCGATCCCCTTGATGGGGGCACCAATACTATTATCCGGGGGTAGTTATCACTGTCCGTTAACCCTT-GAAAACGCGTTAGGTTTCGAAAGAGCACTTAGTCCTTGGGCGT-CAAGCAATTTGTGCGGCCTTC-AAAC-AACGACCGTGTCCT-AGCGATT-AACCGT-ATTTGTCAGAGCGGCAGGAT-TATTGCTGACGA-CCTC-TCCAACATGTAGTGCAGTTGTAGGTATGGCGGCG-AAGGTTATGAGGCTTAGGTGCAAAGAATTGTTAAAACTCTATAACATCGGTTTAGGTTGGTACGAGTAAGCCACTTCGAGACGTGTGGTGAGTGTC-TA-TTGCTGAATGTAGCCCCCATTTGTCTGGTCTCAATCAGAAGTGTGAGATCTATAAATATCCCCGTATTTACATTCATAATTGGAATTATACGGTACAAACCGGTATTT-AGCGCGATAGTCCGTGCGAATGAGATGGACAGTGTGGCGTCTTTGTCGGCGGAACTACAATGCGTCAGATTGCGTAAAAATCATTGACATACGTCGGGAATCACCACTTCGCCGTCATATCTTTAGATGGTATCGA-T-GGAGATATGTTGGTAACC-CAGAGGGTAACTCCGCGAATTCTTTGGGACGCATTATTATCAGCGTTAAGCCGGTGTTTTGGCTCGTCGCAGCTTCCC 792 - [I10:A,S10:A->C,D13:C,I53:C,D54:C,I60:G,S61:G->A,D62:A,I66:G,I66:C,I66:T,D67:C,D68:T,D69:G,D88:C,D89:T,S91:A->T,I93:A,I93:C,I118:C,S118:C->A,D119:A,I123:C,D124:C,D159:G,I164:G,D253:A,I256:A,I296:G,D297:G,D316:C,I318:C,I350:G,D351:G,I381:T,D382:T,I404:T,D406:T,I412:G,D413:G,I440:G,D441:G,I480:T,I480:C,D481:C,D482:T,I524:T,S525:T->C,S526:C->A,D527:A,D536:A,S537:T->A,D539:A,S542:C->T,I543:A,I543:C,I586:G,D587:G,I601:T,D602:T,I607:G,S608:G->C,D609:C,D677:T,D678:A,I680:A,I680:T,I688:G,D689:G,I694:G,S694:G->A,S695:A->T,D696:T,I719:G,D721:G,I723:A,D724:A,I731:G,S731:G->A,D733:A,D738:T,D739:T,S740:G->T,S741:G->T,D743:A,S744:C->G,I746:A,I746:C,I746:G,I775:G,S776:G->C,D777:C] - 0 GTTGCCCGGG-ACCCTTCAGGCCCGTAAAAGCATCGTGTGTTCCTGCATGCCTT-CCGCTTC-GGAATA---GCTGGTGGATGGCATACTTACACTCAC--GGCTGGTATTCGCTACTACTTCCTG-CATAT-CCGATCCCCTTGATGGGGGCACCAATACTATTATCCGGGGG-TAGTTATCACTGTCCGTTAACCCTTGAAAACGCGTTAGGTTTCGAAAGAGCACTTAGTCCTTGGGCGTCAAGCAATTTGTGCGGCCTTCAAA-CAACGACCGTGTCCTAGCGATTAACCGTATTTGTCAGAGC-GGCAGGATTATTGCTGACGACC-TCTCCAACATGTAGTGCAGTTGTAGGTATGGC-GGCGAAGGTTATGAGGCTTAGGTGCAAAGAA-TTGTTAAAACTCTATAACATCGG-TTTAGGTT-GGTACGAGTAAGCCACTTCGAGACGTGT-GGTGAGTGTCTATTGCTGAATGTAGCCCCCATTTGTCTGG--TCTCAATCAGAAGTGTGAGATCTATAAATATCCCCGTATTTACA-TTCATAATTGGAATTATAC--GGTACAAACCGGTATTTAGCGCGATAGTCCGTGCGAATGAGAT-GGACAGTGTGGCGTC-TTTGTC-GGCGGAACTACAATGCGTCAGATTGCGTAAAAATCATTGACATACGTCGGGAATCACCACTTCGCCGTCATAT--CTTTAGAT-GGTATC-GATGGAGATATGTTGGTAACCCAGA-GGGT-AACTCCGC-GAATTCTTTGGGACG---CATTATTATCAGCGTTAAGCCGGTGTTTT-GGCTCGTCGCAGCTTCCC 792 - |||||||||| || ||||||||||||||||||||||||||||||||||||||| | ||||| | ||| | |||||||||||||||||| | | ||||||||||||||||||||||||| ||| | |||||||||||||||||||||||||||||||||| |||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| || |||||||||||||||||||||||||||||||||||||||| | |||||||||||||||||| | |||||||||||||||||||||||||||||||| | ||||||||||||||||||||||||||||| | ||||||||||||||||||||| || ||||| | |||||||||||||||||||||||||| | |||||||||||||||||||||||||||||||||||||| | ||||||||||||||||||||||||||||||||||||||||| | |||||||| | || ||||||||||||||||||||||||||||||||||||||||||| | ||||||||||||| | |||| | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| | |||||||| | |||| |||||||||||||||||||||| || | | |||||| | |||| | | ||||||||||||||||||||||||||||| | ||||||||||||||| - 0 GTTGCCCGGGACCC-TTCAGGCCCGTAAAAGCATCGTGTGTTCCTGCATGCCTTCC-GCTTCGGA-ATAGCTG---GTGGATGGCATACTTACA--CTCACGGCTGGTATTCGCTACTACTTCCTGCA-TATCC-GATCCCCTTGATGGGGGCACCAATACTATTATCC-GGGGGTAGTTATCACTGTCCGTTAACCCTTGAAAACGCGTTAGGTTTCGAAAGAGCACTTAGTCCTTGGGCGTCAAGCAATTTGTGCGGCCTTC-AAACAACGACCGTGTCCTAGCGATTAACCGTATTTGTCAGAGCGG-CAGGATTATTGCTGACGA-CCTCTCCAACATGTAGTGCAGTTGTAGGTATGGCGG-CGAAGGTTATGAGGCTTAGGTGCAAAGAATT-GTTAAAACTCTATAACATCGGTTT-AGGTTGG-TACGAGTAAGCCACTTCGAGACGTGTGG-TGAGTGTCTATTGCTGAATGTAGCCCCCATTTGTCTGGTCT--CAATCAGAAGTGTGAGATCTATAAATATCCCCGTATTTACATTCA-TAATTGGA-AT-TATACGGTACAAACCGGTATTTAGCGCGATAGTCCGTGCGAATGAGATGG-ACAGTGTGGCGTCTT-TGTCGGC-GGAACTACAATGCGTCAGATTGCGTAAAAATCATTGACATACGTCGGGAATCACCACTTCGCCGTCA--TATCTTTAGATGG-TATCGAT-GGAGATATGTTGGTAACCCAGAGGG-TAA-CTCCGCGAA-TTCT--TTG-GGACGCATTATTATCAGCGTTAAGCCGGTGTTTTGGC-TCGTCGCAGCTTCCC 792 + 207 ATCTCCAGAGACAATGCCAAGAACTCACTG 236 + |||||||||||||| ||||||||||||||| + 207 ATCTCCAGAGACAACGCCAAGAACTCACTG 236 -com.milaboratory.core.merger.MergerParametersTest > test2 STANDARD_OUT - { - "qualityMergingAlgorithm": "SumSubtraction", - "partsLayout": "Collinear", - "minimalOverlap": 15, - "maxQuality": 50, - "minimalIdentity": 0.8, - "identityType": "Unweighted" - } + 237 TATCTGCAAATGAACAGCCTGAGAGACGAG 266 + ||||||||||||||||||||||||| |||| + 237 TATCTGCAAATGAACAGCCTGAGAGCCGAG 266 -com.milaboratory.core.RangeTest > test23e14 STANDARD_OUT - 1000001 - 1010100 - 1000111 - 1000011 + 267 GACACGGCTGTGTATTACTGTGC 289 + ||||||||||||||||||||||| + 267 GACACGGCTGTGTATTACTGTGC 289 - 1000010 -com.milaboratory.core.motif.BitapPatternTest > ttt STANDARD_OUT - 0 ATTWCCGACA 9 - ||| |||| - 20 ATTT--GACA 27 - [S3:W->T,D4:C,D5:C] - 24 - -26 +com.milaboratory.core.alignment.AlignerCustomTest > testSemiLocal0 STANDARD_OUT + 29.0 + 2 c----cccTTgaa---tgTtaGTa-----taacta--tct 27 + 0 cAGTTccc--gaaACCtgCta--aGCTCTtaactaCTtct 35 + 29.0 + 2 c----cccTTgaa---tgTtaGTa-----taacta--tct 27 + 0 cAGTTccc--gaaACCtgCta--aGCTCTtaactaCTtct 35 -com.milaboratory.core.alignment.MultiAlignmentHelperTest > test1 STANDARD_OUT +com.milaboratory.core.alignment.AlignmentTest > testInvert STANDARD_OUT 8 AGACACAGATACA 20 ||||||| ||||| 0 AGACACATATACA 12 + 0 AGACACATATACA 12 + ||||||| ||||| + 8 AGACACAGATACA 20 0 GATACATTAGACACAGATACA--- 20 ||||||| ||||| 0 --------AGACACATATACACAG 15 + 0 --------AGACACATATACACAG 15 + ||||||| ||||| + 0 GATACATTAGACACAGATACA--- 20 0 GATACATTAGA---CACAGATACA 20 ||||||||||| |||||||||| 5 GATACATTAGAGACCACAGATACA 28 + 5 GATACATTAGAGACCACAGATACA 28 + ||||||||||| |||||||||| + 0 GATACATTAGA---CACAGATACA 20 0 GATAC-----ATTAGA---CACAGATACA 20 ||||| |||||| |||||||||| 0 GATACGATACATTAGAGACCACAGATACA 28 + 0 GATACGATACATTAGAGACCACAGATACA 28 + ||||| |||||| |||||||||| + 0 GATAC-----ATTAGA---CACAGATACA 20 - Quality 78778 878777 7778887878 - Subject 0 GATAC-----ATTAGA---CACAGATACA--- 20 - Query0 0 aga---cacaTataca 12 - Query1 0 -------------aga---cacaTatacaCAG 15 - Query2 5 gatac-----attagaGACcacagataca 28 - Query3 0 gatacGATACattagaGACcacagataca 28 - - Quality 78778 - Subject 0 GATAC 4 - Query1 0 ----- 0 - Query2 5 gatac 9 - Query3 0 gatac 4 - - Quality - Subject 5 ----- 5 - Query1 0 ----- 0 - Query2 10 ----- 10 - Query3 5 GATAC 9 - - Quality 87877 - Subject 5 ATTAG 9 - Query0 0 ag 1 - Query1 0 ---ag 1 - Query2 10 attag 14 - Query3 10 attag 14 - - Quality 7 7 - Subject 10 A---C 11 - Query0 2 a---c 3 - Query1 2 a---c 3 - Query2 15 aGACc 19 - Query3 15 aGACc 19 - - Quality 77888 - Subject 12 ACAGA 16 - Query0 4 acaTa 8 - Query1 4 acaTa 8 - Query2 20 acaga 24 - Query3 20 acaga 24 - - Quality 7878 - Subject 17 TACA- 20 - Query0 9 taca 12 - Query1 9 tacaC 13 - Query2 25 taca 28 - Query3 25 taca 28 - - Quality - Subject 21 -- 21 - Query1 14 AG 15 - - 0 GATAC-----ATTAGA---CACAGATACA--- 20 - 0 ...---....T..... 12 - 0 -------------...---....T.....CAG 15 - 5 .....-----......GAC.......... 28 - 0 .....GATAC......GAC.......... 28 - - 787788787777778887878 - 0 GATACATTAGACACAGATACA 20 - -com.milaboratory.core.alignment.MultiAlignmentHelperTest > test2 STANDARD_OUT - 15 TATAGGGAGAACTCCGATCGACATCG 40 - ||||||||| ||||||||||||||| - 0 TATAGGGAG--CTCCGATCGACATCG 23 - - 56 CGATCC--CGGTGACAAAGCGTTCGGACC 82 - |||||| ||||||||||||||||||||| - 0 CGATCCTTCGGTGACAAAGCGTTCGGACC 28 - - 36 CATCGGGTATCGCCCTGGTACG 57 - |||| ||||||||||||||||| - 0 CATCAGGTATCGCCCTGGTACG 21 - - 0 AACGATGGGCGCAAATATAGGGAGAACTCCGATCGACATCGGGTATCGCCCTGGTACGATCC--CGGTGACAAAGCGTTCGGACCTGTCTGGACGCTAGAACGC 101 - 0 tatagggag--ctccgatcgacatcg 23 - 0 cgatccTTcggtgacaaagcgttcggacc 28 - 0 catcAggtatcgccctggtacg 21 - -com.milaboratory.core.alignment.blast.BlastAlignerExtTest > test16SMicrobial1 SKIPPED - -com.milaboratory.core.alignment.blast.BlastAlignerExtTest > test1 SKIPPED - -com.milaboratory.core.alignment.blast.BlastAlignerTest > test1 SKIPPED - -com.milaboratory.core.alignment.blast.BlastAlignerTest > simpleRandomTestT1 SKIPPED - -com.milaboratory.core.alignment.blast.BlastAlignerTest > simpleRandomTestT2 SKIPPED - -com.milaboratory.core.alignment.blast.BlastAlignerTest > simpleRandomTestT3 SKIPPED -com.milaboratory.core.alignment.blast.BlastDBBuilderTest > test1 SKIPPED +com.milaboratory.core.alignment.AlignmentIteratorTest > test1 STANDARD_OUT + 0 -ATT-AGACA-- 7 + ||| || | + 0 AATTGGGA-ATT 10 + I0AI3GSA3GDC6I8TI8T com.milaboratory.core.alignment.BandedAffineAlignerTest > test11 STANDARD_OUT 0 --------------------- -1 @@ -2852,43 +2638,38 @@ 1 gAccCtgtgatgacccagactccagcctccgtgTCTgAaCctgtgggaggcacagtcaccatcaagtgccaggccagtcagagcattagcaacctctta-------------------------------------------------------------NNNcatctggggtctcatcaaggttcaaaggcagtggatctgggacagagtTcactctcaccatcagCggcgtgcagtgtgccgatgctgccacttactac 200 com.milaboratory.core.alignment.AlignerTest > testCalculateScore1 STANDARD_OUT - 8.39us - 7.51us - 5.08us - -com.milaboratory.core.alignment.AlignmentIteratorTest > test1 STANDARD_OUT - 0 -ATT-AGACA-- 7 - ||| || | - 0 AATTGGGA-ATT 10 - I0AI3GSA3GDC6I8TI8T + 24.25us + 21.47us + 14.21us + Gradle is still running, please be patient... -com.milaboratory.core.alignment.kaligner2.KAligner2Test > testBoundaries STANDARD_OUT - 4967 +com.milaboratory.core.alignment.BandedLinearAlignerTest > testCase1 STANDARD_OUT + GCGTGAAGACTGCAGGCATTGAGTACGTTACTAGTCCAGTGGGGCCCAACCGTAACATTGCGTGTGACTGGTTGCTTAGCGGGTGACGGCGTTTCAGGTTACGCCCTCTGTGCATCACCGATAGCGTTGTTTGAGCTTTCTAACGTCTCAAACCTGCTTGCGCCCTACGGTTTCTCTATATATACACGAAAGGGGCTGGTCGCAACCTCGCAATTCTATCCCTCCAACCTCCCTCGAATTTTT + AAAGCGTGAAGACTTGCAGGCATTGGTACGTTATTAGTCCAGTGGGGCCACAACCGTAACATTGCGTGTGACTGGTGCTTAGCGGGTGACGGCGTTCAGGTTACGCCCTCTGTGCATCACCGATTAGCGTTGTCTGAGCTTTCTAACGTCTCAAACCTGCTTGCGCCCTACGGTTTCTCTATAGTATCACGAAAGGGTCTGGTCGCAACCTCGCAATTCTATCCCTCCAACCTCCCTTGAATTTTTCTA -com.milaboratory.core.alignment.kaligner2.KAligner2Test > caseJ1 STANDARD_OUT - 52 - 0 TGATGCTTTTGATATCTGGGGCCAAGGGACAATGGTCACCGTCTCTTCAGGA 51 - ||||||||||||||||||||||||||||||||||||||||||||||||||| - 55 TGATGCTTTTGATATCTGGGGCCAAGGGACAATGGTCACCGTCTCTTCAGGG 106 - [S51:A->G] - (0->52) - (55->107) +com.milaboratory.core.alignment.BandedLinearAlignerTest > testGlobal1 STANDARD_OUT + 1 AATTGACA 8 + |||||| + 0 TATTGACT 7 -com.milaboratory.core.alignment.kaligner2.KAligner2Test > testCase0 SKIPPED - Gradle is still running, please be patient... +com.milaboratory.core.alignment.BandedLinearAlignerTest > testGlobal2 STANDARD_OUT + 1 AATTGACAG 9 + |||||| | + 0 TATTGAC-G 7 -com.milaboratory.core.alignment.kaligner2.KAligner2Test > testSimpleRandomTest STANDARD_OUT - Time per query: 8.20ms - Processed queries: 7 - Bad percent: 0.0 - False positive percent: 0.5809128630705395 - Scoring error percent: 0.0 +com.milaboratory.core.alignment.BandedLinearAlignerTest > testGlobal3 STANDARD_OUT + 0 TATTGACT 7 + |||||| + 1 AATTGACA 8 -com.milaboratory.core.alignment.kaligner2.OffsetPacksAccumulatorTest > testScoreCorrection2 SKIPPED +com.milaboratory.core.alignment.BandedLinearAlignerTest > testGlobal4 STANDARD_OUT + 0 TATTGAC-G 7 + |||||| | + 1 AATTGACAG 9 com.milaboratory.core.alignment.kaligner2.KMapper2Test > test11112 STANDARD_OUT ID: 0 - Score: 1665 + Score: 1770 Cluster 0: Q 27 -> T 15 - -12 Q 30 -> T 18 - -12 @@ -2904,6 +2685,8 @@ Q 93 -> T 59 - -34 Q 96 -> T 62 - -34 Q 99 -> T 65 - -34 + Q 102 -> T 68 - -34 + Q 111 -> T 79 - -32 Q 114 -> T 82 - -32 Cluster 2: Q 150 -> T 92 - -58 @@ -2911,12 +2694,12 @@ Q 156 -> T 98 - -58 Q 159 -> T 101 - -58 Cluster 3: - Q 198 -> T 120 - -78 Q 201 -> T 123 - -78 Q 204 -> T 126 - -78 Q 207 -> T 129 - -78 Q 216 -> T 139 - -77 Q 219 -> T 142 - -77 + Q 222 -> T 145 - -77 Q 231 -> T 153 - -78 Q 234 -> T 156 - -78 Q 237 -> T 159 - -78 @@ -2933,7 +2716,7 @@ com.milaboratory.core.alignment.kaligner2.KMapper2Test > test1111 STANDARD_OUT ID: 0 - Score: 1206 + Score: 1257 Cluster 0: Q 9 -> T 15 - 6 Q 12 -> T 18 - 6 @@ -2945,8 +2728,8 @@ Q 30 -> T 36 - 6 Cluster 1: Q 57 -> T 48 - -9 - Q 60 -> T 51 - -9 Q 69 -> T 61 - -8 + Q 78 -> T 69 - -9 Q 81 -> T 72 - -9 Q 84 -> T 75 - -9 Q 87 -> T 78 - -9 @@ -2962,16 +2745,17 @@ Q 174 -> T 138 - -36 Q 177 -> T 141 - -36 Q 180 -> T 144 - -36 + Q 183 -> T 147 - -36 Q 185 -> T 149 - -36 com.milaboratory.core.alignment.kaligner2.KMapper2Test > testRandom1 STANDARD_OUT - noHits: 265 + noHits: 319 noHits2: 0 noHits3: 0 - wrongTopHit: 42 - wrongTopHitS: 28 - noCorrectHitInList: 20 + wrongTopHit: 40 + wrongTopHitS: 23 + noCorrectHitInList: 15 @@ -2979,13 +2763,13 @@ Timings: DescriptiveStatistics: n: 100000 - min: 12738.0 - max: 1.341385159E9 - mean: 501236.4706300188 - std dev: 8481027.150666695 - median: 206341.0 - skewness: 115.55915758613185 - kurtosis: 15143.729588782413 + min: 49336.0 + max: 1.629609846E9 + mean: 814562.929270187 + std dev: 1.2666179029481351E7 + median: 521364.0 + skewness: 97.33264044772457 + kurtosis: 10305.781637677557 @@ -2993,14 +2777,14 @@ Clusters basicSize DescriptiveStatistics: - n: 99693 + n: 99641 min: 1.0 max: 6.0 - mean: 2.8441314836548326 - std dev: 1.096179981455982 + mean: 2.876867955961902 + std dev: 1.110830829601105 median: 3.0 - skewness: 0.3137727099557269 - kurtosis: -0.6560879927001659 + skewness: 0.27350970870742597 + kurtosis: -0.7108314509884743 @@ -3008,60 +2792,168 @@ Top Delta DescriptiveStatistics: - n: 99715 + n: 99666 min: -19.0 max: 0.0 - mean: -0.0012134583563152288 - std dev: 0.14115777944866573 + mean: -0.001113719824212096 + std dev: 0.12909140230075208 median: 0.0 - skewness: -122.07259593272437 - kurtosis: 15358.139874738128 + skewness: -122.7303270223829 + kurtosis: 15716.514367360038 -com.milaboratory.core.alignment.AlignmentTest > testInvert STANDARD_OUT +com.milaboratory.core.alignment.kaligner2.OffsetPacksAccumulatorTest > testScoreCorrection2 SKIPPED + +com.milaboratory.core.alignment.kaligner2.KAligner2Test > testBoundaries STANDARD_OUT + 4959 + +com.milaboratory.core.alignment.kaligner2.KAligner2Test > caseJ1 STANDARD_OUT + 52 + 0 TGATGCTTTTGATATCTGGGGCCAAGGGACAATGGTCACCGTCTCTTCAGGA 51 + ||||||||||||||||||||||||||||||||||||||||||||||||||| + 55 TGATGCTTTTGATATCTGGGGCCAAGGGACAATGGTCACCGTCTCTTCAGGG 106 + [S51:A->G] + (0->52) + (55->107) + +com.milaboratory.core.alignment.kaligner2.KAligner2Test > testCase0 SKIPPED + +com.milaboratory.core.alignment.kaligner2.KAligner2Test > testSimpleRandomTest STANDARD_OUT + Time per query: 24.46ms + Processed queries: 0 + Bad percent: NaN + False positive percent: 0.2457002457002457 + Scoring error percent: NaN + +com.milaboratory.core.alignment.kaligner2.KAligner2Test > testSimpleRandomTest FAILED + java.lang.AssertionError: Bad fraction = NaN + at org.junit.Assert.fail(Assert.java:89) + at org.junit.Assert.assertTrue(Assert.java:42) + at com.milaboratory.core.alignment.kaligner2.KAligner2Test.testSimpleRandomTest(KAligner2Test.java:123) + +com.milaboratory.core.alignment.batch.SimpleBatchAlignerTest > test1 STANDARD_OUT + 4 hits. + +com.milaboratory.core.alignment.AlignmentTrimmerTest > testRandom1 STANDARD_OUT + lTrimmed = 1752 + rTrimmed = 1650 + lTrimmed = 2811 + rTrimmed = 2763 + +com.milaboratory.core.alignment.blast.BlastAlignerTest > test1 SKIPPED + +com.milaboratory.core.alignment.blast.BlastAlignerTest > simpleRandomTestT1 SKIPPED + +com.milaboratory.core.alignment.blast.BlastAlignerTest > simpleRandomTestT2 SKIPPED + +com.milaboratory.core.alignment.blast.BlastAlignerTest > simpleRandomTestT3 SKIPPED + +com.milaboratory.core.alignment.blast.BlastAlignerExtTest > test16SMicrobial1 SKIPPED + +com.milaboratory.core.alignment.blast.BlastAlignerExtTest > test1 SKIPPED + +com.milaboratory.core.alignment.blast.BlastDBBuilderTest > test1 SKIPPED + +com.milaboratory.core.alignment.MultiAlignmentHelperTest > test1 STANDARD_OUT 8 AGACACAGATACA 20 ||||||| ||||| 0 AGACACATATACA 12 - 0 AGACACATATACA 12 - ||||||| ||||| - 8 AGACACAGATACA 20 0 GATACATTAGACACAGATACA--- 20 ||||||| ||||| 0 --------AGACACATATACACAG 15 - 0 --------AGACACATATACACAG 15 - ||||||| ||||| - 0 GATACATTAGACACAGATACA--- 20 0 GATACATTAGA---CACAGATACA 20 ||||||||||| |||||||||| 5 GATACATTAGAGACCACAGATACA 28 - 5 GATACATTAGAGACCACAGATACA 28 - ||||||||||| |||||||||| - 0 GATACATTAGA---CACAGATACA 20 0 GATAC-----ATTAGA---CACAGATACA 20 ||||| |||||| |||||||||| 0 GATACGATACATTAGAGACCACAGATACA 28 - 0 GATACGATACATTAGAGACCACAGATACA 28 - ||||| |||||| |||||||||| - 0 GATAC-----ATTAGA---CACAGATACA 20 + Quality 78778 878777 7778887878 + Subject 0 GATAC-----ATTAGA---CACAGATACA--- 20 + Query0 0 aga---cacaTataca 12 + Query1 0 -------------aga---cacaTatacaCAG 15 + Query2 5 gatac-----attagaGACcacagataca 28 + Query3 0 gatacGATACattagaGACcacagataca 28 -com.milaboratory.core.alignment.batch.SimpleBatchAlignerTest > test1 STANDARD_OUT - 4 hits. + Quality 78778 + Subject 0 GATAC 4 + Query1 0 ----- 0 + Query2 5 gatac 9 + Query3 0 gatac 4 -com.milaboratory.core.alignment.AlignmentTrimmerTest > testRandom1 STANDARD_OUT - lTrimmed = 1703 - rTrimmed = 1706 - lTrimmed = 2814 - rTrimmed = 2780 + Quality + Subject 5 ----- 5 + Query1 0 ----- 0 + Query2 10 ----- 10 + Query3 5 GATAC 9 + + Quality 87877 + Subject 5 ATTAG 9 + Query0 0 ag 1 + Query1 0 ---ag 1 + Query2 10 attag 14 + Query3 10 attag 14 + + Quality 7 7 + Subject 10 A---C 11 + Query0 2 a---c 3 + Query1 2 a---c 3 + Query2 15 aGACc 19 + Query3 15 aGACc 19 + + Quality 77888 + Subject 12 ACAGA 16 + Query0 4 acaTa 8 + Query1 4 acaTa 8 + Query2 20 acaga 24 + Query3 20 acaga 24 + + Quality 7878 + Subject 17 TACA- 20 + Query0 9 taca 12 + Query1 9 tacaC 13 + Query2 25 taca 28 + Query3 25 taca 28 + + Quality + Subject 21 -- 21 + Query1 14 AG 15 + + 0 GATAC-----ATTAGA---CACAGATACA--- 20 + 0 ...---....T..... 12 + 0 -------------...---....T.....CAG 15 + 5 .....-----......GAC.......... 28 + 0 .....GATAC......GAC.......... 28 + + 787788787777778887878 + 0 GATACATTAGACACAGATACA 20 + +com.milaboratory.core.alignment.MultiAlignmentHelperTest > test2 STANDARD_OUT + 15 TATAGGGAGAACTCCGATCGACATCG 40 + ||||||||| ||||||||||||||| + 0 TATAGGGAG--CTCCGATCGACATCG 23 + + 56 CGATCC--CGGTGACAAAGCGTTCGGACC 82 + |||||| ||||||||||||||||||||| + 0 CGATCCTTCGGTGACAAAGCGTTCGGACC 28 + + 36 CATCGGGTATCGCCCTGGTACG 57 + |||| ||||||||||||||||| + 0 CATCAGGTATCGCCCTGGTACG 21 + + 0 AACGATGGGCGCAAATATAGGGAGAACTCCGATCGACATCGGGTATCGCCCTGGTACGATCC--CGGTGACAAAGCGTTCGGACCTGTCTGGACGCTAGAACGC 101 + 0 tatagggag--ctccgatcgacatcg 23 + 0 cgatccTTcggtgacaaagcgttcggacc 28 + 0 catcAggtatcgccctggtacg 21 com.milaboratory.core.alignment.kaligner1.KAlignerTest > testRandomCorrectness STANDARD_OUT - C=1182;I=0;M=0;ScE=0;R=0.0 AlignmentTime = 3.20ms - C=1642;I=1;M=0;ScE=0;R=0.0 AlignmentTime = 2.51ms - C=2048;I=0;M=0;ScE=0;R=0.0 AlignmentTime = 798.83us - C=2142;I=0;M=0;ScE=0;R=8.333333333333333E-7 AlignmentTime = 1.25ms + C=1182;I=0;M=0;ScE=0;R=0.0 AlignmentTime = 4.35ms + C=1642;I=1;M=0;ScE=0;R=0.0 AlignmentTime = 1.92ms + C=2048;I=0;M=0;ScE=0;R=0.0 AlignmentTime = 957.05us + C=2142;I=0;M=0;ScE=0;R=8.333333333333333E-7 AlignmentTime = 1.09ms com.milaboratory.core.alignment.kaligner1.KAlignerTest > testRandom1 STANDARD_OUT ##teamcity[buildStatisticValue key='kmFound' value='0.9449'] @@ -3069,1580 +2961,484 @@ ##teamcity[buildStatisticValue key='kmFalse' value='0.0058'] com.milaboratory.core.alignment.kaligner1.KAlignerTest > testRandomCorrectnessConcurrent STANDARD_OUT - C=2998;I=0;M=0;ScE=0;R=0.0 AlignmentTime = 4.80ms - C=2999;I=0;M=0;ScE=0;R=0.0 AlignmentTime = 5.33ms - C=3000;I=0;M=0;ScE=0;R=0.0 AlignmentTime = 2.88ms - C=2994;I=0;M=2;ScE=0;R=8.333333333333333E-7 AlignmentTime = 912.38us + C=2998;I=0;M=0;ScE=0;R=0.0 AlignmentTime = 7.87ms + C=2999;I=0;M=0;ScE=0;R=0.0 AlignmentTime = 10.28ms + C=2995;I=0;M=0;ScE=0;R=0.0 AlignmentTime = 4.53ms + C=2997;I=0;M=1;ScE=1;R=0.0 AlignmentTime = 2.07ms com.milaboratory.core.alignment.kaligner1.KMapperTest > testBestOffset2 STANDARD_OUT -205 -com.milaboratory.core.alignment.AlignmentHelperTest > test1 STANDARD_OUT - 0 GAGGTGCAGCTGGTGGAGTCTGGGGGAGGC 29 - |||||||||||||||||||||||||||||| - 0 GAGGTGCAGCTGGTGGAGTCTGGGGGAGGC 29 +com.milaboratory.core.sequence.GeneticCodeTest > generateExtendedGeneticCode SKIPPED - 30 TTGGT-ACAGCCTGGGGGGTCCCTGAGACT 58 - |||| | |||||||||||||| |||||| - 30 CTGGTCA-AGCCTGGGGGGTCCATGAGACA 58 +com.milaboratory.core.sequence.NucleotideAlphabetTest > testCalculateIntersections SKIPPED - 59 CTCCTGTGCAGCCTCTGGATTCACCTTCAG 88 - |||||||||||||||||||||| ||||||| - 59 CTCCTGTGCAGCCTCTGGATTCCCCTTCAG 88 +com.milaboratory.core.sequence.ShortSequenceSetTest > test1 STANDARD_OUT + 99949 elements with 366.3KiB in raw nucleotide entropy serialized into 273.18KiB - 89 TAGC-TATAGCATGAACTGGGTCCGCCAGG 117 - || | ||||||||||||||||||||||||| - 89 TA-CTTATAGCATGAACTGGGTCCGCCAGG 117 +com.milaboratory.core.sequence.AminoAcidAlphabetTest > testCalculateMatches SKIPPED - 118 CTCCAGGGAAGGGGCTGGAGTGGGTTTCAT 147 - ||||||||||||||||||||||||| |||| - 118 CTCCAGGGAAGGGGCTGGAGTGGGTCTCAT 147 +com.milaboratory.core.sequence.quality.QualityTrimmerTest > testParametersSerialization0 STANDARD_OUT + { + "averageQualityThreshold": 7.0, + "windowSize": 6 + } - 148 ACATTAGTAGTAGTAGTAG-TACCATATAC 176 - |||||||||| ||||||| || |||||| - 148 CCATTAGTAGTGGTAGTAGTTA-CATATAT 176 +com.milaboratory.core.sequence.quality.QualityAggregatorTest > test1 STANDARD_OUT + 35 - 177 TACGCAGACTCTGTGAAGGGCCGATTCACC 206 - ||||||||||| |||||||||||||||||| - 177 TACGCAGACTCCGTGAAGGGCCGATTCACC 206 +com.milaboratory.core.sequence.quality.QualityAggregatorTest > test2 STANDARD_OUT + 618 - 207 ATCTCCAGAGACAATGCCAAGAACTCACTG 236 - |||||||||||||| ||||||||||||||| - 207 ATCTCCAGAGACAACGCCAAGAACTCACTG 236 +com.milaboratory.core.sequence.quality.QualityAggregatorTest > test3 STANDARD_OUT + 2465 - 237 TATCTGCAAATGAACAGCCTGAGAGACGAG 266 - ||||||||||||||||||||||||| |||| - 237 TATCTGCAAATGAACAGCCTGAGAGCCGAG 266 +com.milaboratory.core.sequence.AminoAcidSequenceTest > testName STANDARD_OUT + 3 - 267 GACACGGCTGTGTATTACTGTGC 289 - ||||||||||||||||||||||| - 267 GACACGGCTGTGTATTACTGTGC 289 +com.milaboratory.core.sequence.AminoAcidSequenceTest > testConvertPositionSync1 STANDARD_OUT + FromCenter + 2 + 3 + 4 + 5 + 6 + 7 + 8 + 9 + 10 + 11 + 12 + 13 + 14 + 15 + 16 + 17 + 18 + 19 + FromLeftWithoutIncompleteCodon + 2 + 3 + 4 + 5 + 6 + 7 + 8 + 9 + 10 + 11 + 12 + 13 + 14 + 15 + 16 + 17 + 18 + 19 + FromLeftWithIncompleteCodon + 2 + 3 + 4 + 5 + 6 + 7 + 8 + 9 + 10 + 11 + 12 + 13 + 14 + 15 + 16 + 17 + 18 + 19 + FromRightWithoutIncompleteCodon + 2 + 3 + 4 + 5 + 6 + 7 + 8 + 9 + 10 + 11 + 12 + 13 + 14 + 15 + 16 + 17 + 18 + 19 + FromRightWithIncompleteCodon + 2 + 3 + 4 + 5 + 6 + 7 + 8 + 9 + 10 + 11 + 12 + 13 + 14 + 15 + 16 + 17 + 18 + 19 +com.milaboratory.core.motif.BitapPatternTest > ttt STANDARD_OUT + 0 ATTWCCGACA 9 + ||| |||| + 20 ATTT--GACA 27 + [S3:W->T,D4:C,D5:C] + 24 + -26 + Gradle is still running, please be patient... -com.milaboratory.core.alignment.AlignerCustomTest > testSemiLocal0 STANDARD_OUT - 29.0 - 2 c----cccTTgaa---tgTtaGTa-----taacta--tct 27 - 0 cAGTTccc--gaaACCtgCta--aGCTCTtaactaCTtct 35 - 29.0 - 2 c----cccTTgaa---tgTtaGTa-----taacta--tct 27 - 0 cAGTTccc--gaaACCtgCta--aGCTCTtaactaCTtct 35 +com.milaboratory.core.tree.PrimerGenerator > generate SKIPPED -com.milaboratory.core.alignment.BandedLinearAlignerTest > testCase1 STANDARD_OUT - GCGTGAAGACTGCAGGCATTGAGTACGTTACTAGTCCAGTGGGGCCCAACCGTAACATTGCGTGTGACTGGTTGCTTAGCGGGTGACGGCGTTTCAGGTTACGCCCTCTGTGCATCACCGATAGCGTTGTTTGAGCTTTCTAACGTCTCAAACCTGCTTGCGCCCTACGGTTTCTCTATATATACACGAAAGGGGCTGGTCGCAACCTCGCAATTCTATCCCTCCAACCTCCCTCGAATTTTT - AAAGCGTGAAGACTTGCAGGCATTGGTACGTTATTAGTCCAGTGGGGCCACAACCGTAACATTGCGTGTGACTGGTGCTTAGCGGGTGACGGCGTTCAGGTTACGCCCTCTGTGCATCACCGATTAGCGTTGTCTGAGCTTTCTAACGTCTCAAACCTGCTTGCGCCCTACGGTTTCTCTATAGTATCACGAAAGGGTCTGGTCGCAACCTCGCAATTCTATCCCTCCAACCTCCCTTGAATTTTTCTA +com.milaboratory.core.tree.SequenceTreeMapTest > testCase9 STANDARD_OUT + Hit 1 + 0 ac-gacTtgactg 11 + 0 acTgac-tgactg 11 -com.milaboratory.core.alignment.BandedLinearAlignerTest > testGlobal1 STANDARD_OUT - 1 AATTGACA 8 - |||||| - 0 TATTGACT 7 + Hit 2 + 0 ac-gactTgactg 11 + 0 acTgact-gactg 11 -com.milaboratory.core.alignment.BandedLinearAlignerTest > testGlobal2 STANDARD_OUT - 1 AATTGACAG 9 - |||||| | - 0 TATTGAC-G 7 -com.milaboratory.core.alignment.BandedLinearAlignerTest > testGlobal3 STANDARD_OUT - 0 TATTGACT 7 - |||||| - 1 AATTGACA 8 +com.milaboratory.core.tree.SequenceTreeMapTest > optimalityAndScopeTest STANDARD_OUT + --NW alignments-- + CASSLAPGATN-KLFF + CASS-APGATNEKLFF -com.milaboratory.core.alignment.BandedLinearAlignerTest > testGlobal4 STANDARD_OUT - 0 TATTGAC-G 7 - |||||| | - 1 AATTGACAG 9 + CASSLAPGATN-KLFF + CASSLAPG-TNEKLFF -com.milaboratory.test.TestUtil > testLT STANDARD_OUT - Short tests. - No system env properties. + CASSLAPGATN-KLfF + CASSLAPG-TNEKLyF -com.milaboratory.util.VersionInfoTest > test3 SKIPPED + --STM alignments-- + CASSLAPGATN-KLFF + CASS-APGATNEKLFF -com.milaboratory.util.ByteStringTest > testSpeed1 STANDARD_OUT - Time per hash: 1.63us - Addition to hash set (per operation): 7.17us - Hash set removal (per operation): 3.71us - b + CASSLAPGATN-KLFF + CASSLAPG-TNEKLFF -com.milaboratory.util.RemoveActionTest > test1 STANDARD_OUT - /tmp/milib_3c46d72f844cb302cdfe10b50e73b42b3c0a14033509164381156177478 + CASSlAPGATN-KLFF + CASSa-PGATNEKLFF -com.milaboratory.util.RemoveActionTest > test2 STANDARD_OUT - /tmp/milib_66a965c9c66418719d0e16c0c9d99eae88bbc0565404239152299951793.tmp + CASSLAPGaTN-KLFF + CASSLAPGt-NEKLFF -com.milaboratory.util.JsonOverriderTest > test1 STANDARD_OUT - WARNING: unnecessary override -Ob= with the same value. + CASSlAPGATN-KLFF + CA-SsAPGATNEKLFF -com.milaboratory.util.CacheTest > test1 STANDARD_OUT - Cache misses:400 - Cache hits:800 + CASSlAPGATN-KLFF + CAS-sAPGATNEKLFF -com.milaboratory.util.IntCombinationsTest > test1 STANDARD_OUT - [0, 1] - [0, 2] - [1, 2] + CASSLAPGATNk-LFF + CASS-APGATNeKLFF -com.milaboratory.util.sorting.SortingUtilTest > test1 STANDARD_OUT - Collation: 991.45ms - Sorting: 481.21ms - 1 - 217 - 41478 - 99537 - 99999 + CASSLAPGaTN-KLFF + CASSLAP-gTNEKLFF -com.milaboratory.util.sorting.HashSorterTest > testSingleton STANDARD_OUT - /tmp/milib_11459a7f8ed93ef6867a583beecd816823a61f5f16032856083478984307 - timeInCollate: 44.52s - timeInCollatorInit: 29.91s - timeAwaitingO: 34.1ms - timeAwaitingI: 7.76s - timeInFinalSorting1: 0ns - timeInFinalSorting2: 133.08ms - timeInFinalSorting3: 276.48ms - /8S (5|27|32): objs=50000 size=3.18MiB + CASSLAPGATNk-LFF + CASSLAPG-TNeKLFF -com.milaboratory.util.sorting.HashSorterTest > test1 STANDARD_OUT - /tmp/milib_8374c26a3e38966571b4d576a63e106712c27b2412905336616831267225 - Gradle is still running, please be patient... - timeInCollate: 2.15m - timeInCollatorInit: 6.14s - timeAwaitingO: 13.42s - timeAwaitingI: 30.88s - timeInFinalSorting1: 15.24s - timeInFinalSorting2: 14.7s - timeInFinalSorting3: 3.84s - /0N (5|27|32): objs=156403 size=9.15MiB - /1N (5|27|32): objs=151939 size=8.39MiB - /2N (5|27|32): objs=161804 size=9.23MiB - /3N (5|27|32): objs=150232 size=8.41MiB - /4N (5|27|32): objs=143722 size=7.86MiB - /5N (5|27|32): objs=149708 size=8.36MiB - /6N (5|27|32): objs=154969 size=8.7MiB - /7N (5|27|32): objs=151091 size=8.61MiB - /8N (5|27|32): objs=151208 size=8.23MiB - /9N (5|27|32): objs=158907 size=9.01MiB - /10N (5|27|32): objs=164979 size=9.33MiB - /11N (5|27|32): objs=161276 size=9.25MiB - /12N (5|27|32): objs=161507 size=9.27MiB - /13N (5|27|32): objs=160137 size=9.06MiB - /14N (5|27|32): objs=156707 size=8.89MiB - /15N (5|27|32): objs=162754 size=9.26MiB - /16N (5|27|32): objs=152396 size=8.51MiB - /17N (5|27|32): objs=159178 size=9.06MiB - /18N (5|27|32): objs=151231 size=8.63MiB - /19N (5|27|32): objs=158684 size=9.18MiB - /20N (5|27|32): objs=163566 size=9.47MiB - /21N (5|27|32): objs=167450 size=9.5MiB - /22N (5|27|32): objs=163397 size=9.72MiB - /23N (5|27|32): objs=144610 size=8.03MiB - /24N (5|27|32): objs=148727 size=8.35MiB - /25N (5|27|32): objs=155663 size=8.74MiB - /26N (5|27|32): objs=154125 size=8.69MiB - /27N (5|27|32): objs=156229 size=8.88MiB - /28N (5|27|32): objs=154378 size=8.61MiB - /29N (5|27|32): objs=156404 size=8.9MiB - /30N (5|27|32): objs=164590 size=9.77MiB - /31N (5|27|32): objs=152029 size=8.46MiB - /0/0N (2|25|36): objs=42014 size=958.12KiB - /0/1N (2|25|36): objs=39693 size=915.35KiB - /0/2N (2|25|36): objs=23210 size=331.19KiB - /0/3S (2|25|36): objs=151 size=185B - /0/4N (2|25|36): objs=14681 size=93.91KiB - /0/5N (2|25|36): objs=4549 size=21.98KiB - /0/6S (2|25|36): objs=163 size=286B - /0/7N (2|25|36): objs=1409 size=5.71KiB - /0/8S (2|25|36): objs=157 size=277B - /0/9S (2|25|36): objs=123 size=115B - /0/10S (2|25|36): objs=136 size=297B - /0/11N (2|25|36): objs=3531 size=16.08KiB - /0/12S (2|25|36): objs=146 size=218B - /0/13N (2|25|36): objs=2165 size=9.33KiB - /0/14S (2|25|36): objs=155 size=258B - /0/15N (2|25|36): objs=460 size=1.74KiB - /0/16S (2|25|36): objs=138 size=152B - /0/17N (2|25|36): objs=1656 size=7.05KiB - /0/18S (2|25|36): objs=163 size=215B - /0/19N (2|25|36): objs=2765 size=11.79KiB - /0/20S (2|25|36): objs=151 size=281B - /0/21N (2|25|36): objs=2871 size=12.57KiB - /0/22S (2|25|36): objs=143 size=142B - /0/23N (2|25|36): objs=298 size=908B - /0/24S (2|25|36): objs=156 size=211B - /0/25N (2|25|36): objs=299 size=727B - /0/26S (2|25|36): objs=160 size=257B - /0/27N (2|25|36): objs=1544 size=6.35KiB - /0/28S (2|25|36): objs=150 size=86B - /0/29N (2|25|36): objs=1406 size=5.66KiB - /0/30S (2|25|36): objs=161 size=93B - /0/31N (2|25|36): objs=3638 size=16.89KiB - /0/32S (2|25|36): objs=148 size=119B - /0/33N (2|25|36): objs=2853 size=12.39KiB - /0/34S (2|25|36): objs=153 size=165B - /0/35N (2|25|36): objs=4807 size=23.49KiB - /1/0N (2|25|36): objs=35438 size=710.08KiB - /1/1N (2|25|36): objs=41103 size=918.37KiB - /1/2N (2|25|36): objs=39208 size=799.4KiB - /1/3N (2|25|36): objs=4757 size=21.8KiB - /1/4S (2|25|36): objs=178 size=106B - /1/5N (2|25|36): objs=760 size=3.12KiB - /1/6S (2|25|36): objs=173 size=102B - /1/7N (2|25|36): objs=841 size=3.25KiB - /1/8S (2|25|36): objs=175 size=196B - /1/9N (2|25|36): objs=1092 size=4.27KiB - /1/10S (2|25|36): objs=140 size=136B - /1/11N (2|25|36): objs=3042 size=13.27KiB - /1/12S (2|25|36): objs=149 size=224B - /1/13N (2|25|36): objs=5486 size=25.08KiB - /1/14S (2|25|36): objs=166 size=163B - /1/15N (2|25|36): objs=750 size=2.69KiB - /1/16S (2|25|36): objs=169 size=167B - /1/17N (2|25|36): objs=3538 size=15.95KiB - /1/18S (2|25|36): objs=153 size=271B - /1/19N (2|25|36): objs=299 size=922B - /1/20S (2|25|36): objs=162 size=204B - /1/21N (2|25|36): objs=1541 size=5.96KiB - /1/22S (2|25|36): objs=160 size=275B - /1/23N (2|25|36): objs=478 size=1.66KiB - /1/24S (2|25|36): objs=155 size=205B - /1/25N (2|25|36): objs=904 size=3.49KiB - /1/26S (2|25|36): objs=144 size=219B - /1/27N (2|25|36): objs=2842 size=13.45KiB - /1/28S (2|25|36): objs=150 size=202B - /1/29N (2|25|36): objs=1083 size=4.01KiB - /1/30S (2|25|36): objs=153 size=209B - /1/31N (2|25|36): objs=3523 size=15.84KiB - /1/32S (2|25|36): objs=160 size=181B - /1/33N (2|25|36): objs=2430 size=10.02KiB - /1/34S (2|25|36): objs=167 size=249B - /1/35N (2|25|36): objs=270 size=963B - /2/0N (2|25|36): objs=41481 size=926.49KiB - /2/1N (2|25|36): objs=42474 size=1.05MiB - /2/2N (2|25|36): objs=39022 size=798.16KiB - /2/3N (2|25|36): objs=17394 size=193.35KiB - /2/4S (2|25|36): objs=149 size=214B - /2/5S (2|25|36): objs=149 size=129B - /2/6S (2|25|36): objs=166 size=230B - /2/7N (2|25|36): objs=649 size=2.26KiB - /2/8S (2|25|36): objs=160 size=180B - /2/9N (2|25|36): objs=1219 size=5.5KiB - /2/10S (2|25|36): objs=168 size=198B - /2/11N (2|25|36): objs=789 size=3.36KiB - /2/12S (2|25|36): objs=144 size=323B - /2/13N (2|25|36): objs=567 size=1.95KiB - /2/14S (2|25|36): objs=169 size=104B - /2/15S (2|25|36): objs=135 size=128B - /2/16S (2|25|36): objs=154 size=206B - /2/17N (2|25|36): objs=706 size=2.74KiB - /2/18S (2|25|36): objs=155 size=312B - /2/19N (2|25|36): objs=3559 size=16.79KiB - /2/20S (2|25|36): objs=167 size=335B - /2/21N (2|25|36): objs=3931 size=19.59KiB - /2/22S (2|25|36): objs=180 size=127B - /2/23N (2|25|36): objs=1041 size=4.16KiB - /2/24S (2|25|36): objs=170 size=208B - /2/25N (2|25|36): objs=651 size=2.26KiB - /2/26S (2|25|36): objs=137 size=307B - /2/27S (2|25|36): objs=141 size=175B - /2/28S (2|25|36): objs=154 size=288B - /2/29N (2|25|36): objs=1489 size=6.07KiB - /2/30S (2|25|36): objs=153 size=217B - /2/31N (2|25|36): objs=726 size=2.77KiB - /2/32S (2|25|36): objs=155 size=318B - /2/33S (2|25|36): objs=151 size=87B - /2/34S (2|25|36): objs=119 size=261B - /2/35N (2|25|36): objs=3030 size=12.73KiB - /3/0N (2|25|36): objs=30406 size=405.93KiB - /3/1S (2|25|36): objs=133 size=105B - /3/2N (2|25|36): objs=8084 size=40.27KiB - /3/3N (2|25|36): objs=41005 size=831.81KiB - /3/4N (2|25|36): objs=30845 size=550.25KiB - /3/5S (2|25|36): objs=167 size=276B - /3/6N (2|25|36): objs=3874 size=17.98KiB - /3/7N (2|25|36): objs=14244 size=101.83KiB - /3/8S (2|25|36): objs=154 size=323B - /3/9N (2|25|36): objs=3670 size=15.89KiB - /3/10S (2|25|36): objs=155 size=271B - /3/11N (2|25|36): objs=325 size=924B - /3/12S (2|25|36): objs=162 size=99B - /3/14S (2|25|36): objs=178 size=303B - /3/15N (2|25|36): objs=1350 size=5.65KiB - /3/16S (2|25|36): objs=168 size=144B - /3/17N (2|25|36): objs=1750 size=7.43KiB - /3/18S (2|25|36): objs=147 size=279B - /3/19N (2|25|36): objs=782 size=2.88KiB - /3/20S (2|25|36): objs=147 size=209B - /3/21N (2|25|36): objs=3883 size=17.92KiB - /3/22S (2|25|36): objs=179 size=318B - /3/24S (2|25|36): objs=147 size=330B - /3/25N (2|25|36): objs=468 size=1.58KiB - /3/26S (2|25|36): objs=167 size=303B - /3/27N (2|25|36): objs=2449 size=10.14KiB - /3/28S (2|25|36): objs=161 size=245B - /3/29N (2|25|36): objs=922 size=3.81KiB - /3/30S (2|25|36): objs=129 size=163B - /3/31N (2|25|36): objs=322 size=1022B - /3/32S (2|25|36): objs=151 size=112B - /3/33N (2|25|36): objs=335 size=945B - /3/34S (2|25|36): objs=141 size=336B - /3/35N (2|25|36): objs=3032 size=13.01KiB - /4/0N (1|26|34): objs=72867 size=2.62MiB - /4/1N (1|26|34): objs=43686 size=1002.53KiB - /4/2S (1|26|34): objs=150 size=190B - /4/3N (1|26|34): objs=316 size=979B - /4/4S (1|26|34): objs=154 size=127B - /4/5N (1|26|34): objs=2749 size=11.54KiB - /4/6S (1|26|34): objs=163 size=267B - /4/7N (1|26|34): objs=1527 size=6.58KiB - /4/8S (1|26|34): objs=152 size=131B - /4/9N (1|26|34): objs=1531 size=6.48KiB - /4/10S (1|26|34): objs=168 size=203B - /4/11N (1|26|34): objs=284 size=807B - /4/12S (1|26|34): objs=127 size=245B - /4/13N (1|26|34): objs=1136 size=4.41KiB - /4/14S (1|26|34): objs=158 size=303B - /4/15N (1|26|34): objs=2774 size=13.14KiB - /4/16S (1|26|34): objs=160 size=136B - /4/17N (1|26|34): objs=3244 size=15.44KiB - /4/18S (1|26|34): objs=153 size=235B - /4/19N (1|26|34): objs=1825 size=7.64KiB - /4/20S (1|26|34): objs=149 size=262B - /4/22S (1|26|34): objs=145 size=294B - /4/23N (1|26|34): objs=2311 size=10.3KiB - /4/24S (1|26|34): objs=131 size=97B - /4/25N (1|26|34): objs=1060 size=4.21KiB - /4/26S (1|26|34): objs=156 size=150B - /4/27N (1|26|34): objs=1621 size=6.87KiB - /4/28S (1|26|34): objs=141 size=291B - /4/29N (1|26|34): objs=2606 size=11.73KiB - /4/30S (1|26|34): objs=136 size=198B - /4/31N (1|26|34): objs=445 size=1.53KiB - /4/32S (1|26|34): objs=162 size=243B - /4/33N (1|26|34): objs=1335 size=5.56KiB - /4/0/0N (1|25|34): objs=34766 size=620.16KiB - /4/0/1N (1|25|34): objs=8673 size=41.74KiB - /4/0/2S (1|25|34): objs=139 size=131B - /4/0/3N (1|25|34): objs=1222 size=5.19KiB - /4/0/4S (1|25|34): objs=159 size=174B - /4/0/5N (1|25|34): objs=7356 size=35.28KiB - /4/0/6S (1|25|34): objs=150 size=315B - /4/0/7N (1|25|34): objs=3381 size=14.53KiB - /4/0/8S (1|25|34): objs=154 size=279B - /4/0/9N (1|25|34): objs=471 size=1.46KiB - /4/0/10S (1|25|34): objs=147 size=88B - /4/0/11N (1|25|34): objs=1866 size=7.71KiB - /4/0/12S (1|25|34): objs=145 size=243B - /4/0/13N (1|25|34): objs=2844 size=12.1KiB - /4/0/14S (1|25|34): objs=148 size=277B - /4/0/15N (1|25|34): objs=1204 size=4.9KiB - /4/0/16S (1|25|34): objs=145 size=271B - /4/0/18S (1|25|34): objs=170 size=321B - /4/0/19N (1|25|34): objs=468 size=1.65KiB - /4/0/20S (1|25|34): objs=150 size=320B - /4/0/21S (1|25|34): objs=170 size=254B - /4/0/22S (1|25|34): objs=145 size=153B - /4/0/23N (1|25|34): objs=780 size=3.28KiB - /4/0/24S (1|25|34): objs=147 size=132B - /4/0/25N (1|25|34): objs=3905 size=17.58KiB - /4/0/26S (1|25|34): objs=147 size=86B - /4/0/27N (1|25|34): objs=738 size=2.74KiB - /4/0/28S (1|25|34): objs=158 size=312B - /4/0/29N (1|25|34): objs=432 size=1.52KiB - /4/0/30S (1|25|34): objs=157 size=194B - /4/0/32S (1|25|34): objs=146 size=246B - /4/0/33N (1|25|34): objs=2184 size=9.05KiB - /5/0N (2|25|36): objs=35844 size=599.32KiB - /5/1N (2|25|36): objs=16044 size=108.34KiB - /5/2S (2|25|36): objs=157 size=124B - /5/3N (2|25|36): objs=23099 size=199.22KiB - /5/4N (2|25|36): objs=38723 size=949.94KiB - /5/5N (2|25|36): objs=9771 size=55.36KiB - /5/6S (2|25|36): objs=179 size=230B - /5/7N (2|25|36): objs=1507 size=6.21KiB - /5/8S (2|25|36): objs=133 size=104B - /5/9S (2|25|36): objs=191 size=190B - /5/10S (2|25|36): objs=141 size=320B - /5/11N (2|25|36): objs=297 size=715B - /5/12S (2|25|36): objs=142 size=153B - /5/14S (2|25|36): objs=155 size=268B - /5/15N (2|25|36): objs=1436 size=5.99KiB - /5/16S (2|25|36): objs=151 size=340B - /5/17N (2|25|36): objs=6744 size=34.33KiB - /5/18S (2|25|36): objs=142 size=87B - /5/19N (2|25|36): objs=4162 size=18.75KiB - /5/20S (2|25|36): objs=146 size=209B - /5/21N (2|25|36): objs=1347 size=5.5KiB - /5/22S (2|25|36): objs=135 size=307B - /5/23N (2|25|36): objs=852 size=3.62KiB - /5/24S (2|25|36): objs=151 size=206B - /5/25N (2|25|36): objs=2298 size=9.98KiB - /5/26S (2|25|36): objs=164 size=213B - /5/27N (2|25|36): objs=452 size=1.66KiB - /5/28S (2|25|36): objs=142 size=241B - /5/29N (2|25|36): objs=1253 size=5.1KiB - /5/30S (2|25|36): objs=154 size=120B - /5/32S (2|25|36): objs=151 size=284B - /5/33N (2|25|36): objs=2697 size=11.61KiB - /5/34S (2|25|36): objs=147 size=117B - /5/35N (2|25|36): objs=601 size=2.17KiB - /6/0N (2|25|36): objs=37311 size=651KiB - /6/1N (2|25|36): objs=37698 size=784.54KiB - /6/2N (2|25|36): objs=42418 size=1.12MiB - /6/3N (2|25|36): objs=8287 size=39.05KiB - /6/4S (2|25|36): objs=165 size=103B - /6/5N (2|25|36): objs=1805 size=7.37KiB - /6/6S (2|25|36): objs=143 size=324B - /6/7N (2|25|36): objs=466 size=1.49KiB - /6/8S (2|25|36): objs=155 size=105B - /6/9N (2|25|36): objs=492 size=1.83KiB - /6/10S (2|25|36): objs=158 size=220B - /6/11N (2|25|36): objs=4958 size=22.53KiB - /6/12S (2|25|36): objs=143 size=173B - /6/13N (2|25|36): objs=1676 size=6.87KiB - /6/14S (2|25|36): objs=164 size=341B - /6/15N (2|25|36): objs=1824 size=7.68KiB - /6/16S (2|25|36): objs=150 size=286B - /6/17N (2|25|36): objs=3504 size=15.8KiB - /6/18S (2|25|36): objs=161 size=172B - /6/19S (2|25|36): objs=167 size=341B - /6/20S (2|25|36): objs=153 size=196B - /6/21N (2|25|36): objs=3301 size=15.14KiB - /6/22S (2|25|36): objs=178 size=296B - /6/23N (2|25|36): objs=567 size=2.19KiB - /6/24S (2|25|36): objs=156 size=160B - /6/25N (2|25|36): objs=485 size=1.6KiB - /6/26S (2|25|36): objs=135 size=173B - /6/27N (2|25|36): objs=3222 size=13.8KiB - /6/28S (2|25|36): objs=171 size=212B - /6/29N (2|25|36): objs=1448 size=5.82KiB - /6/30S (2|25|36): objs=156 size=188B - /6/31N (2|25|36): objs=924 size=3.5KiB - /6/32S (2|25|36): objs=145 size=300B - /6/34S (2|25|36): objs=131 size=178B - /6/35N (2|25|36): objs=1952 size=8.09KiB - /7/0N (2|25|36): objs=36593 size=759.49KiB - /7/1N (2|25|36): objs=38322 size=878.67KiB - /7/2N (2|25|36): objs=37182 size=775.89KiB - /7/3N (2|25|36): objs=7511 size=42KiB - /7/4S (2|25|36): objs=144 size=277B - /7/5N (2|25|36): objs=2860 size=12.26KiB - /7/6S (2|25|36): objs=163 size=319B - /7/7N (2|25|36): objs=1670 size=6.67KiB - /7/8S (2|25|36): objs=145 size=211B - /7/9N (2|25|36): objs=2239 size=10.03KiB - /7/10S (2|25|36): objs=160 size=341B - /7/11N (2|25|36): objs=748 size=2.84KiB - /7/12S (2|25|36): objs=152 size=211B - /7/13N (2|25|36): objs=292 size=805B - /7/14S (2|25|36): objs=145 size=181B - /7/15N (2|25|36): objs=3195 size=14.15KiB - /7/16S (2|25|36): objs=140 size=105B - /7/17N (2|25|36): objs=1042 size=4.29KiB - /7/18S (2|25|36): objs=173 size=307B - /7/19N (2|25|36): objs=1120 size=4.55KiB - /7/20S (2|25|36): objs=133 size=252B - /7/21N (2|25|36): objs=1221 size=4.86KiB - /7/22S (2|25|36): objs=168 size=140B - /7/23N (2|25|36): objs=442 size=1.68KiB - /7/24S (2|25|36): objs=147 size=181B - /7/25N (2|25|36): objs=5047 size=21.54KiB - /7/26S (2|25|36): objs=166 size=196B - /7/28S (2|25|36): objs=163 size=100B - /7/29N (2|25|36): objs=6848 size=36.07KiB - /7/30S (2|25|36): objs=166 size=327B - /7/31N (2|25|36): objs=313 size=1.04KiB - /7/32S (2|25|36): objs=163 size=138B - /7/33S (2|25|36): objs=161 size=162B - /7/34S (2|25|36): objs=150 size=190B - /7/35N (2|25|36): objs=1807 size=7.8KiB - /8/0N (2|25|36): objs=38666 size=782.12KiB - /8/1N (2|25|36): objs=35406 size=688.09KiB - /8/2N (2|25|36): objs=31638 size=493.42KiB - /8/3S (2|25|36): objs=147 size=98B - /8/4N (2|25|36): objs=2301 size=9.81KiB - /8/5S (2|25|36): objs=171 size=210B - /8/6N (2|25|36): objs=3346 size=15.38KiB - /8/7N (2|25|36): objs=9857 size=51.92KiB - /8/8S (2|25|36): objs=181 size=357B - /8/9N (2|25|36): objs=444 size=1.47KiB - /8/10S (2|25|36): objs=164 size=122B - /8/11N (2|25|36): objs=1573 size=6.54KiB - /8/12S (2|25|36): objs=158 size=98B - /8/13N (2|25|36): objs=572 size=2.36KiB - /8/14S (2|25|36): objs=163 size=91B - /8/15N (2|25|36): objs=1527 size=6.4KiB - /8/16S (2|25|36): objs=148 size=156B - /8/17N (2|25|36): objs=479 size=1.53KiB - /8/18S (2|25|36): objs=150 size=298B - /8/19N (2|25|36): objs=1385 size=5.66KiB - /8/20S (2|25|36): objs=164 size=282B - /8/21N (2|25|36): objs=1410 size=5.77KiB - /8/22S (2|25|36): objs=142 size=85B - /8/23N (2|25|36): objs=5296 size=24.38KiB - /8/24S (2|25|36): objs=142 size=234B - /8/26S (2|25|36): objs=146 size=159B - /8/27N (2|25|36): objs=4282 size=19.77KiB - /8/28S (2|25|36): objs=155 size=254B - /8/29N (2|25|36): objs=313 size=795B - /8/30S (2|25|36): objs=149 size=254B - /8/31N (2|25|36): objs=3011 size=13.37KiB - /8/32S (2|25|36): objs=141 size=172B - /8/33N (2|25|36): objs=3025 size=14.18KiB - /8/34S (2|25|36): objs=148 size=171B - /8/35N (2|25|36): objs=4208 size=18.13KiB - /9/0N (2|25|36): objs=43115 size=978.71KiB - /9/1N (2|25|36): objs=33779 size=611.24KiB - /9/2N (2|25|36): objs=44999 size=1.14MiB - /9/3N (2|25|36): objs=17722 size=174.28KiB - /9/4S (2|25|36): objs=163 size=234B - /9/5N (2|25|36): objs=1210 size=4.86KiB - /9/6S (2|25|36): objs=150 size=279B - /9/7N (2|25|36): objs=583 size=2.12KiB - /9/8S (2|25|36): objs=151 size=179B - /9/9N (2|25|36): objs=1236 size=5.2KiB - /9/10S (2|25|36): objs=174 size=204B - /9/11N (2|25|36): objs=449 size=1.58KiB - /9/12S (2|25|36): objs=145 size=158B - /9/13N (2|25|36): objs=879 size=3.39KiB - /9/14S (2|25|36): objs=143 size=147B - /9/15N (2|25|36): objs=1146 size=4.61KiB - /9/16S (2|25|36): objs=141 size=252B - /9/17N (2|25|36): objs=489 size=1.64KiB - /9/18S (2|25|36): objs=128 size=120B - /9/19N (2|25|36): objs=1385 size=5.41KiB - /9/20S (2|25|36): objs=154 size=106B - /9/21N (2|25|36): objs=4873 size=23.14KiB - /9/22S (2|25|36): objs=158 size=129B - /9/23N (2|25|36): objs=1497 size=6.38KiB - /9/24S (2|25|36): objs=148 size=273B - /9/25N (2|25|36): objs=897 size=3.57KiB - /9/26S (2|25|36): objs=170 size=297B - /9/27N (2|25|36): objs=276 size=906B - /9/28S (2|25|36): objs=166 size=94B - /9/30S (2|25|36): objs=153 size=301B - /9/31N (2|25|36): objs=309 size=941B - /9/32S (2|25|36): objs=148 size=128B - /9/33N (2|25|36): objs=1620 size=7KiB - /9/34S (2|25|36): objs=151 size=102B - /10/0N (2|25|36): objs=39459 size=905.39KiB - /10/1N (2|25|36): objs=38655 size=852.01KiB - /10/2N (2|25|36): objs=45605 size=1.09MiB - /10/3N (2|25|36): objs=1677 size=7.14KiB - /10/4S (2|25|36): objs=165 size=108B - /10/5N (2|25|36): objs=499 size=1.64KiB - /10/6S (2|25|36): objs=135 size=146B - /10/7N (2|25|36): objs=6249 size=31.01KiB - /10/8S (2|25|36): objs=148 size=311B - /10/9N (2|25|36): objs=1820 size=7.45KiB - /10/10S (2|25|36): objs=150 size=305B - /10/11N (2|25|36): objs=4174 size=18.45KiB - /10/12S (2|25|36): objs=138 size=156B - /10/13N (2|25|36): objs=8343 size=40.98KiB - /10/14S (2|25|36): objs=152 size=171B - /10/15N (2|25|36): objs=1615 size=6.65KiB - /10/16S (2|25|36): objs=158 size=234B - /10/17N (2|25|36): objs=1073 size=4.23KiB - /10/18S (2|25|36): objs=154 size=255B - /10/19N (2|25|36): objs=1610 size=6.84KiB - /10/20S (2|25|36): objs=180 size=147B - /10/21N (2|25|36): objs=1917 size=8.28KiB - /10/22S (2|25|36): objs=156 size=123B - /10/23N (2|25|36): objs=1351 size=5.7KiB - /10/24S (2|25|36): objs=176 size=283B - /10/25N (2|25|36): objs=324 size=969B - /10/26S (2|25|36): objs=165 size=123B - /10/27N (2|25|36): objs=1229 size=5.26KiB - /10/28S (2|25|36): objs=133 size=280B - /10/29N (2|25|36): objs=1390 size=5.55KiB - /10/30S (2|25|36): objs=163 size=245B - /10/31N (2|25|36): objs=932 size=3.46KiB - /10/32S (2|25|36): objs=165 size=128B - /10/33N (2|25|36): objs=4416 size=20.29KiB - /10/34S (2|25|36): objs=156 size=284B - /10/35S (2|25|36): objs=147 size=238B - /11/0N (2|25|36): objs=40410 size=943.66KiB - /11/1N (2|25|36): objs=13827 size=88.06KiB - /11/2S (2|25|36): objs=147 size=251B - /11/3N (2|25|36): objs=26404 size=364.81KiB - /11/4N (2|25|36): objs=40746 size=920.25KiB - /11/5N (2|25|36): objs=7209 size=33.33KiB - /11/6S (2|25|36): objs=173 size=210B - /11/7N (2|25|36): objs=1168 size=4.7KiB - /11/8S (2|25|36): objs=150 size=170B - /11/9N (2|25|36): objs=288 size=784B - /11/10S (2|25|36): objs=156 size=136B - /11/11N (2|25|36): objs=482 size=1.54KiB - /11/12S (2|25|36): objs=155 size=328B - /11/13S (2|25|36): objs=172 size=258B - /11/14S (2|25|36): objs=151 size=289B - /11/15N (2|25|36): objs=498 size=1.78KiB - /11/16S (2|25|36): objs=171 size=185B - /11/17N (2|25|36): objs=817 size=3.01KiB - /11/18S (2|25|36): objs=147 size=328B - /11/19N (2|25|36): objs=307 size=814B - /11/20S (2|25|36): objs=155 size=230B - /11/21N (2|25|36): objs=5397 size=26.31KiB - /11/22S (2|25|36): objs=137 size=248B - /11/24S (2|25|36): objs=157 size=122B - /11/25N (2|25|36): objs=2814 size=11.85KiB - /11/26S (2|25|36): objs=166 size=292B - /11/27N (2|25|36): objs=3543 size=15.49KiB - /11/28S (2|25|36): objs=149 size=180B - /11/30S (2|25|36): objs=155 size=199B - /11/31N (2|25|36): objs=12140 size=80.78KiB - /11/32S (2|25|36): objs=135 size=237B - /11/33N (2|25|36): objs=1099 size=4.7KiB - /11/34S (2|25|36): objs=146 size=115B - /11/35N (2|25|36): objs=1505 size=6.27KiB - /12/0N (2|25|36): objs=44337 size=1.21MiB - /12/1N (2|25|36): objs=42454 size=1.03MiB - /12/2N (2|25|36): objs=37429 size=702.82KiB - /12/3N (2|25|36): objs=4090 size=17.31KiB - /12/4S (2|25|36): objs=156 size=182B - /12/5N (2|25|36): objs=1330 size=5.1KiB - /12/6S (2|25|36): objs=157 size=189B - /12/7N (2|25|36): objs=6717 size=34.37KiB - /12/8S (2|25|36): objs=164 size=99B - /12/9N (2|25|36): objs=1064 size=4.13KiB - /12/10S (2|25|36): objs=148 size=335B - /12/11N (2|25|36): objs=883 size=3.49KiB - /12/12S (2|25|36): objs=146 size=142B - /12/13N (2|25|36): objs=2317 size=9.65KiB - /12/14S (2|25|36): objs=178 size=169B - /12/15N (2|25|36): objs=1205 size=4.69KiB - /12/16S (2|25|36): objs=166 size=289B - /12/17N (2|25|36): objs=488 size=1.73KiB - /12/18S (2|25|36): objs=145 size=246B - /12/19N (2|25|36): objs=2463 size=10.96KiB - /12/20S (2|25|36): objs=153 size=228B - /12/21N (2|25|36): objs=2076 size=8.79KiB - /12/22S (2|25|36): objs=171 size=351B - /12/23N (2|25|36): objs=3940 size=16.57KiB - /12/24S (2|25|36): objs=153 size=187B - /12/26S (2|25|36): objs=139 size=128B - /12/27N (2|25|36): objs=287 size=799B - /12/28S (2|25|36): objs=141 size=255B - /12/29N (2|25|36): objs=1380 size=5.6KiB - /12/30S (2|25|36): objs=146 size=124B - /12/31N (2|25|36): objs=4011 size=17.88KiB - /12/32S (2|25|36): objs=150 size=215B - /12/33N (2|25|36): objs=2562 size=12.06KiB - /12/34S (2|25|36): objs=161 size=186B - /13/0N (2|25|36): objs=40653 size=919.73KiB - /13/1N (2|25|36): objs=40527 size=873.4KiB - /13/2N (2|25|36): objs=39550 size=1.05MiB - /13/3N (2|25|36): objs=6590 size=30.26KiB - /13/4S (2|25|36): objs=151 size=254B - /13/5N (2|25|36): objs=1051 size=4.33KiB - /13/6S (2|25|36): objs=147 size=119B - /13/7N (2|25|36): objs=5312 size=25.55KiB - /13/8S (2|25|36): objs=162 size=295B - /13/9N (2|25|36): objs=3339 size=14.84KiB - /13/10S (2|25|36): objs=156 size=271B - /13/12S (2|25|36): objs=109 size=160B - /13/13N (2|25|36): objs=587 size=2.29KiB - /13/14S (2|25|36): objs=178 size=107B - /13/15N (2|25|36): objs=3003 size=12.57KiB - /13/16S (2|25|36): objs=151 size=132B - /13/17N (2|25|36): objs=285 size=712B - /13/18S (2|25|36): objs=141 size=122B - /13/19N (2|25|36): objs=6258 size=30.55KiB - /13/20S (2|25|36): objs=154 size=227B - /13/21S (2|25|36): objs=147 size=293B - /13/22S (2|25|36): objs=153 size=169B - /13/23N (2|25|36): objs=1632 size=6.9KiB - /13/24S (2|25|36): objs=140 size=296B - /13/25N (2|25|36): objs=1344 size=5.36KiB - /13/26S (2|25|36): objs=161 size=152B - /13/27N (2|25|36): objs=900 size=3.47KiB - /13/28S (2|25|36): objs=169 size=161B - /13/29N (2|25|36): objs=1906 size=7.94KiB - /13/30S (2|25|36): objs=152 size=168B - /13/31N (2|25|36): objs=314 size=815B - /13/32S (2|25|36): objs=149 size=107B - /13/33N (2|25|36): objs=4035 size=17.2KiB - /13/34S (2|25|36): objs=159 size=138B - /13/35N (2|25|36): objs=272 size=673B - /14/0N (2|25|36): objs=40745 size=935.77KiB - /14/1N (2|25|36): objs=41649 size=1.04MiB - /14/2N (2|25|36): objs=37158 size=737.84KiB - /14/3N (2|25|36): objs=7993 size=36.32KiB - /14/4S (2|25|36): objs=142 size=122B - /14/5N (2|25|36): objs=319 size=924B - /14/6S (2|25|36): objs=147 size=242B - /14/7N (2|25|36): objs=5047 size=24.03KiB - /14/8S (2|25|36): objs=146 size=180B - /14/9N (2|25|36): objs=720 size=2.85KiB - /14/10S (2|25|36): objs=151 size=205B - /14/11N (2|25|36): objs=2504 size=10.65KiB - /14/12S (2|25|36): objs=158 size=292B - /14/13N (2|25|36): objs=307 size=1005B - /14/14S (2|25|36): objs=164 size=117B - /14/15S (2|25|36): objs=175 size=136B - /14/16S (2|25|36): objs=165 size=314B - /14/17N (2|25|36): objs=324 size=979B - /14/18S (2|25|36): objs=148 size=285B - /14/19S (2|25|36): objs=169 size=111B - /14/20S (2|25|36): objs=141 size=131B - /14/21N (2|25|36): objs=1646 size=6.99KiB - /14/22S (2|25|36): objs=184 size=341B - /14/23N (2|25|36): objs=3748 size=17.07KiB - /14/24S (2|25|36): objs=128 size=235B - /14/26S (2|25|36): objs=136 size=235B - /14/27N (2|25|36): objs=791 size=2.88KiB - /14/28S (2|25|36): objs=161 size=88B - /14/29N (2|25|36): objs=2474 size=10.33KiB - /14/30S (2|25|36): objs=134 size=92B - /14/32S (2|25|36): objs=149 size=108B - /14/33N (2|25|36): objs=2216 size=9.28KiB - /14/34S (2|25|36): objs=130 size=181B - /14/35N (2|25|36): objs=6338 size=30.59KiB - /15/0N (2|25|36): objs=42598 size=985.31KiB - /15/1N (2|25|36): objs=44595 size=1015.32KiB - /15/2N (2|25|36): objs=36815 size=732.09KiB - /15/3N (2|25|36): objs=1454 size=5.98KiB - /15/4S (2|25|36): objs=156 size=85B - /15/5N (2|25|36): objs=1054 size=4.18KiB - /15/6S (2|25|36): objs=124 size=255B - /15/7N (2|25|36): objs=886 size=3.38KiB - /15/8S (2|25|36): objs=165 size=190B - /15/9N (2|25|36): objs=294 size=810B - /15/10S (2|25|36): objs=130 size=234B - /15/11N (2|25|36): objs=458 size=1.46KiB - /15/12S (2|25|36): objs=163 size=229B - /15/13N (2|25|36): objs=462 size=1.48KiB - /15/14S (2|25|36): objs=162 size=146B - /15/15N (2|25|36): objs=7242 size=34.35KiB - /15/16S (2|25|36): objs=158 size=106B - /15/17N (2|25|36): objs=323 size=1003B - /15/18S (2|25|36): objs=165 size=130B - /15/19N (2|25|36): objs=6461 size=29.09KiB - /15/20S (2|25|36): objs=160 size=313B - /15/21N (2|25|36): objs=6159 size=26.87KiB - /15/22S (2|25|36): objs=149 size=161B - /15/23N (2|25|36): objs=2530 size=10.8KiB - /15/24S (2|25|36): objs=170 size=256B - /15/25N (2|25|36): objs=484 size=1.59KiB - /15/26S (2|25|36): objs=142 size=155B - /15/27N (2|25|36): objs=4809 size=23.13KiB - /15/28S (2|25|36): objs=174 size=124B - /15/29N (2|25|36): objs=463 size=1.47KiB - /15/30S (2|25|36): objs=156 size=303B - /15/31N (2|25|36): objs=910 size=3.71KiB - /15/32S (2|25|36): objs=137 size=266B - /15/33N (2|25|36): objs=1182 size=4.87KiB - /15/34S (2|25|36): objs=165 size=231B - /15/35N (2|25|36): objs=1099 size=4.46KiB - /16/0N (2|25|36): objs=34582 size=667.92KiB - /16/1N (2|25|36): objs=40948 size=1016.06KiB - /16/2N (2|25|36): objs=18947 size=164.35KiB - /16/3S (2|25|36): objs=141 size=286B - /16/4N (2|25|36): objs=13518 size=75.76KiB - /16/5S (2|25|36): objs=153 size=310B - /16/6N (2|25|36): objs=5381 size=27.99KiB - /16/7S (2|25|36): objs=167 size=137B - /16/8N (2|25|36): objs=1900 size=7.77KiB - /16/9S (2|25|36): objs=145 size=206B - /16/10N (2|25|36): objs=727 size=2.65KiB - /16/11N (2|25|36): objs=482 size=1.67KiB - /16/12S (2|25|36): objs=143 size=207B - /16/13N (2|25|36): objs=2447 size=10.81KiB - /16/14S (2|25|36): objs=163 size=216B - /16/15N (2|25|36): objs=1236 size=5.06KiB - /16/16S (2|25|36): objs=146 size=316B - /16/17S (2|25|36): objs=152 size=195B - /16/18S (2|25|36): objs=155 size=108B - /16/19N (2|25|36): objs=4254 size=18.28KiB - /16/20S (2|25|36): objs=148 size=299B - /16/21N (2|25|36): objs=2122 size=8.91KiB - /16/22S (2|25|36): objs=153 size=250B - /16/24S (2|25|36): objs=149 size=207B - /16/25N (2|25|36): objs=2230 size=10.03KiB - /16/26S (2|25|36): objs=148 size=304B - /16/27N (2|25|36): objs=3115 size=13.54KiB - /16/28S (2|25|36): objs=150 size=308B - /16/29N (2|25|36): objs=3940 size=18.28KiB - /16/30S (2|25|36): objs=165 size=213B - /16/31N (2|25|36): objs=6374 size=33.47KiB - /16/32S (2|25|36): objs=149 size=228B - /16/33N (2|25|36): objs=2274 size=9.81KiB - /16/34S (2|25|36): objs=151 size=136B - /16/35N (2|25|36): objs=5341 size=24.17KiB - /17/0N (2|25|36): objs=41235 size=958.16KiB - /17/1N (2|25|36): objs=39477 size=847.84KiB - /17/2N (2|25|36): objs=32936 size=545.51KiB - /17/3S (2|25|36): objs=153 size=182B - /17/4N (2|25|36): objs=3205 size=14.67KiB - /17/5S (2|25|36): objs=137 size=192B - /17/6N (2|25|36): objs=2309 size=9.89KiB - /17/7S (2|25|36): objs=145 size=184B - /17/8N (2|25|36): objs=3497 size=14.63KiB - /17/9N (2|25|36): objs=1178 size=4.73KiB - /17/10S (2|25|36): objs=138 size=188B - /17/11N (2|25|36): objs=4709 size=21.3KiB - /17/12S (2|25|36): objs=152 size=338B - /17/13N (2|25|36): objs=1242 size=4.76KiB - /17/14S (2|25|36): objs=142 size=284B - /17/15N (2|25|36): objs=458 size=1.62KiB - /17/16S (2|25|36): objs=145 size=117B - /17/17N (2|25|36): objs=2867 size=12.98KiB - /17/18S (2|25|36): objs=191 size=329B - /17/19N (2|25|36): objs=1832 size=7.54KiB - /17/20S (2|25|36): objs=162 size=267B - /17/21N (2|25|36): objs=3121 size=13.69KiB - /17/22S (2|25|36): objs=137 size=265B - /17/23N (2|25|36): objs=1596 size=6.78KiB - /17/24S (2|25|36): objs=140 size=269B - /17/25N (2|25|36): objs=306 size=855B - /17/26S (2|25|36): objs=173 size=301B - /17/27N (2|25|36): objs=887 size=3.7KiB - /17/28S (2|25|36): objs=162 size=236B - /17/29N (2|25|36): objs=4357 size=18.84KiB - /17/30S (2|25|36): objs=131 size=140B - /17/31S (2|25|36): objs=167 size=324B - /17/32S (2|25|36): objs=160 size=177B - /17/33N (2|25|36): objs=9118 size=48.26KiB - /17/34S (2|25|36): objs=141 size=110B - /17/35N (2|25|36): objs=2272 size=9.81KiB - /18/0N (2|25|36): objs=39207 size=817.58KiB - /18/1N (2|25|36): objs=36909 size=756.6KiB - /18/2N (2|25|36): objs=28814 size=376.76KiB - /18/3S (2|25|36): objs=123 size=197B - /18/4N (2|25|36): objs=9400 size=46.4KiB - /18/5N (2|25|36): objs=15133 size=109.66KiB - /18/6S (2|25|36): objs=154 size=230B - /18/7N (2|25|36): objs=1830 size=7.65KiB - /18/8S (2|25|36): objs=146 size=99B - /18/9N (2|25|36): objs=285 size=842B - /18/10S (2|25|36): objs=152 size=276B - /18/12S (2|25|36): objs=154 size=333B - /18/14S (2|25|36): objs=141 size=205B - /18/15N (2|25|36): objs=926 size=3.5KiB - /18/16S (2|25|36): objs=154 size=190B - /18/17N (2|25|36): objs=1320 size=5.49KiB - /18/18S (2|25|36): objs=167 size=233B - /18/19N (2|25|36): objs=2676 size=11.79KiB - /18/20S (2|25|36): objs=158 size=172B - /18/21N (2|25|36): objs=313 size=814B - /18/22S (2|25|36): objs=169 size=251B - /18/23N (2|25|36): objs=2422 size=11.08KiB - /18/24S (2|25|36): objs=154 size=305B - /18/26S (2|25|36): objs=158 size=202B - /18/27N (2|25|36): objs=1475 size=6.18KiB - /18/28S (2|25|36): objs=159 size=147B - /18/29N (2|25|36): objs=5425 size=26.94KiB - /18/30S (2|25|36): objs=150 size=333B - /18/31N (2|25|36): objs=561 size=1.88KiB - /18/32S (2|25|36): objs=163 size=327B - /18/33N (2|25|36): objs=586 size=2.16KiB - /18/34S (2|25|36): objs=149 size=264B - /18/35N (2|25|36): objs=1498 size=5.91KiB - /19/0N (2|25|36): objs=39611 size=1.02MiB - /19/1N (2|25|36): objs=39169 size=851.48KiB - /19/2N (2|25|36): objs=36809 size=821.06KiB - /19/3N (2|25|36): objs=20880 size=208.96KiB - /19/4S (2|25|36): objs=143 size=82B - /19/6S (2|25|36): objs=163 size=258B - /19/7N (2|25|36): objs=1253 size=5.03KiB - /19/8S (2|25|36): objs=156 size=226B - /19/9N (2|25|36): objs=2304 size=9.7KiB - /19/10S (2|25|36): objs=167 size=242B - /19/11N (2|25|36): objs=6071 size=28.76KiB - /19/12S (2|25|36): objs=152 size=143B - /19/13N (2|25|36): objs=1673 size=7.12KiB - /19/14S (2|25|36): objs=160 size=172B - /19/16S (2|25|36): objs=141 size=316B - /19/17N (2|25|36): objs=608 size=2.08KiB - /19/18S (2|25|36): objs=156 size=332B - /19/20S (2|25|36): objs=162 size=122B - /19/21N (2|25|36): objs=1079 size=4.08KiB - /19/22S (2|25|36): objs=133 size=161B - /19/23S (2|25|36): objs=161 size=341B - /19/24S (2|25|36): objs=154 size=145B - /19/25N (2|25|36): objs=1906 size=7.71KiB - /19/26S (2|25|36): objs=158 size=201B - /19/27N (2|25|36): objs=1684 size=6.9KiB - /19/28S (2|25|36): objs=137 size=310B - /19/29N (2|25|36): objs=614 size=2.28KiB - /19/30S (2|25|36): objs=156 size=302B - /19/31N (2|25|36): objs=1273 size=5.02KiB - /19/32S (2|25|36): objs=155 size=233B - /19/34S (2|25|36): objs=161 size=302B - /19/35N (2|25|36): objs=1135 size=4.66KiB - /20/0N (2|25|36): objs=40254 size=1006.34KiB - /20/1N (2|25|36): objs=38981 size=763.73KiB - /20/2N (2|25|36): objs=24084 size=257.14KiB - /20/3S (2|25|36): objs=135 size=203B - /20/4N (2|25|36): objs=16737 size=103.97KiB - /20/5N (2|25|36): objs=23743 size=228.42KiB - /20/6S (2|25|36): objs=177 size=271B - /20/7S (2|25|36): objs=176 size=230B - /20/8S (2|25|36): objs=143 size=340B - /20/9N (2|25|36): objs=1101 size=4.37KiB - /20/10S (2|25|36): objs=165 size=112B - /20/12S (2|25|36): objs=148 size=315B - /20/13N (2|25|36): objs=1688 size=7.06KiB - /20/14S (2|25|36): objs=152 size=324B - /20/15N (2|25|36): objs=2806 size=11.93KiB - /20/16S (2|25|36): objs=138 size=117B - /20/17S (2|25|36): objs=145 size=330B - /20/18S (2|25|36): objs=143 size=193B - /20/19N (2|25|36): objs=2122 size=11.06KiB - /20/20S (2|25|36): objs=150 size=327B - /20/21N (2|25|36): objs=1523 size=6.23KiB - /20/22S (2|25|36): objs=136 size=152B - /20/23N (2|25|36): objs=629 size=2.46KiB - /20/24S (2|25|36): objs=154 size=110B - /20/25N (2|25|36): objs=4499 size=21.15KiB - /20/26S (2|25|36): objs=139 size=195B - /20/27N (2|25|36): objs=298 size=988B - /20/28S (2|25|36): objs=155 size=278B - /20/29N (2|25|36): objs=477 size=1.48KiB - /20/30S (2|25|36): objs=148 size=85B - /20/31N (2|25|36): objs=969 size=3.86KiB - /20/32S (2|25|36): objs=140 size=242B - /20/33N (2|25|36): objs=473 size=1.46KiB - /20/34S (2|25|36): objs=141 size=286B - /20/35N (2|25|36): objs=497 size=1.73KiB - /21/0N (2|25|36): objs=39053 size=872.61KiB - /21/1N (2|25|36): objs=43758 size=1.03MiB - /21/2N (2|25|36): objs=34975 size=537.62KiB - /21/3S (2|25|36): objs=165 size=330B - /21/4N (2|25|36): objs=5986 size=29.32KiB - /21/5N (2|25|36): objs=3436 size=15.94KiB - /21/6S (2|25|36): objs=151 size=107B - /21/7N (2|25|36): objs=7905 size=39.05KiB - /21/8S (2|25|36): objs=153 size=232B - /21/10S (2|25|36): objs=147 size=196B - /21/11N (2|25|36): objs=1095 size=4.38KiB - /21/12S (2|25|36): objs=156 size=294B - /21/14S (2|25|36): objs=163 size=244B - /21/15N (2|25|36): objs=4146 size=20.04KiB - /21/16S (2|25|36): objs=169 size=178B - /21/17N (2|25|36): objs=307 size=878B - /21/18S (2|25|36): objs=147 size=120B - /21/19N (2|25|36): objs=1560 size=6.5KiB - /21/20S (2|25|36): objs=147 size=326B - /21/21N (2|25|36): objs=2847 size=12.3KiB - /21/22S (2|25|36): objs=147 size=305B - /21/23N (2|25|36): objs=1221 size=4.97KiB - /21/24S (2|25|36): objs=141 size=317B - /21/25N (2|25|36): objs=9246 size=50.51KiB - /21/26S (2|25|36): objs=172 size=98B - /21/28S (2|25|36): objs=161 size=307B - /21/29N (2|25|36): objs=1424 size=5.85KiB - /21/30S (2|25|36): objs=172 size=284B - /21/31N (2|25|36): objs=2899 size=12.13KiB - /21/32S (2|25|36): objs=141 size=228B - /21/33N (2|25|36): objs=1512 size=6.18KiB - /21/34S (2|25|36): objs=141 size=209B - /21/35N (2|25|36): objs=3607 size=15.49KiB - /22/0N (2|25|36): objs=37825 size=778.64KiB - /22/1N (2|25|36): objs=44835 size=1.24MiB - /22/2N (2|25|36): objs=40908 size=973.53KiB - /22/3N (2|25|36): objs=9296 size=47.21KiB - /22/4S (2|25|36): objs=149 size=337B - /22/5N (2|25|36): objs=3374 size=15.95KiB - /22/6S (2|25|36): objs=164 size=264B - /22/7N (2|25|36): objs=625 size=2.41KiB - /22/8S (2|25|36): objs=133 size=160B - /22/9N (2|25|36): objs=309 size=1.03KiB - /22/10S (2|25|36): objs=140 size=237B - /22/11S (2|25|36): objs=142 size=165B - /22/12S (2|25|36): objs=151 size=140B - /22/13S (2|25|36): objs=156 size=150B - /22/14S (2|25|36): objs=150 size=301B - /22/15N (2|25|36): objs=1832 size=7.64KiB - /22/16S (2|25|36): objs=166 size=342B - /22/17N (2|25|36): objs=4712 size=22.18KiB - /22/18S (2|25|36): objs=160 size=200B - /22/19N (2|25|36): objs=5585 size=25.42KiB - /22/20S (2|25|36): objs=153 size=153B - /22/21N (2|25|36): objs=1326 size=5.63KiB - /22/22S (2|25|36): objs=147 size=161B - /22/23N (2|25|36): objs=317 size=856B - /22/24S (2|25|36): objs=161 size=317B - /22/25N (2|25|36): objs=468 size=1.64KiB - /22/26S (2|25|36): objs=170 size=337B - /22/27N (2|25|36): objs=2155 size=8.75KiB - /22/28S (2|25|36): objs=148 size=160B - /22/29N (2|25|36): objs=615 size=2.41KiB - /22/30S (2|25|36): objs=153 size=296B - /22/31N (2|25|36): objs=2028 size=8.58KiB - /22/32S (2|25|36): objs=157 size=206B - /22/33N (2|25|36): objs=4100 size=17.49KiB - /22/34S (2|25|36): objs=178 size=216B - /22/35N (2|25|36): objs=309 size=1.06KiB - /23/0N (1|26|34): objs=76075 size=3.14MiB - /23/1N (1|26|34): objs=42377 size=1005.8KiB - /23/2S (1|26|34): objs=173 size=332B - /23/3N (1|26|34): objs=2324 size=9.76KiB - /23/4S (1|26|34): objs=168 size=187B - /23/5N (1|26|34): objs=1483 size=6.13KiB - /23/6S (1|26|34): objs=153 size=148B - /23/7N (1|26|34): objs=483 size=1.66KiB - /23/8S (1|26|34): objs=156 size=313B - /23/9N (1|26|34): objs=3000 size=12.77KiB - /23/10S (1|26|34): objs=151 size=308B - /23/11N (1|26|34): objs=769 size=2.92KiB - /23/12S (1|26|34): objs=153 size=115B - /23/13N (1|26|34): objs=1034 size=3.98KiB - /23/14S (1|26|34): objs=134 size=187B - /23/15N (1|26|34): objs=769 size=2.9KiB - /23/16S (1|26|34): objs=158 size=335B - /23/17N (1|26|34): objs=2509 size=10.67KiB - /23/18S (1|26|34): objs=136 size=131B - /23/19N (1|26|34): objs=4235 size=22.33KiB - /23/20S (1|26|34): objs=154 size=191B - /23/21N (1|26|34): objs=963 size=3.81KiB - /23/22S (1|26|34): objs=159 size=158B - /23/23N (1|26|34): objs=1332 size=5.41KiB - /23/24S (1|26|34): objs=160 size=247B - /23/25N (1|26|34): objs=1536 size=5.78KiB - /23/26S (1|26|34): objs=159 size=249B - /23/27N (1|26|34): objs=1067 size=4.02KiB - /23/28S (1|26|34): objs=159 size=248B - /23/29N (1|26|34): objs=471 size=1.45KiB - /23/30S (1|26|34): objs=144 size=326B - /23/31S (1|26|34): objs=146 size=91B - /23/32S (1|26|34): objs=153 size=256B - /23/33N (1|26|34): objs=1567 size=6.45KiB - /23/0/0N (1|25|34): objs=38515 size=966.71KiB - /23/0/1N (1|25|34): objs=18061 size=160.22KiB - /23/0/2S (1|25|34): objs=142 size=228B - /23/0/3N (1|25|34): objs=2553 size=11.51KiB - /23/0/4S (1|25|34): objs=188 size=312B - /23/0/5N (1|25|34): objs=447 size=1.63KiB - /23/0/6S (1|25|34): objs=149 size=299B - /23/0/7N (1|25|34): objs=885 size=3.4KiB - /23/0/8S (1|25|34): objs=167 size=119B - /23/0/10S (1|25|34): objs=166 size=88B - /23/0/11N (1|25|34): objs=2251 size=10.16KiB - /23/0/12S (1|25|34): objs=145 size=319B - /23/0/13N (1|25|34): objs=758 size=2.98KiB - /23/0/14S (1|25|34): objs=161 size=179B - /23/0/16S (1|25|34): objs=140 size=269B - /23/0/17N (1|25|34): objs=2498 size=10.41KiB - /23/0/18S (1|25|34): objs=146 size=327B - /23/0/19N (1|25|34): objs=768 size=2.81KiB - /23/0/20S (1|25|34): objs=140 size=181B - /23/0/21N (1|25|34): objs=459 size=1.51KiB - /23/0/22S (1|25|34): objs=154 size=280B - /23/0/23N (1|25|34): objs=1695 size=6.89KiB - /23/0/24S (1|25|34): objs=162 size=274B - /23/0/25N (1|25|34): objs=272 size=884B - /23/0/26S (1|25|34): objs=186 size=359B - /23/0/27N (1|25|34): objs=1986 size=8.49KiB - /23/0/28S (1|25|34): objs=136 size=157B - /23/0/30S (1|25|34): objs=145 size=177B - /23/0/31N (1|25|34): objs=1096 size=4.31KiB - /23/0/32S (1|25|34): objs=176 size=140B - /23/0/33N (1|25|34): objs=1328 size=5.34KiB - /24/0N (2|25|36): objs=37695 size=694.2KiB - /24/1N (2|25|36): objs=37989 size=786.21KiB - /24/2N (2|25|36): objs=36737 size=764.48KiB - /24/3N (2|25|36): objs=3399 size=14.73KiB - /24/4S (2|25|36): objs=149 size=177B - /24/5N (2|25|36): objs=5997 size=29.11KiB - /24/6S (2|25|36): objs=148 size=172B - /24/7N (2|25|36): objs=600 size=2.2KiB - /24/8S (2|25|36): objs=173 size=268B - /24/9N (2|25|36): objs=1790 size=7.32KiB - /24/10S (2|25|36): objs=175 size=273B - /24/11N (2|25|36): objs=2895 size=12.32KiB - /24/12S (2|25|36): objs=163 size=229B - /24/14S (2|25|36): objs=163 size=99B - /24/15S (2|25|36): objs=151 size=129B - /24/16S (2|25|36): objs=162 size=114B - /24/18S (2|25|36): objs=161 size=127B - /24/19N (2|25|36): objs=2701 size=11.97KiB - /24/20S (2|25|36): objs=142 size=276B - /24/21N (2|25|36): objs=1085 size=4.35KiB - /24/22S (2|25|36): objs=145 size=194B - /24/24S (2|25|36): objs=145 size=260B - /24/26S (2|25|36): objs=170 size=153B - /24/27N (2|25|36): objs=5704 size=25.93KiB - /24/28S (2|25|36): objs=170 size=322B - /24/29N (2|25|36): objs=3711 size=16.97KiB - /24/30S (2|25|36): objs=144 size=261B - /24/31N (2|25|36): objs=2109 size=9.01KiB - /24/32S (2|25|36): objs=152 size=160B - /24/33N (2|25|36): objs=1639 size=6.47KiB - /24/34S (2|25|36): objs=169 size=336B - /24/35N (2|25|36): objs=1994 size=8.88KiB - /25/0N (2|25|36): objs=38199 size=846.22KiB - /25/1N (2|25|36): objs=36555 size=714.93KiB - /25/2N (2|25|36): objs=41152 size=967.44KiB - /25/3N (2|25|36): objs=5899 size=27.95KiB - /25/4S (2|25|36): objs=136 size=236B - /25/5N (2|25|36): objs=4128 size=17.39KiB - /25/6S (2|25|36): objs=151 size=141B - /25/8S (2|25|36): objs=136 size=104B - /25/9S (2|25|36): objs=161 size=240B - /25/10S (2|25|36): objs=154 size=146B - /25/11N (2|25|36): objs=6056 size=29.41KiB - /25/12S (2|25|36): objs=166 size=150B - /25/13N (2|25|36): objs=2578 size=10.8KiB - /25/14S (2|25|36): objs=142 size=268B - /25/15N (2|25|36): objs=2024 size=9.58KiB - /25/16S (2|25|36): objs=144 size=219B - /25/18S (2|25|36): objs=158 size=228B - /25/19N (2|25|36): objs=790 size=3.11KiB - /25/20S (2|25|36): objs=143 size=305B - /25/21N (2|25|36): objs=593 size=2.11KiB - /25/22S (2|25|36): objs=173 size=127B - /25/23N (2|25|36): objs=303 size=785B - /25/24S (2|25|36): objs=150 size=327B - /25/25N (2|25|36): objs=2298 size=9.9KiB - /25/26S (2|25|36): objs=160 size=206B - /25/27N (2|25|36): objs=446 size=1.61KiB - /25/28S (2|25|36): objs=163 size=351B - /25/29N (2|25|36): objs=1357 size=5.44KiB - /25/30S (2|25|36): objs=152 size=316B - /25/31N (2|25|36): objs=2905 size=13.1KiB - /25/32S (2|25|36): objs=153 size=233B - /25/33N (2|25|36): objs=5574 size=28.32KiB - /25/34S (2|25|36): objs=167 size=215B - /25/35N (2|25|36): objs=2197 size=9.19KiB - /26/0N (2|25|36): objs=39807 size=796.6KiB - /26/1N (2|25|36): objs=38486 size=878.27KiB - /26/2N (2|25|36): objs=38525 size=760.75KiB - /26/3N (2|25|36): objs=5630 size=26.08KiB - /26/4S (2|25|36): objs=162 size=281B - /26/5N (2|25|36): objs=290 size=876B - /26/6S (2|25|36): objs=146 size=304B - /26/8S (2|25|36): objs=150 size=196B - /26/9N (2|25|36): objs=298 size=1.01KiB - /26/10S (2|25|36): objs=162 size=255B - /26/12S (2|25|36): objs=152 size=183B - /26/13N (2|25|36): objs=1038 size=4.19KiB - /26/14S (2|25|36): objs=139 size=125B - /26/15N (2|25|36): objs=475 size=1.52KiB - /26/16S (2|25|36): objs=148 size=105B - /26/17N (2|25|36): objs=1234 size=4.97KiB - /26/18S (2|25|36): objs=165 size=188B - /26/19N (2|25|36): objs=567 size=2KiB - /26/20S (2|25|36): objs=144 size=157B - /26/21N (2|25|36): objs=1769 size=7.44KiB - /26/22S (2|25|36): objs=161 size=329B - /26/23N (2|25|36): objs=2318 size=10.04KiB - /26/24S (2|25|36): objs=137 size=222B - /26/25N (2|25|36): objs=444 size=1.49KiB - /26/26S (2|25|36): objs=145 size=230B - /26/27N (2|25|36): objs=1057 size=4.28KiB - /26/28S (2|25|36): objs=168 size=251B - /26/29S (2|25|36): objs=160 size=217B - /26/30S (2|25|36): objs=157 size=332B - /26/31N (2|25|36): objs=17114 size=139.46KiB - /26/32S (2|25|36): objs=160 size=120B - /26/33N (2|25|36): objs=282 size=767B - /26/34S (2|25|36): objs=144 size=130B - /26/35N (2|25|36): objs=2191 size=9.38KiB - /27/0N (2|25|36): objs=41835 size=1.1MiB - /27/1N (2|25|36): objs=39014 size=691.15KiB - /27/2N (2|25|36): objs=21227 size=190.07KiB - /27/3S (2|25|36): objs=173 size=159B - /27/4N (2|25|36): objs=15451 size=112.09KiB - /27/5N (2|25|36): objs=272 size=677B - /27/6S (2|25|36): objs=157 size=104B - /27/7N (2|25|36): objs=787 size=3.2KiB - /27/8S (2|25|36): objs=172 size=179B - /27/9N (2|25|36): objs=308 size=882B - /27/10S (2|25|36): objs=132 size=259B - /27/11N (2|25|36): objs=1354 size=5.52KiB - /27/12S (2|25|36): objs=155 size=115B - /27/13N (2|25|36): objs=473 size=1.48KiB - /27/14S (2|25|36): objs=156 size=263B - /27/15N (2|25|36): objs=1556 size=6.28KiB - /27/16S (2|25|36): objs=148 size=301B - /27/17N (2|25|36): objs=2983 size=14.33KiB - /27/18S (2|25|36): objs=159 size=286B - /27/19S (2|25|36): objs=176 size=353B - /27/20S (2|25|36): objs=136 size=295B - /27/21N (2|25|36): objs=1836 size=7.93KiB - /27/22S (2|25|36): objs=137 size=284B - /27/23N (2|25|36): objs=756 size=3.07KiB - /27/24S (2|25|36): objs=145 size=312B - /27/25N (2|25|36): objs=5363 size=26.61KiB - /27/26S (2|25|36): objs=132 size=163B - /27/27N (2|25|36): objs=1502 size=6.13KiB - /27/28S (2|25|36): objs=135 size=220B - /27/29N (2|25|36): objs=7112 size=35.28KiB - /27/30S (2|25|36): objs=160 size=181B - /27/31N (2|25|36): objs=5570 size=28.06KiB - /27/32S (2|25|36): objs=178 size=294B - /27/33N (2|25|36): objs=4700 size=22.14KiB - /27/34S (2|25|36): objs=140 size=179B - /27/35N (2|25|36): objs=1539 size=6.62KiB - /28/0N (2|25|36): objs=39852 size=959.71KiB - /28/1N (2|25|36): objs=5993 size=27.18KiB - /28/2S (2|25|36): objs=169 size=233B - /28/3N (2|25|36): objs=30161 size=464.94KiB - /28/4N (2|25|36): objs=36110 size=609.29KiB - /28/5S (2|25|36): objs=157 size=192B - /28/6N (2|25|36): objs=861 size=3.34KiB - /28/7S (2|25|36): objs=145 size=113B - /28/8N (2|25|36): objs=1188 size=4.94KiB - /28/9S (2|25|36): objs=160 size=94B - /28/10N (2|25|36): objs=3416 size=14.33KiB - /28/11N (2|25|36): objs=3176 size=13.51KiB - /28/12S (2|25|36): objs=152 size=256B - /28/13N (2|25|36): objs=306 size=1009B - /28/14S (2|25|36): objs=158 size=98B - /28/15N (2|25|36): objs=1365 size=5.61KiB - /28/16S (2|25|36): objs=157 size=143B - /28/17N (2|25|36): objs=6718 size=32.51KiB - /28/18S (2|25|36): objs=165 size=300B - /28/19N (2|25|36): objs=7839 size=41.4KiB - /28/20S (2|25|36): objs=150 size=307B - /28/21N (2|25|36): objs=5484 size=25.9KiB - /28/22S (2|25|36): objs=134 size=160B - /28/23N (2|25|36): objs=613 size=2.28KiB - /28/24S (2|25|36): objs=166 size=282B - /28/25S (2|25|36): objs=138 size=85B - /28/26S (2|25|36): objs=141 size=207B - /28/27N (2|25|36): objs=3226 size=13.78KiB - /28/28S (2|25|36): objs=146 size=330B - /28/29N (2|25|36): objs=1226 size=5KiB - /28/30S (2|25|36): objs=164 size=228B - /28/31S (2|25|36): objs=154 size=213B - /28/32S (2|25|36): objs=151 size=322B - /28/33N (2|25|36): objs=2960 size=12.64KiB - /28/34S (2|25|36): objs=134 size=118B - /28/35N (2|25|36): objs=1143 size=4.59KiB - /29/0N (2|25|36): objs=37906 size=778.88KiB - /29/1N (2|25|36): objs=38247 size=841.07KiB - /29/2N (2|25|36): objs=41420 size=982.82KiB - /29/3N (2|25|36): objs=2953 size=12.63KiB - /29/4S (2|25|36): objs=139 size=159B - /29/5S (2|25|36): objs=136 size=224B - /29/6S (2|25|36): objs=139 size=299B - /29/7N (2|25|36): objs=1658 size=7.01KiB - /29/8S (2|25|36): objs=184 size=338B - /29/9N (2|25|36): objs=324 size=964B - /29/10S (2|25|36): objs=144 size=273B - /29/11N (2|25|36): objs=4255 size=21.6KiB - /29/12S (2|25|36): objs=166 size=203B - /29/13N (2|25|36): objs=5743 size=28KiB - /29/14S (2|25|36): objs=148 size=272B - /29/16S (2|25|36): objs=151 size=245B - /29/17N (2|25|36): objs=1357 size=5.48KiB - /29/18S (2|25|36): objs=156 size=164B - /29/19S (2|25|36): objs=162 size=194B - /29/20S (2|25|36): objs=151 size=160B - /29/21N (2|25|36): objs=1865 size=7.86KiB - /29/22S (2|25|36): objs=172 size=341B - /29/23N (2|25|36): objs=5378 size=25.74KiB - /29/24S (2|25|36): objs=142 size=272B - /29/25N (2|25|36): objs=1268 size=5KiB - /29/26S (2|25|36): objs=135 size=130B - /29/27N (2|25|36): objs=3447 size=15.53KiB - /29/28S (2|25|36): objs=158 size=185B - /29/29N (2|25|36): objs=3264 size=14.32KiB - /29/30S (2|25|36): objs=142 size=194B - /29/31N (2|25|36): objs=1667 size=6.7KiB - /29/32S (2|25|36): objs=154 size=134B - /29/34S (2|25|36): objs=168 size=297B - /29/35N (2|25|36): objs=2905 size=12.18KiB - /30/0N (2|25|36): objs=38668 size=888.4KiB - /30/1N (2|25|36): objs=41872 size=1.04MiB - /30/2N (2|25|36): objs=46240 size=1.26MiB - /30/3N (2|25|36): objs=12512 size=77.42KiB - /30/4S (2|25|36): objs=156 size=161B - /30/5N (2|25|36): objs=589 size=2.12KiB - /30/6S (2|25|36): objs=132 size=192B - /30/7N (2|25|36): objs=1592 size=6.41KiB - /30/8S (2|25|36): objs=158 size=218B - /30/10S (2|25|36): objs=161 size=238B - /30/11N (2|25|36): objs=4260 size=19.16KiB - /30/12S (2|25|36): objs=164 size=210B - /30/13N (2|25|36): objs=3746 size=17.23KiB - /30/14S (2|25|36): objs=144 size=136B - /30/15N (2|25|36): objs=1799 size=7.49KiB - /30/16S (2|25|36): objs=157 size=268B - /30/18S (2|25|36): objs=158 size=113B - /30/19N (2|25|36): objs=492 size=1.63KiB - /30/20S (2|25|36): objs=160 size=227B - /30/21N (2|25|36): objs=292 size=796B - /30/22S (2|25|36): objs=156 size=319B - /30/23N (2|25|36): objs=610 size=2.14KiB - /30/24S (2|25|36): objs=142 size=123B - /30/25N (2|25|36): objs=2272 size=9.42KiB - /30/26S (2|25|36): objs=145 size=147B - /30/27N (2|25|36): objs=310 size=882B - /30/28S (2|25|36): objs=159 size=170B - /30/29N (2|25|36): objs=931 size=3.55KiB - /30/30S (2|25|36): objs=154 size=240B - /30/31N (2|25|36): objs=4603 size=22.18KiB - /30/32S (2|25|36): objs=166 size=185B - /30/33N (2|25|36): objs=758 size=2.87KiB - /30/34S (2|25|36): objs=153 size=237B - /30/35N (2|25|36): objs=579 size=2.29KiB - /31/0N (2|25|36): objs=39264 size=884.4KiB - /31/1N (2|25|36): objs=40000 size=902.55KiB - /31/2N (2|25|36): objs=27673 size=558.4KiB - /31/3S (2|25|36): objs=140 size=138B - /31/4N (2|25|36): objs=1184 size=4.8KiB - /31/5S (2|25|36): objs=147 size=119B - /31/6N (2|25|36): objs=2741 size=11.61KiB - /31/7S (2|25|36): objs=142 size=199B - /31/9S (2|25|36): objs=146 size=100B - /31/10N (2|25|36): objs=4058 size=17.39KiB - /31/11N (2|25|36): objs=2864 size=12.38KiB - /31/12S (2|25|36): objs=152 size=339B - /31/13N (2|25|36): objs=4827 size=21.32KiB - /31/14S (2|25|36): objs=169 size=314B - /31/15N (2|25|36): objs=3216 size=13.62KiB - /31/16S (2|25|36): objs=161 size=101B - /31/18S (2|25|36): objs=177 size=238B - /31/19N (2|25|36): objs=2129 size=8.52KiB - /31/20S (2|25|36): objs=191 size=168B - /31/21N (2|25|36): objs=1623 size=6.93KiB - /31/22S (2|25|36): objs=148 size=192B - /31/23N (2|25|36): objs=8832 size=51.06KiB - /31/24S (2|25|36): objs=135 size=311B - /31/25N (2|25|36): objs=2206 size=9.69KiB - /31/26S (2|25|36): objs=139 size=236B - /31/27N (2|25|36): objs=948 size=3.56KiB - /31/28S (2|25|36): objs=176 size=127B - /31/29N (2|25|36): objs=319 size=851B - /31/30S (2|25|36): objs=150 size=161B - /31/31N (2|25|36): objs=1042 size=4.04KiB - /31/32S (2|25|36): objs=147 size=129B - /31/33N (2|25|36): objs=6042 size=31.25KiB - /31/34S (2|25|36): objs=134 size=201B - /31/35N (2|25|36): objs=607 size=2.3KiB + CASSLAPGATN-KLfF + CASSLAPG-TNEKLyF -com.milaboratory.util.sorting.HashSorterTest > test2 SKIPPED + ------------------ -com.milaboratory.util.NSequenceWithQualityPrintHelperTest > test1 SKIPPED +com.milaboratory.core.mutations.MutationTest > exportRegexps STANDARD_OUT + S([\QAGCTNRYSWKMBDHV\E])(\d+)([\QAGCTNRYSWKMBDHV\E])|D([\QAGCTNRYSWKMBDHV\E])(\d+)|I(\d+)([\QAGCTNRYSWKMBDHV\E]) + S([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E])(\d+)([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E])|D([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E])(\d+)|I(\d+)([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E]) -com.milaboratory.util.AtomicEnumHistogramTest > test1 STANDARD_OUT - {"labels":["A","B","C","null"],"hist":[1,2,0,1]} +com.milaboratory.core.mutations.MutationsUtilTest > test1111 STANDARD_OUT + S([\QAGCTNRYSWKMBDHV\E])(\d+)([\QAGCTNRYSWKMBDHV\E])|D([\QAGCTNRYSWKMBDHV\E])(\d+)|I(\d+)([\QAGCTNRYSWKMBDHV\E]) + S([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E])(\d+)([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E])|D([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E])(\d+)|I(\d+)([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E]) + +com.milaboratory.core.mutations.MutationsUtilTest > nt2AAWithMappingManual1 STANDARD_OUT + [I2C::SM0I, I2G::I1A, I2C::I1A, SG2C:SM0I:I1A] + +com.milaboratory.core.mutations.MutationsUtilTest > nt2AAWithMappingManual2 STANDARD_OUT + [S0:T->N,D13:V,S14:S->Y,S15:P->R,S16:W->P,S17:Y->G,S18:D->T,S19:P->I,S20:G->P,S21:D->A,S22:K->T,S23:A->K,S24:F->R,S25:G->S,S26:P->D,I27:S] + [-1, -1, 9, 15] + +com.milaboratory.core.mutations.MutationsUtilTest > nt2AAWithMappingManual3 STANDARD_OUT + 0 CAGGTTCAGCTGGTGCAGTCTGGAGCTGAGGTGAAGAAGCCTGGGGCCTCAGTGAAGGTCTCCTGCAAGGCTTCTGGTTACACCTTTACCAGCTACGGTATCAGCTGGGTGCGACAGGCCCCTGGACAAGGGCTTGAGTGGATGGGATGGATCAGCGCTTACAATGGTAACACAAACTATGCACAGAAGCTCCAGGGCAGAGTCACCATGACCACAGACACATCCACGAGCACAGCCTACATGGAGCTGAGGAGCCTGAGATCTGACGACACGGCCGTGTATTACTGTGCGAGAGA 295 + |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||| ||||| ||||||||||||||||||||||||||||| ||||||||| ||||||||| ||||||||||||||||||| || ||||| ||| || |||||||||||||| + 0 CAGGTTCAGCTGGTGCAGTCTGGAGCTGAGGTGAAGAAGCCTGGGGCCTCAGTGAAGGTCTCCTGCAAGGCTTCTGGTTACACCTTTACCAGCTACGGTATCAGCTGGGTGCGACAGGCCCCTGGACAAGGGCTTGAGTGGATGGGATGGATCAGCGCTTACAATGGTAACACATTCTATGCAGAGAAGTTCCAGGGCAGAGTCACCATGACCACAGACGCATCCACGACCACAGCCTATATGGAGCTGAGGAGCCTGACATTTGACG-----GCCACATACTACTGTGCGAGAGA 290 + [S58:N->F,S61:Q->E,S63:L->F,S73:T->A,S76:S->T,S86:R->T,S87:S->F,S89:D->G,D90:T,D91:A,S92:V->H,S93:Y->I,S94:Y->L,S95:C->L,S96:A->C,S97:R->E,S98:_->R] + QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYGISWVRQAPGQGLEWMGWISAYNGNTFYAEKFQGRVTMTTDASTTTAYMELRSLTFDGHILLCER + QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYGISWVRQAPGQGLEWMGWISAYNGNTFYAEKFQGRVTMTTDASTTTAYMELRSLTFDGHILLCER + [S58:N->F,S61:Q->E,S63:L->F,S73:T->A,S76:S->T,S86:R->T,S87:S->F,S89:D->G,D90:T,D91:A,S92:V->H,S93:Y->I,S94:Y->L,S95:C->L,S96:A->C,S97:R->E,S98:_->R] + [0, 0, 1, 2, 3, 4, -1, 5, 6, 7, 7, 8, 8, 8, 10, 10, 11, 12] + +com.milaboratory.core.mutations.MutationsUtilTest > nt2AAWithMappingManual4 STANDARD_OUT + [S3:S->M,D4:D,S5:_->I] + +com.milaboratory.core.mutations.MutationsTest > testCanonical1 STANDARD_OUT + GTGCCCCGGGAGGTTTTGCAACGTCACATCCACGTTCTGGGTTGAAGACGTGCTAAGTGATAGGAGAATAAGGCCGCAAAGATCCGGTTCAATGGGAATTATTCAAATTCCCCTACCATGGGGGAGACGTTCGGGGTGTCAGAAACTAGTTTTAGTGGCGAACTAGAGGCCGTCCAAGACATCGCCTGTATCATTACCGCATCTGCCCGGGAGCCGCCATGGGACGTTACTCTCGCGACCCGTTACAATGACATCTCGCTCCTGTGCTAAAGATACGAAACGCCAGATCGCGTGACGGGGTCTTGTAAAAGTAGGTTCTCGGTGGGGTTAGCAAGGCGACTGCTTTAGCTGCTGAACGACCCCGTGAGTATGATGCTAAGTGTACTATTTAAACTGGACGAGTTCACTTGTCGCCATCATACGTCGTGCTATATATCCGTCTCCATATATAAGTCCCGTGAGGGGCCGGGCCTGGAGTGTCGACAACAAGGGCAGCAGACATCTCTGCATAGTCAACGGAACCAGAAGTTCAGAGCGATCTCGGGCTAATCCACTGAGATTCTGTGCAACAGAGTACAAGAGCGAAGTTGATTAGAGGGCGCCGAGGGGGAAAAAACTTTACTTTTAGAGAAC + AGTCCCCGGGAGGTTTACAACGTCACATCCACGTTTCTGGTTTGAAGACGTGCTAAGTGATAGGAGAATAAGGCCGCAAAGATCCGGTTCAATGGGAATTATTCGAATTCCCCTACCATGGTGAGACGGTTTCTGGGTTTCAGAACTAGTTTAGTGGCGAACTAGAGTCCGTTCAGGATCGCCTGTATCATTACCGCATCTGCCCGGGAGCCTCCATGGGACGTTACTCCGCGGCCCTTACAATAGACATCTCGCTTCCCTGTTCTATAGATACGAAACGCACAGTCGCGCGACGGGGTTGTAAAAGAGGTCTCGGTGTGGTTAGCAAGGCGACTGCTTTAGCTGCTAACGACCCCGTGAGTATGATGCTAGTGTACTATTTAGACTAACTTGTCCATTGTCGCCATCAACGCCTTGCGCTAGTATCCGTCTCCATACTTGATAGTCCCGTAGGGGCCAGGCCTGGAGGTCGACAACAGGGCAGCAGACTCTCTCATAGCAACGGAACGCAGAAGTTCAAGCGACTCGGGCTAACCCAGAGATCTTTGCAACTGAGTACAAGAGCGAGGTTGATAGAGGGCGCGAGGGGAAAAAACTACTTTTAGAGAAC + AGTCCCGGGAGTTTCAACGTCACATCCACGTTTTGGTTGAAGACGTGCTTAAGTGTTAGGGGAATAATCGCAAAGACCGGTTCAATGGGAATTATGAATTCCCCTACCATGGAGACGGTTTCTGGGTTTCAGAACATTTAGTGGGAACTAGAGTCCGTTCAGGATCGCCTGTATCATTACCGCATCTGCCCGGGAGCCTCCCATGGGACGTTACTCCGCGGGCCGCTTACAATGTACATCTGCTTCCCTGTTCTATTGATACGAAACGCTCAGCCCGGACTGGGTTGGTAAAAGAGGTCTCGGGTGTAGTTTGCAAGGCGACTGCTTTAGCTGCTAACGAGCCCCGTGGTGTGATGCTATGTACTATTTAGACTAACTTGTACCATTGTCGCCATCAACGCCTTGTGCTAGTATCCGTCTCCAACTTGTAGTCCCGTAGGGGCCAGCGCCTGAGGTCGACAACAGGGAGCAGACTCTCTCATAGCGACGAACGCAGAAGTTCAAGCGACTCGGCTAACCCAGAGATCTTTGCAACTGAGTAAAGAGCGAGGTTGATAGAGGGCGCGTGCGGGAAACTACTTTTAGATAAC + 0 AGT--CCCGGGA-G-TTT-CAACGTCACATCCACGTT-TTGGTTGAAGACGTGCTTAAGTGTTAGGGGAATAA--TCGCAAAGA-CCGGTTCAATGGGAATTA-T-GAATTCCCCTACCAT---GGAGACGGTTTCTGGGTTTCAG-AAC-A--TTTAGTGG-GAACTAGAGTCCGTTC-AG-GATCGCCTGTATCATTACCGCATCTGCCCGGGAGCCTCCCATGGGACGTTACTC-CGCGGGCCGCTTACAATGTACATCT-GCTTCCCTGTTCTATTGATACGAAACGCTCAG--CCCG-GACTGGGT-TGGTAAAAG-AGG-TCTCGGGTGTAGTTTGCAAGGCGACTGCTTTAGCTGCT-AACGAGCCCCGTG-GTGTGATGCT-A-TGTACTATTTAGACT-AACTTGTAC-CATTGTCGCCATCA-ACGCCTTGTGCTA-GTATCCGTCTCCA-ACT-TGTAGTCCCGT-AGGGGCCAGCGCCT-GAG-GTCGACAAC-AGGG-AGCAGAC-TCTCT-CATAG-CGAC-GAACGCAGAAGTTCA-AGCGA-CTC-GGCTAA-CC-CAGAGA-TCTTTGCAACTGAGTA-AAGAGCGAGGTTGA-TAGAGGGCG-CGTGCGGG---AAAC--TACTTTTAGATAAC 589 + || ||||||| | ||| |||||||||||||||||| | |||||||||||||| |||||| |||| |||||| |||||||| |||||||||||||||||| | |||||||||||||| |||||| | ||| |||| |||| ||| | |||||||| ||||||||| |||| | || ||||||||||||||||||||||||||||||||||| |||||||||||||||| |||| ||| |||||||| |||||| || | ||||| ||| |||||||||||| ||| | || ||| |||| | ||||||| ||| |||| |||| ||| ||||||||||||||||||||||| ||||| ||||||| || ||||||| | ||||||||||| ||| || || | | |||||||||||| ||| | |||||| |||||||||||| | | | |||||||| ||||||| | |||| ||| ||||||||| |||| ||||||| ||||| ||||| | || |||| |||||||||| ||||| ||| |||||| || | |||| ||| |||||| ||||| |||||||| ||||| ||||||||| || | ||| |||| |||||||||| ||| + 0 -GTGCCCCGGGAGGTTTTGCAACGTCACATCCACGTTCTGGGTTGAAGACGTGC-TAAGTGATAGGAGAATAAGGCCGCAAAGATCCGGTTCAATGGGAATTATTCAAATTCCCCTACCATGGGGGAGAC-G-TTCGGGGTGTCAGAAACTAGTTTTAGTGGCGAACTAGAGGCCGTCCAAGACATCGCCTGTATCATTACCGCATCTGCCCGGGAGCC-GCCATGGGACGTTACTCTCGCGACCCG-TTACAATG-ACATCTCGC-T-CCTGTGCTAAAGATACGAAACGC-CAGATCGCGTGACGGGGTCTTGTAAAAGTAGGTTCTC-GGTGGGGTTAGCAAGGCGACTGCTTTAGCTGCTGAACGA-CCCCGTGAGTATGATGCTAAGTGTACTATTTAAACTGGACGAGTTCAC-TTGTCGCCATCATACG--TCGTGCTATATATCCGTCTCCATA-TAT-AAGTCCCGTGAGGGGCC-GGGCCTGGAGTGTCGACAACAAGGGCAGCAGACATCTCTGCATAGTCAACGGAAC-CAGAAGTTCAGAGCGATCTCGGGCTAATCCACTGAGATTCTGTGCAACAGAGTACAAGAGCGAAGTTGATTAGAGGGCGCCGAGGGGGAAAAAACTTTACTTTTAGAGAAC 632 + [I2:G,S2:G->C,D6:C,I11:G,S12:G->T,S16:T->G,D17:G,I35:T,I35:C,D36:C,S37:T->G,D40:G,I71:G,I71:G,S71:G->C,D72:G,D74:C,I101:T,S102:T->C,D103:C,I119:G,I119:G,D121:G,D122:G,D129:T,I131:T,I132:G,D134:G,I142:A,D144:A,I148:G,S148:G->T,D151:T,I175:A,S176:A->G,I177:A,S177:G->C,D178:A,D179:C,I236:G,S236:G->A,S237:A->C,S240:C->G,D241:G,I286:A,S286:A->T,S287:T->C,S288:C->G,D289:G,I296:G,D297:G,D302:T,I304:T,D320:G,I322:G,I353:G,S353:G->A,D354:A,I377:A,S378:A->G,D379:G,I395:G,D396:G,D402:T,I404:T,D423:T,D424:C,S425:G->T,S426:T->C,S428:C->T,I429:G,I429:C,D447:T,S448:A->T,I449:A,D467:G,I469:G,I549:T,S549:T->C,I551:A,S552:A->T,D553:C,D554:T,D605:G,I607:G,I610:A,I610:A,D612:A,D614:A,I617:T,D619:T] + 0 GT-GCCCCGGGA-GGTTTTGCAACGTCACATCCACGT--TCTGGGTTGAAGACGTGCTAAGTGATAGGAGAATAA--GGCCGCAAAGATCCGGTTCAATGGGAATTA-TTCAAATTCCCCTACCAT--GGGGGAGACGTT-C-GGGGTGTCAG-AAACTA-GTTTTAGTGGCGAACTAGAGGCCGTCC-AA-GACATCGCCTGTATCATTACCGCATCTGCCCGGGAGCCGCCATGGGACGTTACTCTCGC-GACCCGTTACAATGACATCTCGCTCCTGTGCTAAAGATACGAAACGCCAG-ATCGCGTGAC-GGGGTCTT-GTAAAAGTAGGTTCTCGG-TGGGGTTAGCAAGGCGACTGCTTTAGCTGCT-GAACGACCCCGTGAGTATGATGCT-AAGTGTACTATTTAAACT-GGACGAGTT-CACTTGTCGCCATCATACGTCGTGC--TATATATCCGTCTCCATATA-TAAGTCCCGTGAGGGGCCGG-GCCTGGAGTGTCGACAACAAGGGCAGCAGACATCTCTGCATAGTCAACGGAACCAGAAGTTCAGAGCGATCTCGGGCTAA-TC-CACTGAGATTCTGTGCAACAGAGTACAAGAGCGAAGTTGATTAGAGGGCGCCGAGG-GGG--AAAAAAC-TTTACTTTTAGAGAAC 632 + || ||| |||| | ||| ||||||||||||||||| | || |||||||||||||||||||||||||||||| | |||||||||||||||||||||||||| | ||||||||||||||| || |||||| | | || ||||||| || ||| || ||||||||||||||||||||||| | |||||||||||||||||||||||||||||||||||||||||||||||||||||||| || |||||||||||||||||||||||||||||||||||||||||||| |||||| | |||| | |||||||||||||||| | ||||||||||||||||||||||||||||||| |||||||||||||||||||||| | ||||||||||||||| | ||||| | ||||||||||||||||||| | |||||||||||||||||| |||||||||||||||||| | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| | | |||||||||||||||||||||||||||||||||||||||||||||||||| | ||| || | || || ||||||||||||| + 0 GTGCCCC-GGGAGGTTTTG-CAACGTCACATCCACGTTCT-GGG-TTGAAGACGTGCTAAGTGATAGGAGAATAAGGC-C-GCAAAGATCCGGTTCAATGGGAATTATTC-AAATTCCCCTACCATGGGG--GAGACG-TTCGGG-GTGTCAGAAA-CTAGTTT-TAGTGGCGAACTAGAGGCCGTCCAAGAC--ATCGCCTGTATCATTACCGCATCTGCCCGGGAGCCGCCATGGGACGTTACTCTCGCGACCCG-TTACAATGACATCTCGCTCCTGTGCTAAAGATACGAAACGCCAGATCG-CGTGACGG-GGTC-TTGTAAAAGTAGGTTCTC-GGTGGGGTTAGCAAGGCGACTGCTTTAGCTGCTGA-ACGACCCCGTGAGTATGATGCTAAG-TGTACTATTTAAACTGG-ACGAG-TTCACTTGTCGCCATCATACG--TCGTGCTATATATCCGTCTCCATA-TATAAGTCCCGTGAGGGGCC-GGGCCTGGAGTGTCGACAACAAGGGCAGCAGACATCTCTGCATAGTCAACGGAACCAGAAGTTCAGAGCGATCTCGGGCTAATCCACT--GAGATTCTGTGCAACAGAGTACAAGAGCGAAGTTGATTAGAGGGCGCCGA-GGGGGAAAA-A-ACTTT-ACTTTTAGAGAAC 632 com.milaboratory.primitivio.blocks.PrimitivOBlocksTest > benchmark1 SKIPPED com.milaboratory.primitivio.blocks.PrimitivOBlocksTest > test1 STANDARD_OUT + Pending / IO / Serde: 1 / 0 / 2 + Pending / IO / Serde: 0 / 0 / 4 + Pending / IO / Serde: 0 / 0 / 0 ================== High compression: false Concurrency: 4 File size: 6799510 - Write time: 761.9ms + Write time: 5.37s O. Stats: - Wall clock time: 775.54ms - Total CPU time: 1.02s - User wait time: 588.06ms - Serialization time: 170.22ms (16.75%) - Checksum calculation time: 328.51ms (32.33%) - Compression time: 356.58ms (35.1%) - Total IO delay: 415.32ms - Concurrency overhead: 220.39ms + Wall clock time: 5.4s + Total CPU time: 10.92s + User wait time: 4.02s + Serialization time: 8.37s (76.63%) + Checksum calculation time: 1.77s (16.25%) + Compression time: 677.05ms (6.2%) + Total IO delay: 534.73ms + Concurrency overhead: 508.26ms Uncompressed size: 18.44MiB (~2.08KiB per object) Output size: 6.48MiB (~748B per object; compression = 35.17%) - IO speed: 15.63MiB/s - Concurrency adjusted uncompressed speed: 31.9MiB/s - Actual uncompressed speed: 23.79MiB/s - Actual speed: 8.37MiB/s + IO speed: 12.14MiB/s + Concurrency adjusted uncompressed speed: 5.47MiB/s + Actual uncompressed speed: 3.42MiB/s + Actual speed: 1.2MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 748B Blocks: 62 (~107.1KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Pending / IO / Serde: 0 / 0 / 0 + Pending / IO / Serde: 0 / 0 / 0 + Pending / IO / Serde: 2 / 1 / 0 I. Stats 1: - Wall clock time: 674.35ms - Total CPU time: 630.16ms - Serialization time: 445.81ms (70.75%) - Checksum calculation time: 75.69ms (12.01%) - Compression time: 102.76ms (16.31%) - Total IO delay: 274.73ms + Wall clock time: 4.3s + Total CPU time: 6.48s + Serialization time: 4.98s (76.87%) + Checksum calculation time: 571.7ms (8.82%) + Compression time: 906.91ms (13.99%) + Total IO delay: 474.53ms Input size: 6.48MiB Decompressed size: 18.44MiB (compression = 35.17%) - IO speed: 23.67MiB/s - Concurrency adjusted uncompressed speed: 81.58MiB/s - Actual uncompressed speed: 27.35MiB/s - Actual speed: 9.62MiB/s + IO speed: 13.68MiB/s + Concurrency adjusted uncompressed speed: 10.6MiB/s + Actual uncompressed speed: 4.28MiB/s + Actual speed: 1.51MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 748B Blocks: 62 (~107.1KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 + Pending / IO / Serde: 0 / 0 / 0 + Pending / IO / Serde: 0 / 0 / 0 I. Stats 2: - Wall clock time: 1.6s - Total CPU time: 913.07ms - Serialization time: 521.65ms (57.13%) - Checksum calculation time: 160.49ms (17.58%) - Compression time: 219.07ms (23.99%) - Total IO delay: 638.48ms + Wall clock time: 7.74s + Total CPU time: 9.73s + Serialization time: 6.73s (69.16%) + Checksum calculation time: 1.15s (11.77%) + Compression time: 1.8s (18.52%) + Total IO delay: 817.32ms Input size: 12.97MiB Decompressed size: 36.87MiB (compression = 35.17%) - IO speed: 20.33MiB/s - Concurrency adjusted uncompressed speed: 95.28MiB/s - Actual uncompressed speed: 22.99MiB/s - Actual speed: 8.09MiB/s + IO speed: 15.87MiB/s + Concurrency adjusted uncompressed speed: 13.98MiB/s + Actual uncompressed speed: 4.77MiB/s + Actual speed: 1.68MiB/s Objects: 18158 Average object size uncompressed: 2.08KiB Average object size compressed: 748B Blocks: 124 (~107.1KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 + Pending / IO / Serde: 2 / 0 / 2 + Pending / IO / Serde: 0 / 0 / 0 ================== High compression: false Concurrency: 4 File size: 6791878 - Write time: 625.33ms + Write time: 3.39s O. Stats: - Wall clock time: 626.31ms - Total CPU time: 752.52ms - User wait time: 495.53ms - Serialization time: 253.79ms (33.73%) - Checksum calculation time: 200.3ms (26.62%) - Compression time: 294.29ms (39.11%) - Total IO delay: 158.17ms - Concurrency overhead: 71.47ms + Wall clock time: 3.4s + Total CPU time: 4.04s + User wait time: 2.54s + Serialization time: 2.46s (60.93%) + Checksum calculation time: 441.02ms (10.91%) + Compression time: 1.08s (26.73%) + Total IO delay: 603.73ms + Concurrency overhead: 122.79ms Uncompressed size: 18.44MiB (~2.08KiB per object) Output size: 6.48MiB (~748B per object; compression = 35.13%) - IO speed: 41MiB/s - Concurrency adjusted uncompressed speed: 61.66MiB/s - Actual uncompressed speed: 29.45MiB/s - Actual speed: 10.35MiB/s + IO speed: 10.74MiB/s + Concurrency adjusted uncompressed speed: 14.36MiB/s + Actual uncompressed speed: 5.43MiB/s + Actual speed: 1.91MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 748B Blocks: 20 (~331.63KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 + Pending / IO / Serde: 0 / 0 / 0 I. Stats 1: - Wall clock time: 652.87ms - Total CPU time: 672.82ms - Serialization time: 252.4ms (37.51%) - Checksum calculation time: 192.01ms (28.54%) - Compression time: 227.26ms (33.78%) - Total IO delay: 90.53ms + Wall clock time: 2.25s + Total CPU time: 2.43s + Serialization time: 1.07s (44.04%) + Checksum calculation time: 362.92ms (14.95%) + Compression time: 982.8ms (40.48%) + Total IO delay: 320.45ms Input size: 6.48MiB Decompressed size: 18.44MiB (compression = 35.13%) - IO speed: 71.97MiB/s - Concurrency adjusted uncompressed speed: 97.04MiB/s - Actual uncompressed speed: 28.28MiB/s - Actual speed: 9.93MiB/s + IO speed: 20.24MiB/s + Concurrency adjusted uncompressed speed: 26.84MiB/s + Actual uncompressed speed: 8.19MiB/s + Actual speed: 2.88MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 748B Blocks: 20 (~331.63KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 - Pending / IO / Serde: 2 / 1 / 0 + Pending / IO / Serde: 0 / 1 / 0 + Pending / IO / Serde: 0 / 0 / 0 I. Stats 2: - Wall clock time: 1.41s - Total CPU time: 1.3s - Serialization time: 493.56ms (37.88%) - Checksum calculation time: 382.58ms (29.36%) - Compression time: 424.4ms (32.57%) - Total IO delay: 191.87ms + Wall clock time: 5.23s + Total CPU time: 4.83s + Serialization time: 2.08s (43.04%) + Checksum calculation time: 763.51ms (15.82%) + Compression time: 1.95s (40.32%) + Total IO delay: 610.16ms Input size: 12.95MiB Decompressed size: 36.87MiB (compression = 35.13%) - IO speed: 67.82MiB/s - Concurrency adjusted uncompressed speed: 98.86MiB/s - Actual uncompressed speed: 26.1MiB/s - Actual speed: 9.17MiB/s + IO speed: 21.24MiB/s + Concurrency adjusted uncompressed speed: 27.13MiB/s + Actual uncompressed speed: 7.05MiB/s + Actual speed: 2.48MiB/s Objects: 18158 Average object size uncompressed: 2.08KiB Average object size compressed: 748B Blocks: 40 (~331.63KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 + Pending / IO / Serde: 0 / 0 / 1 + Pending / IO / Serde: 0 / 0 / 1 ================== High compression: false Concurrency: 1 File size: 6799510 - Write time: 837.34ms + Write time: 4.94s O. Stats: - Wall clock time: 838.57ms - Total CPU time: 357.87ms - User wait time: 782.26ms - Serialization time: 81.32ms (22.72%) - Checksum calculation time: 57.51ms (16.07%) - Compression time: 212.85ms (59.48%) - Total IO delay: 192.55ms - Concurrency overhead: 115.79ms + Wall clock time: 4.95s + Total CPU time: 3.44s + User wait time: 4.47s + Serialization time: 1.89s (54.86%) + Checksum calculation time: 440.27ms (12.8%) + Compression time: 1.03s (30.03%) + Total IO delay: 519.92ms + Concurrency overhead: 359.89ms Uncompressed size: 18.44MiB (~2.08KiB per object) Output size: 6.48MiB (~748B per object; compression = 35.17%) - IO speed: 33.77MiB/s - Concurrency adjusted uncompressed speed: 27.68MiB/s - Actual uncompressed speed: 22MiB/s - Actual speed: 7.74MiB/s + IO speed: 12.49MiB/s + Concurrency adjusted uncompressed speed: 4.27MiB/s + Actual uncompressed speed: 3.73MiB/s + Pending / IO / Serde: 0 / 0 / 0 + Actual speed: 1.31MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 748B Blocks: 62 (~107.1KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Checksum ok! + Pending / IO / Serde: 0 / 1 / 0 I. Stats 1: - Wall clock time: 539.62ms - Total CPU time: 268.53ms - Serialization time: 122.44ms (45.6%) - Checksum calculation time: 57.52ms (21.42%) - Compression time: 81.02ms (30.17%) - Total IO delay: 417.59ms + Wall clock time: 2.29s + Total CPU time: 2.77s + Serialization time: 1.34s (48.51%) + Checksum calculation time: 509.75ms (18.39%) + Compression time: 864.51ms (31.19%) + Total IO delay: 456.45ms Input size: 6.48MiB Decompressed size: 18.44MiB (compression = 35.17%) - IO speed: 15.55MiB/s - Concurrency adjusted uncompressed speed: 26.88MiB/s - Actual uncompressed speed: 34.21MiB/s - Actual speed: 12.03MiB/s + IO speed: 14.22MiB/s + Concurrency adjusted uncompressed speed: 5.71MiB/s + Actual uncompressed speed: 8.06MiB/s + Actual speed: 2.83MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 748B Blocks: 62 (~107.1KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 - Pending / IO / Serde: 2 / 1 / 0 + Pending / IO / Serde: 0 / 1 / 0 I. Stats 2: - Wall clock time: 1.17s - Total CPU time: 466.06ms - Serialization time: 179.6ms (38.54%) - Checksum calculation time: 114.6ms (24.59%) - Compression time: 155.4ms (33.34%) - Total IO delay: 902.33ms + Wall clock time: 5.17s + Total CPU time: 5.89s + Serialization time: 2.95s (50.08%) + Checksum calculation time: 1.17s (19.89%) + Compression time: 1.67s (28.45%) + Total IO delay: 904.69ms Input size: 12.97MiB Decompressed size: 36.87MiB (compression = 35.17%) - IO speed: 14.38MiB/s - Concurrency adjusted uncompressed speed: 26.95MiB/s - Actual uncompressed speed: 31.49MiB/s - Actual speed: 11.08MiB/s + IO speed: 14.35MiB/s + Concurrency adjusted uncompressed speed: 5.43MiB/s + Actual uncompressed speed: 7.13MiB/s + Actual speed: 2.51MiB/s Objects: 18158 Average object size uncompressed: 2.08KiB Average object size compressed: 748B Blocks: 124 (~107.1KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 + Pending / IO / Serde: 0 / 0 / 1 + Pending / IO / Serde: 0 / 0 / 0 ================== High compression: false Concurrency: 1 File size: 6791878 - Write time: 921.45ms + Write time: 3.36s O. Stats: - Wall clock time: 922.62ms - Total CPU time: 638.27ms - User wait time: 852.19ms - Serialization time: 200.12ms (31.35%) - Checksum calculation time: 187.15ms (29.32%) - Compression time: 235.57ms (36.91%) - Total IO delay: 138.92ms - Concurrency overhead: 35.49ms + Wall clock time: 3.36s + Total CPU time: 2.48s + User wait time: 3.02s + Serialization time: 1.54s (62.13%) + Checksum calculation time: 271.45ms (10.93%) + Compression time: 613.21ms (24.7%) + Total IO delay: 388.62ms + Concurrency overhead: 39.18ms Uncompressed size: 18.44MiB (~2.08KiB per object) Output size: 6.48MiB (~748B per object; compression = 35.13%) - IO speed: 46.94MiB/s - Concurrency adjusted uncompressed speed: 22.71MiB/s - Actual uncompressed speed: 20MiB/s - Actual speed: 7.03MiB/s + IO speed: 16.69MiB/s + Concurrency adjusted uncompressed speed: 6.34MiB/s + Actual uncompressed speed: 5.48MiB/s + Actual speed: 1.93MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 748B @@ -4652,115 +3448,149 @@ Pending / IO / Serde: 0 / 0 / 0 I. Stats 1: - Wall clock time: 589.36ms - Total CPU time: 598.55ms - Serialization time: 148.56ms (24.82%) - Checksum calculation time: 225.64ms (37.7%) - Compression time: 223.33ms (37.31%) - Total IO delay: 71.44ms + Wall clock time: 2.2s + Total CPU time: 2.37s + Serialization time: 905.37ms (38.22%) + Checksum calculation time: 462.73ms (19.53%) + Compression time: 983.92ms (41.53%) + Total IO delay: 276.17ms Input size: 6.48MiB Decompressed size: 18.44MiB (compression = 35.13%) - IO speed: 91.23MiB/s - Concurrency adjusted uncompressed speed: 27.56MiB/s - Actual uncompressed speed: 31.3MiB/s - Actual speed: 11MiB/s + IO speed: 23.47MiB/s + Concurrency adjusted uncompressed speed: 6.97MiB/s + Actual uncompressed speed: 8.4MiB/s + Actual speed: 2.95MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 748B Blocks: 20 (~331.63KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 + Pending / IO / Serde: 0 / 0 / 0 + Pending / IO / Serde: 0 / 0 / 0 I. Stats 2: - Wall clock time: 1.26s - Total CPU time: 1.18s - Serialization time: 340.8ms (28.81%) - Checksum calculation time: 410.02ms (34.66%) - Compression time: 429.99ms (36.35%) - Total IO delay: 155.45ms + Wall clock time: 5.33s + Total CPU time: 5.34s + Serialization time: 2.05s (38.36%) + Checksum calculation time: 980.68ms (18.37%) + Compression time: 2.23s (41.79%) + Total IO delay: 532.22ms Input size: 12.95MiB Decompressed size: 36.87MiB (compression = 35.13%) - IO speed: 83.58MiB/s - Concurrency adjusted uncompressed speed: 27.56MiB/s - Actual uncompressed speed: 29.26MiB/s - Actual speed: 10.28MiB/s + IO speed: 24.35MiB/s + Concurrency adjusted uncompressed speed: 6.28MiB/s + Actual uncompressed speed: 6.92MiB/s + Actual speed: 2.43MiB/s Objects: 18158 Average object size uncompressed: 2.08KiB Average object size compressed: 748B Blocks: 40 (~331.63KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 + Pending / IO / Serde: 2 / 0 / 2 + Pending / IO / Serde: 2 / 0 / 2 Pending / IO / Serde: 1 / 0 / 3 + Pending / IO / Serde: 2 / 0 / 2 + Pending / IO / Serde: 3 / 0 / 1 + Pending / IO / Serde: 0 / 0 / 4 + Pending / IO / Serde: 1 / 0 / 3 + Pending / IO / Serde: 1 / 0 / 3 + Pending / IO / Serde: 3 / 0 / 1 Pending / IO / Serde: 1 / 0 / 3 Pending / IO / Serde: 2 / 0 / 2 Pending / IO / Serde: 1 / 0 / 3 Pending / IO / Serde: 0 / 0 / 4 + Pending / IO / Serde: 2 / 0 / 2 + Pending / IO / Serde: 1 / 0 / 3 + Pending / IO / Serde: 2 / 0 / 2 + Pending / IO / Serde: 2 / 0 / 2 + Pending / IO / Serde: 0 / 0 / 4 + Pending / IO / Serde: 2 / 0 / 2 + Pending / IO / Serde: 0 / 0 / 4 + Pending / IO / Serde: 2 / 0 / 2 + Pending / IO / Serde: 0 / 0 / 4 Pending / IO / Serde: 1 / 0 / 3 + Pending / IO / Serde: 1 / 0 / 3 + Pending / IO / Serde: 2 / 0 / 2 + Pending / IO / Serde: 1 / 0 / 2 + Pending / IO / Serde: 2 / 0 / 1 ================== High compression: true Concurrency: 4 File size: 4156299 - Write time: 13.56s + Write time: 53.9s O. Stats: - Wall clock time: 13.56s - Total CPU time: 34.83s - User wait time: 12.88s - Serialization time: 107.15ms (0.31%) - Checksum calculation time: 65.36ms (0.19%) - Compression time: 34.63s (99.41%) - Total IO delay: 272.04ms - Concurrency overhead: 83.73ms + Wall clock time: 53.93s + Total CPU time: 2.45m + User wait time: 50.69s + Serialization time: 1.96s (1.33%) + Checksum calculation time: 669.51ms (0.46%) + Compression time: 2.4m (98.1%) + Total IO delay: 540.62ms + Concurrency overhead: 386.74ms Uncompressed size: 18.44MiB (~2.08KiB per object) Output size: 3.96MiB (~457B per object; compression = 21.5%) - IO speed: 14.57MiB/s - Concurrency adjusted uncompressed speed: 2.08MiB/s - Actual uncompressed speed: 1.36MiB/s - Actual speed: 299.26KiB/s + IO speed: 7.34MiB/s + Concurrency adjusted uncompressed speed: 506.71KiB/s + Actual uncompressed speed: 350.07KiB/s + Actual speed: 75.26KiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 457B Blocks: 62 (~65.47KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 - Pending / IO / Serde: 0 / 1 / 0 + Pending / IO / Serde: 0 / 0 / 0 I. Stats 1: - Wall clock time: 443.09ms - Total CPU time: 196.43ms - Serialization time: 60.33ms (30.71%) - Checksum calculation time: 68.75ms (35%) - Compression time: 60.12ms (30.61%) - Total IO delay: 365.61ms + Wall clock time: 2.12s + Total CPU time: 2.96s + Serialization time: 1.31s (44.18%) + Checksum calculation time: 659.23ms (22.31%) + Compression time: 963.67ms (32.61%) + Total IO delay: 304.6ms Input size: 3.96MiB Decompressed size: 18.44MiB (compression = 21.5%) - IO speed: 10.86MiB/s - Concurrency adjusted uncompressed speed: 131.69MiB/s - Actual uncompressed speed: 41.62MiB/s - Actual speed: 8.95MiB/s + IO speed: 13.04MiB/s + Concurrency adjusted uncompressed speed: 22.62MiB/s + Actual uncompressed speed: 8.69MiB/s + Actual speed: 1.87MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 457B Blocks: 62 (~65.47KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 + Pending / IO / Serde: 0 / 0 / 0 I. Stats 2: - Wall clock time: 1.01s - Total CPU time: 424.75ms - Serialization time: 148.17ms (34.88%) - Checksum calculation time: 142.15ms (33.47%) - Compression time: 120.63ms (28.4%) - Total IO delay: 712.4ms + Wall clock time: 4.66s + Total CPU time: 5.57s + Serialization time: 2.58s (46.29%) + Checksum calculation time: 1.1s (19.78%) + Compression time: 1.84s (33.09%) + Total IO delay: 537.33ms Input size: 7.93MiB Decompressed size: 36.87MiB (compression = 21.5%) - IO speed: 11.13MiB/s - Concurrency adjusted uncompressed speed: 129.84MiB/s - Actual uncompressed speed: 36.58MiB/s - Actual speed: 7.86MiB/s + IO speed: 14.76MiB/s + Concurrency adjusted uncompressed speed: 24.16MiB/s + Actual uncompressed speed: 7.91MiB/s + Actual speed: 1.7MiB/s Objects: 18158 Average object size uncompressed: 2.08KiB Average object size compressed: 457B Blocks: 124 (~65.47KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Pending / IO / Serde: 2 / 0 / 2 + Pending / IO / Serde: 3 / 0 / 1 + Pending / IO / Serde: 2 / 0 / 2 + Pending / IO / Serde: 2 / 0 / 2 + Pending / IO / Serde: 2 / 0 / 2 + Pending / IO / Serde: 2 / 0 / 2 + Pending / IO / Serde: 2 / 0 / 2 + Pending / IO / Serde: 2 / 0 / 2 + Pending / IO / Serde: 2 / 0 / 2 + Pending / IO / Serde: 2 / 0 / 2 + Pending / IO / Serde: 2 / 0 / 2 Pending / IO / Serde: 2 / 0 / 2 Pending / IO / Serde: 2 / 0 / 2 Pending / IO / Serde: 3 / 0 / 1 @@ -4768,68 +3598,85 @@ Pending / IO / Serde: 2 / 0 / 2 Pending / IO / Serde: 2 / 0 / 2 Pending / IO / Serde: 2 / 0 / 2 + Pending / IO / Serde: 2 / 0 / 2 + Pending / IO / Serde: 2 / 0 / 2 + Pending / IO / Serde: 2 / 0 / 2 + Pending / IO / Serde: 2 / 0 / 2 + Pending / IO / Serde: 2 / 0 / 2 + Pending / IO / Serde: 2 / 0 / 2 + Pending / IO / Serde: 3 / 0 / 1 + Pending / IO / Serde: 3 / 0 / 1 + Pending / IO / Serde: 2 / 0 / 2 + Pending / IO / Serde: 2 / 0 / 2 + Pending / IO / Serde: 3 / 0 / 1 + Pending / IO / Serde: 3 / 0 / 1 + Pending / IO / Serde: 3 / 0 / 1 Pending / IO / Serde: 3 / 0 / 1 Pending / IO / Serde: 1 / 0 / 1 + Pending / IO / Serde: 1 / 0 / 1 + Pending / IO / Serde: 1 / 0 / 1 ================== High compression: true Concurrency: 4 File size: 4098671 - Write time: 20.42s + Write time: 1.18m O. Stats: - Wall clock time: 20.42s - Total CPU time: 35.33s - User wait time: 18.56s - Serialization time: 218.95ms (0.62%) - Checksum calculation time: 158.83ms (0.45%) - Compression time: 34.95s (98.92%) - Total IO delay: 133.31ms - Concurrency overhead: 26.43ms + Wall clock time: 1.18m + Total CPU time: 1.98m + User wait time: 1.06m + Serialization time: 1.46s (1.23%) + Checksum calculation time: 381.41ms (0.32%) + Compression time: 1.95m (98.36%) + Total IO delay: 303.63ms + Concurrency overhead: 77.01ms Uncompressed size: 18.44MiB (~2.08KiB per object) Output size: 3.91MiB (~451B per object; compression = 21.2%) - IO speed: 29.39MiB/s - Concurrency adjusted uncompressed speed: 2.07MiB/s - Actual uncompressed speed: 924.42KiB/s - Actual speed: 195.98KiB/s + IO speed: 12.9MiB/s + Concurrency adjusted uncompressed speed: 630.93KiB/s + Actual uncompressed speed: 267.33KiB/s + Actual speed: 56.68KiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 451B Blocks: 20 (~200.13KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 + Pending / IO / Serde: 0 / 0 / 0 I. Stats 1: - Wall clock time: 544.31ms - Total CPU time: 505.66ms - Serialization time: 188.09ms (37.2%) - Checksum calculation time: 179.49ms (35.5%) - Compression time: 137.05ms (27.1%) - Total IO delay: 98.82ms + Wall clock time: 1.61s + Total CPU time: 1.81s + Serialization time: 655.18ms (36.25%) + Checksum calculation time: 391.67ms (21.67%) + Compression time: 756.85ms (41.88%) + Total IO delay: 188.37ms Input size: 3.91MiB Decompressed size: 18.44MiB (compression = 21.2%) - IO speed: 39.89MiB/s - Concurrency adjusted uncompressed speed: 122.1MiB/s - Actual uncompressed speed: 33.89MiB/s - Actual speed: 7.19MiB/s + IO speed: 20.79MiB/s + Concurrency adjusted uncompressed speed: 37.02MiB/s + Actual uncompressed speed: 11.44MiB/s + Actual speed: 2.43MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 451B Blocks: 20 (~200.13KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 + Pending / IO / Serde: 0 / 0 / 0 I. Stats 2: - Wall clock time: 1.17s - Total CPU time: 1.05s - Serialization time: 394.96ms (37.77%) - Checksum calculation time: 362.58ms (34.68%) - Compression time: 286.15ms (27.37%) - Total IO delay: 187.76ms + Wall clock time: 3.67s + Total CPU time: 3.66s + Serialization time: 1.33s (36.46%) + Checksum calculation time: 750.01ms (20.51%) + Compression time: 1.57s (42.85%) + Total IO delay: 328.64ms Input size: 7.82MiB Decompressed size: 36.87MiB (compression = 21.2%) - IO speed: 41.81MiB/s - Concurrency adjusted uncompressed speed: 119.72MiB/s - Actual uncompressed speed: 31.44MiB/s - Actual speed: 6.66MiB/s + IO speed: 23.83MiB/s + Concurrency adjusted uncompressed speed: 37.02MiB/s + Actual uncompressed speed: 10.05MiB/s + Actual speed: 2.13MiB/s Objects: 18158 Average object size uncompressed: 2.08KiB Average object size compressed: 451B @@ -4850,68 +3697,94 @@ Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 + Pending / IO / Serde: 0 / 0 / 1 + Pending / IO / Serde: 0 / 0 / 1 + Pending / IO / Serde: 0 / 0 / 1 + Pending / IO / Serde: 0 / 0 / 1 + Pending / IO / Serde: 0 / 0 / 1 + Pending / IO / Serde: 0 / 0 / 1 + Pending / IO / Serde: 0 / 0 / 1 + Pending / IO / Serde: 0 / 0 / 1 + Pending / IO / Serde: 0 / 0 / 1 + Pending / IO / Serde: 0 / 0 / 1 + Pending / IO / Serde: 0 / 0 / 1 + Pending / IO / Serde: 0 / 0 / 1 + Pending / IO / Serde: 0 / 0 / 1 + Pending / IO / Serde: 0 / 0 / 1 + Pending / IO / Serde: 0 / 0 / 1 + Pending / IO / Serde: 0 / 0 / 1 + Pending / IO / Serde: 0 / 0 / 1 + Gradle is still running, please be patient... + Pending / IO / Serde: 0 / 0 / 1 + Pending / IO / Serde: 0 / 0 / 1 + Pending / IO / Serde: 0 / 0 / 1 + Pending / IO / Serde: 0 / 0 / 1 + Pending / IO / Serde: 0 / 0 / 1 + Pending / IO / Serde: 0 / 0 / 1 + Pending / IO / Serde: 0 / 0 / 1 + Pending / IO / Serde: 0 / 0 / 0 ================== High compression: true Concurrency: 1 File size: 4156299 - Write time: 31.19s + Write time: 1.33m O. Stats: - Wall clock time: 31.19s - Total CPU time: 30.95s - User wait time: 31.13s - Serialization time: 87.86ms (0.28%) - Checksum calculation time: 73.81ms (0.24%) - Compression time: 30.78s (99.45%) - Total IO delay: 107.41ms - Concurrency overhead: 24.05ms + Wall clock time: 1.33m + Total CPU time: 1.31m + User wait time: 1.32m + Serialization time: 963.73ms (1.22%) + Checksum calculation time: 323.03ms (0.41%) + Compression time: 1.29m (98.28%) + Total IO delay: 279.66ms + Concurrency overhead: 154.1ms Uncompressed size: 18.44MiB (~2.08KiB per object) Output size: 3.96MiB (~457B per object; compression = 21.5%) - IO speed: 37.04MiB/s - Concurrency adjusted uncompressed speed: 607.52KiB/s - Actual uncompressed speed: 605.34KiB/s - Actual speed: 130.14KiB/s + IO speed: 14.21MiB/s + Concurrency adjusted uncompressed speed: 238.39KiB/s + Actual uncompressed speed: 237.38KiB/s + Actual speed: 51.03KiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 457B Blocks: 62 (~65.47KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Checksum ok! - Pending / IO / Serde: 1 / 1 / 0 I. Stats 1: - Wall clock time: 483.42ms - Total CPU time: 212.04ms - Serialization time: 96.17ms (45.36%) - Checksum calculation time: 48.85ms (23.04%) - Compression time: 59.81ms (28.21%) - Total IO delay: 404.54ms + Wall clock time: 1.17s + Total CPU time: 1.28s + Serialization time: 507.33ms (39.79%) + Checksum calculation time: 292.51ms (22.94%) + Compression time: 462.15ms (36.24%) + Total IO delay: 205.3ms Input size: 3.96MiB Decompressed size: 18.44MiB (compression = 21.5%) - IO speed: 9.81MiB/s - Concurrency adjusted uncompressed speed: 29.93MiB/s - Actual uncompressed speed: 38.17MiB/s - Actual speed: 8.21MiB/s + IO speed: 19.34MiB/s + Concurrency adjusted uncompressed speed: 12.46MiB/s + Actual uncompressed speed: 15.83MiB/s + Actual speed: 3.4MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 457B Blocks: 62 (~65.47KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 + Pending / IO / Serde: 0 / 0 / 0 I. Stats 2: - Wall clock time: 1.06s - Total CPU time: 442.42ms - Serialization time: 188.08ms (42.51%) - Checksum calculation time: 120.29ms (27.19%) - Compression time: 119.63ms (27.04%) - Total IO delay: 795.21ms + Wall clock time: 2.49s + Total CPU time: 2.73s + Serialization time: 1.11s (40.65%) + Checksum calculation time: 650.98ms (23.87%) + Compression time: 931.94ms (34.18%) + Total IO delay: 434.85ms Input size: 7.93MiB Decompressed size: 36.87MiB (compression = 21.5%) - IO speed: 9.97MiB/s - Concurrency adjusted uncompressed speed: 29.81MiB/s - Actual uncompressed speed: 34.82MiB/s - Actual speed: 7.49MiB/s + IO speed: 18.27MiB/s + Concurrency adjusted uncompressed speed: 11.67MiB/s + Actual uncompressed speed: 14.79MiB/s + Actual speed: 3.18MiB/s Objects: 18158 Average object size uncompressed: 2.08KiB Average object size compressed: 457B @@ -4933,67 +3806,102 @@ Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 + Pending / IO / Serde: 0 / 0 / 1 + Pending / IO / Serde: 0 / 0 / 1 + Pending / IO / Serde: 0 / 0 / 1 + Pending / IO / Serde: 0 / 1 / 0 + Pending / IO / Serde: 0 / 0 / 1 + Pending / IO / Serde: 0 / 0 / 1 + Pending / IO / Serde: 0 / 0 / 1 + Pending / IO / Serde: 0 / 0 / 1 + Pending / IO / Serde: 0 / 0 / 1 + Pending / IO / Serde: 0 / 0 / 1 + Pending / IO / Serde: 0 / 0 / 1 + Pending / IO / Serde: 0 / 0 / 1 + Pending / IO / Serde: 0 / 0 / 1 + Pending / IO / Serde: 0 / 0 / 1 + Pending / IO / Serde: 0 / 0 / 1 + Pending / IO / Serde: 0 / 0 / 1 + Pending / IO / Serde: 0 / 0 / 1 + Pending / IO / Serde: 0 / 0 / 1 + Pending / IO / Serde: 0 / 0 / 1 + Pending / IO / Serde: 0 / 0 / 1 + Pending / IO / Serde: 0 / 1 / 0 + Pending / IO / Serde: 0 / 0 / 1 + Pending / IO / Serde: 0 / 0 / 1 + Pending / IO / Serde: 0 / 0 / 1 + Pending / IO / Serde: 0 / 0 / 1 + Pending / IO / Serde: 0 / 0 / 1 + Pending / IO / Serde: 0 / 0 / 1 + Pending / IO / Serde: 0 / 0 / 1 + Pending / IO / Serde: 0 / 0 / 1 + Pending / IO / Serde: 0 / 0 / 1 + Pending / IO / Serde: 0 / 0 / 1 + Pending / IO / Serde: 0 / 0 / 1 + Pending / IO / Serde: 0 / 0 / 1 ================== High compression: true Concurrency: 1 File size: 4098671 - Write time: 31.92s + Write time: 1.64m O. Stats: - Wall clock time: 31.92s - Total CPU time: 31.71s - User wait time: 31.87s - Serialization time: 208.26ms (0.66%) - Checksum calculation time: 169.38ms (0.53%) - Compression time: 31.33s (98.8%) - Total IO delay: 92.25ms - Concurrency overhead: 12ms + Wall clock time: 1.64m + Total CPU time: 1.63m + User wait time: 1.63m + Serialization time: 1.43s (1.46%) + Checksum calculation time: 380.52ms (0.39%) + Compression time: 1.59m (97.58%) + Total IO delay: 290.11ms + Concurrency overhead: 44.51ms Uncompressed size: 18.44MiB (~2.08KiB per object) Output size: 3.91MiB (~451B per object; compression = 21.2%) - IO speed: 42.49MiB/s - Concurrency adjusted uncompressed speed: 593.47KiB/s - Actual uncompressed speed: 591.42KiB/s - Actual speed: 125.39KiB/s + IO speed: 13.48MiB/s + Concurrency adjusted uncompressed speed: 192.94KiB/s + Actual uncompressed speed: 191.41KiB/s + Actual speed: 40.58KiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 451B Blocks: 20 (~200.13KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Checksum ok! + Pending / IO / Serde: 0 / 0 / 0 I. Stats 1: - Wall clock time: 501.39ms - Total CPU time: 553.66ms - Serialization time: 199.42ms (36.02%) - Checksum calculation time: 201.53ms (36.4%) - Compression time: 151.75ms (27.41%) - Total IO delay: 72.68ms + Wall clock time: 2.36s + Total CPU time: 2.57s + Serialization time: 913.26ms (35.49%) + Checksum calculation time: 584.78ms (22.73%) + Compression time: 1.07s (41.68%) + Total IO delay: 207.97ms Input size: 3.91MiB Decompressed size: 18.44MiB (compression = 21.2%) - IO speed: 54.29MiB/s - Concurrency adjusted uncompressed speed: 29.45MiB/s - Actual uncompressed speed: 36.8MiB/s - Actual speed: 7.8MiB/s + IO speed: 18.88MiB/s + Concurrency adjusted uncompressed speed: 6.63MiB/s + Actual uncompressed speed: 7.82MiB/s + Actual speed: 1.66MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 451B Blocks: 20 (~200.13KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 + Pending / IO / Serde: 0 / 0 / 0 I. Stats 2: - Wall clock time: 1.08s - Total CPU time: 991.39ms - Serialization time: 363.96ms (36.71%) - Checksum calculation time: 380.06ms (38.34%) - Compression time: 245.51ms (24.76%) - Total IO delay: 177.09ms + Wall clock time: 4.5s + Total CPU time: 4.76s + Serialization time: 1.66s (34.95%) + Checksum calculation time: 1.06s (22.36%) + Compression time: 2.01s (42.23%) + Total IO delay: 330.7ms Input size: 7.82MiB Decompressed size: 36.87MiB (compression = 21.2%) - IO speed: 44.17MiB/s - Concurrency adjusted uncompressed speed: 31.57MiB/s - Actual uncompressed speed: 34.24MiB/s - Actual speed: 7.26MiB/s + IO speed: 23.69MiB/s + Concurrency adjusted uncompressed speed: 7.25MiB/s + Actual uncompressed speed: 8.2MiB/s + Actual speed: 1.74MiB/s Objects: 18158 Average object size uncompressed: 2.08KiB Average object size compressed: 451B @@ -5002,95 +3910,1426 @@ com.milaboratory.primitivio.blocks.PrimitivOBlocksTest > bigBlocks STANDARD_OUT Pending / IO / Serde / Objs: 0 / 0 / 0 / 0 + Pending / IO / Serde / Objs: 0 / 0 / 0 / 0 Pending / IO / Serde / Objs: 0 / 0 / 1 / 0 - Pending / IO / Serde / Objs: 0 / 1 / 1 / 1000 - Pending / IO / Serde / Objs: 0 / 1 / 1 / 2000 - Pending / IO / Serde / Objs: 0 / 1 / 1 / 3000 - Pending / IO / Serde / Objs: 0 / 1 / 1 / 4000 - Pending / IO / Serde / Objs: 0 / 1 / 1 / 5000 - Pending / IO / Serde / Objs: 0 / 1 / 1 / 6000 - Pending / IO / Serde / Objs: 0 / 1 / 0 / 7000 - Pending / IO / Serde / Objs: 0 / 0 / 1 / 7000 - Pending / IO / Serde / Objs: 0 / 0 / 1 / 8000 - Pending / IO / Serde / Objs: 0 / 0 / 1 / 9000 - Pending / IO / Serde / Objs: 0 / 1 / 1 / 10000 - Pending / IO / Serde / Objs: 0 / 1 / 1 / 11000 - Pending / IO / Serde / Objs: 0 / 1 / 1 / 12000 - Pending / IO / Serde / Objs: 0 / 1 / 1 / 13000 - Pending / IO / Serde / Objs: 0 / 1 / 1 / 14000 - Pending / IO / Serde / Objs: 0 / 1 / 1 / 15000 - Pending / IO / Serde / Objs: 0 / 1 / 1 / 16000 - Pending / IO / Serde / Objs: 1 / 1 / 1 / 17000 - Pending / IO / Serde / Objs: 0 / 1 / 1 / 18000 - Pending / IO / Serde / Objs: 0 / 1 / 0 / 19000 + Pending / IO / Serde / Objs: 0 / 0 / 1 / 0 + Pending / IO / Serde / Objs: 0 / 0 / 1 / 0 + Pending / IO / Serde / Objs: 0 / 0 / 2 / 0 + Pending / IO / Serde / Objs: 0 / 0 / 2 / 0 + Pending / IO / Serde / Objs: 0 / 0 / 2 / 0 + Pending / IO / Serde / Objs: 0 / 0 / 3 / 0 + Pending / IO / Serde / Objs: 0 / 0 / 3 / 0 + Pending / IO / Serde / Objs: 0 / 0 / 3 / 0 + Pending / IO / Serde / Objs: 0 / 0 / 3 / 0 + Pending / IO / Serde / Objs: 0 / 0 / 3 / 0 + Pending / IO / Serde / Objs: 0 / 0 / 3 / 0 + Pending / IO / Serde / Objs: 0 / 0 / 4 / 0 + Pending / IO / Serde / Objs: 0 / 0 / 4 / 0 + Pending / IO / Serde / Objs: 0 / 0 / 3 / 1000 + Pending / IO / Serde / Objs: 0 / 1 / 3 / 1000 + Pending / IO / Serde / Objs: 0 / 1 / 3 / 1000 + Pending / IO / Serde / Objs: 0 / 1 / 3 / 1000 + Pending / IO / Serde / Objs: 0 / 1 / 3 / 1000 + Pending / IO / Serde / Objs: 1 / 1 / 2 / 2000 + Pending / IO / Serde / Objs: 0 / 1 / 3 / 2000 + Pending / IO / Serde / Objs: 0 / 1 / 3 / 2000 + Pending / IO / Serde / Objs: 0 / 1 / 4 / 2000 + Pending / IO / Serde / Objs: 0 / 1 / 4 / 2000 + Pending / IO / Serde / Objs: 0 / 1 / 4 / 2000 + Pending / IO / Serde / Objs: 0 / 0 / 4 / 2000 + Pending / IO / Serde / Objs: 0 / 0 / 4 / 2000 + Pending / IO / Serde / Objs: 1 / 1 / 3 / 4000 + Pending / IO / Serde / Objs: 1 / 1 / 3 / 4000 + Pending / IO / Serde / Objs: 1 / 1 / 3 / 4000 + Pending / IO / Serde / Objs: 1 / 1 / 3 / 4000 + Pending / IO / Serde / Objs: 2 / 0 / 3 / 5000 + Pending / IO / Serde / Objs: 2 / 0 / 3 / 5000 + Pending / IO / Serde / Objs: 2 / 0 / 3 / 5000 + Pending / IO / Serde / Objs: 2 / 0 / 3 / 5000 + Pending / IO / Serde / Objs: 2 / 1 / 2 / 6000 + Pending / IO / Serde / Objs: 3 / 1 / 2 / 7000 + Pending / IO / Serde / Objs: 3 / 1 / 2 / 7000 + Pending / IO / Serde / Objs: 3 / 1 / 2 / 7000 + Pending / IO / Serde / Objs: 4 / 1 / 0 / 9000 + Pending / IO / Serde / Objs: 4 / 1 / 1 / 9000 + Pending / IO / Serde / Objs: 4 / 1 / 1 / 9000 + Pending / IO / Serde / Objs: 4 / 1 / 2 / 9000 + Pending / IO / Serde / Objs: 3 / 1 / 2 / 9000 + Pending / IO / Serde / Objs: 3 / 1 / 3 / 9000 + Pending / IO / Serde / Objs: 3 / 1 / 3 / 9000 + Pending / IO / Serde / Objs: 3 / 1 / 2 / 10000 + Pending / IO / Serde / Objs: 3 / 1 / 2 / 10000 + Pending / IO / Serde / Objs: 3 / 1 / 2 / 10000 + Pending / IO / Serde / Objs: 4 / 1 / 2 / 11000 + Pending / IO / Serde / Objs: 3 / 1 / 2 / 11000 + Pending / IO / Serde / Objs: 4 / 1 / 2 / 12000 + Pending / IO / Serde / Objs: 4 / 1 / 2 / 12000 + Pending / IO / Serde / Objs: 4 / 1 / 2 / 12000 + Pending / IO / Serde / Objs: 4 / 1 / 3 / 12000 + Pending / IO / Serde / Objs: 4 / 1 / 2 / 13000 + Pending / IO / Serde / Objs: 5 / 1 / 1 / 14000 + Pending / IO / Serde / Objs: 5 / 1 / 2 / 14000 + Pending / IO / Serde / Objs: 4 / 1 / 2 / 14000 + Pending / IO / Serde / Objs: 5 / 1 / 1 / 15000 + Pending / IO / Serde / Objs: 5 / 1 / 2 / 15000 + Pending / IO / Serde / Objs: 5 / 1 / 1 / 16000 + Pending / IO / Serde / Objs: 5 / 1 / 1 / 16000 + Pending / IO / Serde / Objs: 5 / 1 / 2 / 16000 + Pending / IO / Serde / Objs: 4 / 1 / 2 / 16000 + Pending / IO / Serde / Objs: 4 / 1 / 2 / 16000 + Pending / IO / Serde / Objs: 5 / 1 / 1 / 17000 + Pending / IO / Serde / Objs: 5 / 1 / 2 / 17000 + Pending / IO / Serde / Objs: 4 / 1 / 2 / 17000 + Pending / IO / Serde / Objs: 5 / 1 / 1 / 18000 + Pending / IO / Serde / Objs: 5 / 1 / 2 / 18000 + Pending / IO / Serde / Objs: 5 / 1 / 2 / 18000 + Pending / IO / Serde / Objs: 5 / 1 / 2 / 18000 + Pending / IO / Serde / Objs: 7 / 1 / 0 / 20000 + Pending / IO / Serde / Objs: 6 / 1 / 0 / 20000 + Pending / IO / Serde / Objs: 6 / 1 / 0 / 20000 + Pending / IO / Serde / Objs: 5 / 1 / 0 / 20000 + Pending / IO / Serde / Objs: 5 / 1 / 0 / 20000 + Pending / IO / Serde / Objs: 5 / 1 / 0 / 20000 + Pending / IO / Serde / Objs: 4 / 1 / 0 / 20000 + Pending / IO / Serde / Objs: 4 / 1 / 0 / 20000 + Pending / IO / Serde / Objs: 3 / 1 / 0 / 20000 + Pending / IO / Serde / Objs: 3 / 1 / 0 / 20000 + Pending / IO / Serde / Objs: 2 / 1 / 0 / 20000 + Pending / IO / Serde / Objs: 2 / 1 / 0 / 20000 + Pending / IO / Serde / Objs: 1 / 1 / 0 / 20000 + Pending / IO / Serde / Objs: 1 / 1 / 0 / 20000 Pending / IO / Serde / Objs: 1 / 1 / 0 / 20000 O. Stats: - Wall clock time: 46.95s - Total CPU time: 40.46s - User wait time: 234.66us - Serialization time: 7.61s (18.81%) - Checksum calculation time: 21.39s (52.86%) - Compression time: 4.99s (12.34%) - Total IO delay: 28.94s - Concurrency overhead: 38.31ms + Wall clock time: 3.34m + Total CPU time: 6.51m + User wait time: 3.38s + Serialization time: 2.68m (41.21%) + Checksum calculation time: 1.23m (18.82%) + Compression time: 1.28m (19.63%) + Total IO delay: 2.52m + Concurrency overhead: 83.2ms Uncompressed size: 1.86GiB (~97.66KiB per object) Output size: 1.86GiB (~97.66KiB per object; compression = 100%) - IO speed: 65.92MiB/s - Concurrency adjusted uncompressed speed: 218.92MiB/s - Actual uncompressed speed: 40.63MiB/s - Actual speed: 40.63MiB/s + IO speed: 12.64MiB/s + Concurrency adjusted uncompressed speed: 28.13MiB/s + Actual uncompressed speed: 9.52MiB/s + Actual speed: 9.52MiB/s Objects: 20000 Average object size uncompressed: 97.66KiB Average object size compressed: 97.66KiB Blocks: 20 (~95.37MiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 + +com.milaboratory.util.IntCombinationsTest > test1 STANDARD_OUT + [0, 1] + [0, 2] + [1, 2] + +com.milaboratory.util.NSequenceWithQualityPrintHelperTest > test1 SKIPPED + +com.milaboratory.util.RemoveActionTest > test1 STANDARD_OUT + /tmp/milib_4d4d3a784c5d582ceb1b218ead5ed0fcfc7963b113534665982036306643 + +com.milaboratory.util.RemoveActionTest > test2 STANDARD_OUT + /tmp/milib_d0a27808f56efe3a0932823582064c9e793f31d913202385358666746610.tmp + +com.milaboratory.util.JsonOverriderTest > test1 STANDARD_OUT + WARNING: unnecessary override -Ob= with the same value. + +com.milaboratory.util.VersionInfoTest > test3 SKIPPED + +com.milaboratory.util.sorting.SortingUtilTest > test1 STANDARD_OUT + Collation: 1.48s + Sorting: 2.91s + 1 + 217 + 41575 + 99492 + 99996 + +com.milaboratory.util.sorting.HashSorterTest > testSingleton STANDARD_OUT + /tmp/milib_7d0dc097c69ad7813703884c611ff964a6b5b5918170491752606521517 + timeInCollate: 1.1m + timeInCollatorInit: 43.37s + timeAwaitingO: 19.33ms + timeAwaitingI: 26.64s + timeInFinalSorting1: 0ns + timeInFinalSorting2: 127.03ms + timeInFinalSorting3: 333.27ms + /12S (5|27|32): objs=50000 size=3.06MiB + +com.milaboratory.util.sorting.HashSorterTest > test1 STANDARD_OUT + /tmp/milib_9156ef3a9878176aa8a71c85765efc348cca0a387741342684740479724 + Gradle is still running, please be patient... + timeInCollate: 4.13m + timeInCollatorInit: 31.35s + timeAwaitingO: 19.03s + timeAwaitingI: 1.16m + timeInFinalSorting1: 26.53s + timeInFinalSorting2: 19.44s + timeInFinalSorting3: 10.4s + /0N (5|27|32): objs=156806 size=9.1MiB + /1N (5|27|32): objs=154771 size=8.66MiB + /2N (5|27|32): objs=155155 size=8.83MiB + /3N (5|27|32): objs=164341 size=9.58MiB + /4N (5|27|32): objs=162751 size=9.49MiB + /5N (5|27|32): objs=152538 size=8.43MiB + /6N (5|27|32): objs=152899 size=8.68MiB + /7N (5|27|32): objs=158319 size=8.94MiB + /8N (5|27|32): objs=148320 size=8.3MiB + /9N (5|27|32): objs=158610 size=9.2MiB + /10N (5|27|32): objs=154443 size=8.51MiB + /11N (5|27|32): objs=159396 size=8.91MiB + /12N (5|27|32): objs=157208 size=9.02MiB + /13N (5|27|32): objs=162588 size=9.33MiB + /14N (5|27|32): objs=157262 size=8.94MiB + /15N (5|27|32): objs=154456 size=8.42MiB + /16N (5|27|32): objs=156726 size=8.85MiB + /17N (5|27|32): objs=156721 size=8.87MiB + /18N (5|27|32): objs=155697 size=8.85MiB + /19N (5|27|32): objs=158234 size=8.8MiB + /20N (5|27|32): objs=147752 size=8.12MiB + /21N (5|27|32): objs=149218 size=8.31MiB + /22N (5|27|32): objs=142336 size=7.56MiB + /23N (5|27|32): objs=155518 size=8.61MiB + /24N (5|27|32): objs=148777 size=8.25MiB + /25N (5|27|32): objs=155156 size=8.81MiB + /26N (5|27|32): objs=158594 size=9.2MiB + /27N (5|27|32): objs=162778 size=9.25MiB + /28N (5|27|32): objs=160593 size=9.28MiB + /29N (5|27|32): objs=161072 size=9.12MiB + /30N (5|27|32): objs=164536 size=9.5MiB + /31N (5|27|32): objs=156429 size=9.15MiB + /0/0N (2|25|36): objs=43417 size=1.04MiB + /0/1N (2|25|36): objs=36605 size=881.99KiB + /0/2N (2|25|36): objs=41055 size=902.11KiB + /0/3S (2|25|36): objs=158 size=178B + /0/4N (2|25|36): objs=2134 size=9.91KiB + /0/5N (2|25|36): objs=885 size=3.58KiB + /0/6S (2|25|36): objs=128 size=217B + /0/7N (2|25|36): objs=3672 size=16.83KiB + /0/8S (2|25|36): objs=147 size=119B + /0/9N (2|25|36): objs=2246 size=9.84KiB + /0/10S (2|25|36): objs=151 size=116B + /0/11N (2|25|36): objs=3799 size=16.54KiB + /0/12S (2|25|36): objs=138 size=326B + /0/13N (2|25|36): objs=1386 size=5.75KiB + /0/14S (2|25|36): objs=169 size=274B + /0/15N (2|25|36): objs=2504 size=10.87KiB + /0/16S (2|25|36): objs=154 size=306B + /0/18S (2|25|36): objs=147 size=298B + /0/19N (2|25|36): objs=2805 size=12.66KiB + /0/20S (2|25|36): objs=140 size=172B + /0/21N (2|25|36): objs=3494 size=14.76KiB + /0/22S (2|25|36): objs=151 size=104B + /0/23N (2|25|36): objs=619 size=2.15KiB + /0/24S (2|25|36): objs=153 size=276B + /0/25N (2|25|36): objs=4744 size=21.74KiB + /0/26S (2|25|36): objs=143 size=135B + /0/27N (2|25|36): objs=1385 size=5.8KiB + /0/28S (2|25|36): objs=132 size=299B + /0/29N (2|25|36): objs=987 size=3.78KiB + /0/30S (2|25|36): objs=155 size=225B + /0/31N (2|25|36): objs=2312 size=9.57KiB + /0/32S (2|25|36): objs=109 size=168B + /0/33N (2|25|36): objs=419 size=1.59KiB + /0/34S (2|25|36): objs=163 size=332B + /1/0N (2|25|36): objs=42061 size=967.22KiB + /1/1N (2|25|36): objs=35647 size=635.83KiB + /1/2N (2|25|36): objs=37171 size=811.3KiB + /1/3S (2|25|36): objs=149 size=292B + /1/4N (2|25|36): objs=792 size=3.07KiB + /1/5N (2|25|36): objs=11950 size=73.02KiB + /1/6S (2|25|36): objs=156 size=249B + /1/7N (2|25|36): objs=1572 size=6.48KiB + /1/8S (2|25|36): objs=136 size=196B + /1/9N (2|25|36): objs=1003 size=3.73KiB + /1/10S (2|25|36): objs=167 size=129B + /1/11N (2|25|36): objs=443 size=1.32KiB + /1/12S (2|25|36): objs=162 size=259B + /1/13N (2|25|36): objs=3439 size=17.09KiB + /1/14S (2|25|36): objs=151 size=194B + /1/15N (2|25|36): objs=708 size=2.72KiB + /1/16S (2|25|36): objs=159 size=280B + /1/17N (2|25|36): objs=6701 size=33.08KiB + /1/18S (2|25|36): objs=152 size=298B + /1/19N (2|25|36): objs=309 size=869B + /1/20S (2|25|36): objs=170 size=106B + /1/21N (2|25|36): objs=1803 size=7.33KiB + /1/22S (2|25|36): objs=164 size=150B + /1/23N (2|25|36): objs=920 size=3.74KiB + /1/24S (2|25|36): objs=153 size=215B + /1/25N (2|25|36): objs=1109 size=4.42KiB + /1/26S (2|25|36): objs=145 size=213B + /1/27N (2|25|36): objs=762 size=2.96KiB + /1/28S (2|25|36): objs=170 size=145B + /1/30S (2|25|36): objs=130 size=172B + /1/31N (2|25|36): objs=274 size=807B + /1/32S (2|25|36): objs=151 size=95B + /1/33N (2|25|36): objs=566 size=1.96KiB + /1/34S (2|25|36): objs=129 size=327B + /1/35N (2|25|36): objs=5097 size=24.07KiB + /2/0N (2|25|36): objs=39973 size=917.01KiB + /2/1N (2|25|36): objs=38392 size=837.36KiB + /2/2N (2|25|36): objs=34839 size=703.6KiB + /2/3S (2|25|36): objs=143 size=167B + /2/4N (2|25|36): objs=450 size=1.49KiB + /2/5S (2|25|36): objs=124 size=255B + /2/6N (2|25|36): objs=881 size=3.41KiB + /2/7S (2|25|36): objs=152 size=315B + /2/9S (2|25|36): objs=165 size=286B + /2/10N (2|25|36): objs=2573 size=11.36KiB + /2/11N (2|25|36): objs=7695 size=37.06KiB + /2/12S (2|25|36): objs=150 size=131B + /2/13N (2|25|36): objs=2181 size=9.18KiB + /2/14S (2|25|36): objs=141 size=148B + /2/15N (2|25|36): objs=2330 size=10.2KiB + /2/16S (2|25|36): objs=175 size=107B + /2/17N (2|25|36): objs=1920 size=7.95KiB + /2/18S (2|25|36): objs=139 size=124B + /2/19N (2|25|36): objs=1360 size=5.84KiB + /2/20S (2|25|36): objs=161 size=271B + /2/21N (2|25|36): objs=4829 size=21.72KiB + /2/22S (2|25|36): objs=170 size=210B + /2/23N (2|25|36): objs=2585 size=10.8KiB + /2/24S (2|25|36): objs=150 size=202B + /2/25N (2|25|36): objs=2098 size=8.68KiB + /2/26S (2|25|36): objs=153 size=214B + /2/27N (2|25|36): objs=1113 size=4.62KiB + /2/28S (2|25|36): objs=131 size=276B + /2/29N (2|25|36): objs=5615 size=25.39KiB + /2/30S (2|25|36): objs=139 size=326B + /2/32S (2|25|36): objs=159 size=202B + /2/33N (2|25|36): objs=3775 size=16.81KiB + /2/34S (2|25|36): objs=151 size=239B + /2/35S (2|25|36): objs=143 size=219B + /3/0N (2|25|36): objs=40357 size=944.89KiB + /3/1N (2|25|36): objs=6119 size=30.8KiB + /3/2S (2|25|36): objs=161 size=109B + /3/3N (2|25|36): objs=32102 size=609.45KiB + /3/4N (2|25|36): objs=39847 size=844.28KiB + /3/5N (2|25|36): objs=3353 size=15.25KiB + /3/6S (2|25|36): objs=157 size=182B + /3/7N (2|25|36): objs=10462 size=54.32KiB + /3/8S (2|25|36): objs=173 size=307B + /3/9N (2|25|36): objs=1700 size=7.2KiB + /3/10S (2|25|36): objs=149 size=101B + /3/11N (2|25|36): objs=413 size=1.46KiB + /3/12S (2|25|36): objs=168 size=271B + /3/13N (2|25|36): objs=1587 size=6.74KiB + /3/14S (2|25|36): objs=142 size=222B + /3/15N (2|25|36): objs=4990 size=22.99KiB + /3/16S (2|25|36): objs=158 size=326B + /3/18S (2|25|36): objs=151 size=118B + /3/19N (2|25|36): objs=4282 size=19.4KiB + /3/20S (2|25|36): objs=148 size=249B + /3/21N (2|25|36): objs=1811 size=7.53KiB + /3/22S (2|25|36): objs=163 size=152B + /3/23N (2|25|36): objs=2009 size=8.42KiB + /3/24S (2|25|36): objs=150 size=209B + /3/26S (2|25|36): objs=172 size=201B + /3/27N (2|25|36): objs=2186 size=9.56KiB + /3/28S (2|25|36): objs=144 size=94B + /3/29N (2|25|36): objs=1763 size=7.29KiB + /3/30S (2|25|36): objs=150 size=167B + /3/31N (2|25|36): objs=2192 size=9.61KiB + /3/32S (2|25|36): objs=140 size=92B + /3/33N (2|25|36): objs=1696 size=7.44KiB + /3/34S (2|25|36): objs=144 size=313B + /3/35N (2|25|36): objs=5002 size=22.92KiB + /4/0N (2|25|36): objs=37867 size=852.38KiB + /4/1N (2|25|36): objs=42453 size=1.07MiB + /4/2N (2|25|36): objs=40242 size=1.01MiB + /4/3N (2|25|36): objs=6397 size=30.89KiB + /4/4S (2|25|36): objs=162 size=185B + /4/5N (2|25|36): objs=451 size=1.6KiB + /4/6S (2|25|36): objs=165 size=126B + /4/7N (2|25|36): objs=867 size=3.42KiB + /4/8S (2|25|36): objs=149 size=140B + /4/9N (2|25|36): objs=1549 size=6.56KiB + /4/10S (2|25|36): objs=174 size=245B + /4/11N (2|25|36): objs=621 size=2.05KiB + /4/12S (2|25|36): objs=155 size=179B + /4/13N (2|25|36): objs=571 size=2.12KiB + /4/14S (2|25|36): objs=155 size=156B + /4/15N (2|25|36): objs=631 size=2.21KiB + /4/16S (2|25|36): objs=156 size=293B + /4/17N (2|25|36): objs=1070 size=4.37KiB + /4/18S (2|25|36): objs=162 size=119B + /4/20S (2|25|36): objs=145 size=245B + /4/21S (2|25|36): objs=150 size=245B + /4/22S (2|25|36): objs=150 size=314B + /4/23N (2|25|36): objs=9534 size=43.8KiB + /4/24S (2|25|36): objs=168 size=150B + /4/25N (2|25|36): objs=1038 size=4.15KiB + /4/26S (2|25|36): objs=156 size=160B + /4/27N (2|25|36): objs=308 size=951B + /4/28S (2|25|36): objs=148 size=146B + /4/29N (2|25|36): objs=2762 size=12.22KiB + /4/30S (2|25|36): objs=183 size=265B + /4/31N (2|25|36): objs=1180 size=4.93KiB + /4/32S (2|25|36): objs=138 size=326B + /4/33N (2|25|36): objs=10502 size=53.92KiB + /4/34S (2|25|36): objs=170 size=254B + /4/35N (2|25|36): objs=2022 size=9.87KiB + /5/0N (2|25|36): objs=35697 size=718.77KiB + /5/1N (2|25|36): objs=38198 size=757.29KiB + /5/2N (2|25|36): objs=18321 size=170.11KiB + /5/3S (2|25|36): objs=167 size=332B + /5/4N (2|25|36): objs=16759 size=125.4KiB + /5/5N (2|25|36): objs=3038 size=13.11KiB + /5/6S (2|25|36): objs=162 size=293B + /5/7N (2|25|36): objs=1592 size=6.45KiB + /5/8S (2|25|36): objs=131 size=97B + /5/9N (2|25|36): objs=478 size=1.71KiB + /5/10S (2|25|36): objs=156 size=167B + /5/11N (2|25|36): objs=4865 size=20.69KiB + /5/12S (2|25|36): objs=157 size=301B + /5/13N (2|25|36): objs=598 size=2.07KiB + /5/14S (2|25|36): objs=146 size=131B + /5/15N (2|25|36): objs=1736 size=7.13KiB + /5/16S (2|25|36): objs=155 size=125B + /5/17N (2|25|36): objs=773 size=3.2KiB + /5/18S (2|25|36): objs=164 size=91B + /5/19N (2|25|36): objs=6358 size=33.95KiB + /5/20S (2|25|36): objs=152 size=247B + /5/21N (2|25|36): objs=1220 size=4.96KiB + /5/22S (2|25|36): objs=144 size=199B + /5/23N (2|25|36): objs=1859 size=7.64KiB + /5/24S (2|25|36): objs=149 size=198B + /5/25N (2|25|36): objs=2634 size=12.27KiB + /5/26S (2|25|36): objs=161 size=233B + /5/27N (2|25|36): objs=638 size=2.13KiB + /5/28S (2|25|36): objs=143 size=165B + /5/29N (2|25|36): objs=9544 size=55.04KiB + /5/30S (2|25|36): objs=145 size=159B + /5/31N (2|25|36): objs=1006 size=3.75KiB + /5/32S (2|25|36): objs=149 size=300B + /5/33N (2|25|36): objs=4789 size=23.09KiB + /5/34S (2|25|36): objs=154 size=244B + /6/0N (2|25|36): objs=18720 size=159.85KiB + /6/1S (2|25|36): objs=145 size=185B + /6/2N (2|25|36): objs=21231 size=219.34KiB + /6/3N (2|25|36): objs=40719 size=949.46KiB + /6/4N (2|25|36): objs=39725 size=1.01MiB + /6/5N (2|25|36): objs=2097 size=8.9KiB + /6/6S (2|25|36): objs=147 size=172B + /6/7S (2|25|36): objs=156 size=299B + /6/8S (2|25|36): objs=143 size=142B + /6/9N (2|25|36): objs=5725 size=27.17KiB + /6/10S (2|25|36): objs=143 size=169B + /6/11N (2|25|36): objs=2439 size=10.16KiB + /6/12S (2|25|36): objs=127 size=141B + /6/13N (2|25|36): objs=1822 size=7.42KiB + /6/14S (2|25|36): objs=153 size=309B + /6/15N (2|25|36): objs=1991 size=8.38KiB + /6/16S (2|25|36): objs=167 size=299B + /6/17N (2|25|36): objs=5338 size=24.92KiB + /6/18S (2|25|36): objs=159 size=193B + /6/19N (2|25|36): objs=303 size=869B + /6/20S (2|25|36): objs=154 size=148B + /6/21N (2|25|36): objs=862 size=3.39KiB + /6/22S (2|25|36): objs=154 size=99B + /6/23N (2|25|36): objs=1331 size=5.57KiB + /6/24S (2|25|36): objs=164 size=207B + /6/25N (2|25|36): objs=1974 size=8.29KiB + /6/26S (2|25|36): objs=152 size=336B + /6/27N (2|25|36): objs=314 size=998B + /6/28S (2|25|36): objs=158 size=146B + /6/29N (2|25|36): objs=1020 size=3.95KiB + /6/30S (2|25|36): objs=160 size=239B + /6/31N (2|25|36): objs=3359 size=15.74KiB + /6/32S (2|25|36): objs=137 size=317B + /6/33N (2|25|36): objs=456 size=1.49KiB + /6/34S (2|25|36): objs=138 size=309B + /6/35N (2|25|36): objs=916 size=3.55KiB + /7/0N (2|25|36): objs=42204 size=1.08MiB + /7/1N (2|25|36): objs=36875 size=770.35KiB + /7/2N (2|25|36): objs=38386 size=692.24KiB + /7/3N (2|25|36): objs=7585 size=35.25KiB + /7/4S (2|25|36): objs=169 size=114B + /7/5N (2|25|36): objs=1415 size=5.63KiB + /7/6S (2|25|36): objs=156 size=141B + /7/7N (2|25|36): objs=1375 size=5.66KiB + /7/8S (2|25|36): objs=160 size=198B + /7/9N (2|25|36): objs=1950 size=8.29KiB + /7/10S (2|25|36): objs=135 size=307B + /7/11N (2|25|36): objs=4612 size=22.61KiB + /7/12S (2|25|36): objs=156 size=96B + /7/13N (2|25|36): objs=8452 size=40.34KiB + /7/14S (2|25|36): objs=159 size=333B + /7/16S (2|25|36): objs=159 size=106B + /7/18S (2|25|36): objs=147 size=179B + /7/19N (2|25|36): objs=1343 size=5.5KiB + /7/20S (2|25|36): objs=156 size=154B + /7/21N (2|25|36): objs=2775 size=13.47KiB + /7/22S (2|25|36): objs=164 size=271B + /7/23N (2|25|36): objs=4506 size=19.9KiB + /7/24S (2|25|36): objs=185 size=207B + /7/25S (2|25|36): objs=165 size=339B + /7/26S (2|25|36): objs=156 size=214B + /7/27N (2|25|36): objs=1172 size=4.83KiB + /7/28S (2|25|36): objs=152 size=212B + /7/29N (2|25|36): objs=1347 size=5.25KiB + /7/30S (2|25|36): objs=150 size=235B + /7/31N (2|25|36): objs=454 size=1.72KiB + /7/32S (2|25|36): objs=160 size=114B + /7/33N (2|25|36): objs=623 size=2.22KiB + /7/34S (2|25|36): objs=132 size=254B + /7/35N (2|25|36): objs=584 size=2.15KiB + /8/0N (2|25|36): objs=36841 size=728.29KiB + /8/1N (2|25|36): objs=34797 size=632.47KiB + /8/2N (2|25|36): objs=39711 size=835.12KiB + /8/3N (2|25|36): objs=15230 size=108.82KiB + /8/4S (2|25|36): objs=161 size=246B + /8/5N (2|25|36): objs=1707 size=6.98KiB + /8/6S (2|25|36): objs=142 size=225B + /8/8S (2|25|36): objs=163 size=138B + /8/9N (2|25|36): objs=2376 size=10.13KiB + /8/10S (2|25|36): objs=150 size=205B + /8/11N (2|25|36): objs=275 size=886B + /8/12S (2|25|36): objs=152 size=256B + /8/13N (2|25|36): objs=415 size=1.51KiB + /8/14S (2|25|36): objs=127 size=197B + /8/15N (2|25|36): objs=2418 size=10.19KiB + /8/16S (2|25|36): objs=150 size=296B + /8/17N (2|25|36): objs=2716 size=12.61KiB + /8/18S (2|25|36): objs=160 size=270B + /8/19S (2|25|36): objs=148 size=201B + /8/20S (2|25|36): objs=151 size=248B + /8/22S (2|25|36): objs=147 size=225B + /8/23S (2|25|36): objs=164 size=129B + /8/24S (2|25|36): objs=150 size=172B + /8/25N (2|25|36): objs=1689 size=6.84KiB + /8/26S (2|25|36): objs=167 size=276B + /8/28S (2|25|36): objs=147 size=339B + /8/29N (2|25|36): objs=3136 size=13.27KiB + /8/30S (2|25|36): objs=136 size=148B + /8/32S (2|25|36): objs=155 size=314B + /8/33N (2|25|36): objs=4288 size=20.87KiB + /8/34S (2|25|36): objs=151 size=221B + /9/0N (2|25|36): objs=41153 size=1013.84KiB + /9/1N (2|25|36): objs=41583 size=972.55KiB + /9/2N (2|25|36): objs=39405 size=996.66KiB + /9/3N (2|25|36): objs=2091 size=8.88KiB + /9/4S (2|25|36): objs=163 size=105B + /9/5N (2|25|36): objs=1039 size=4.01KiB + /9/6S (2|25|36): objs=145 size=138B + /9/7S (2|25|36): objs=186 size=204B + /9/8S (2|25|36): objs=145 size=123B + /9/9N (2|25|36): objs=3539 size=16.35KiB + /9/10S (2|25|36): objs=151 size=265B + /9/11N (2|25|36): objs=1284 size=5.04KiB + /9/12S (2|25|36): objs=168 size=330B + /9/13N (2|25|36): objs=1323 size=5.22KiB + /9/14S (2|25|36): objs=143 size=186B + /9/15N (2|25|36): objs=3475 size=16.07KiB + /9/16S (2|25|36): objs=178 size=346B + /9/17N (2|25|36): objs=7537 size=33.44KiB + /9/18S (2|25|36): objs=158 size=90B + /9/19N (2|25|36): objs=603 size=2.25KiB + /9/20S (2|25|36): objs=154 size=318B + /9/21N (2|25|36): objs=297 size=769B + /9/22S (2|25|36): objs=147 size=285B + /9/23N (2|25|36): objs=757 size=2.77KiB + /9/24S (2|25|36): objs=135 size=191B + /9/25N (2|25|36): objs=1694 size=6.95KiB + /9/26S (2|25|36): objs=169 size=336B + /9/27N (2|25|36): objs=910 size=3.42KiB + /9/28S (2|25|36): objs=142 size=161B + /9/29N (2|25|36): objs=3810 size=19.44KiB + /9/30S (2|25|36): objs=152 size=137B + /9/31N (2|25|36): objs=751 size=3.15KiB + /9/32S (2|25|36): objs=163 size=333B + /9/33N (2|25|36): objs=3649 size=16.54KiB + /9/34S (2|25|36): objs=137 size=110B + /9/35N (2|25|36): objs=1074 size=4.1KiB + /10/0N (2|25|36): objs=40273 size=864.99KiB + /10/1N (2|25|36): objs=42077 size=1.01MiB + /10/2N (2|25|36): objs=31317 size=528.33KiB + /10/3S (2|25|36): objs=157 size=151B + /10/4S (2|25|36): objs=146 size=198B + /10/5S (2|25|36): objs=128 size=198B + /10/6N (2|25|36): objs=272 size=987B + /10/7S (2|25|36): objs=144 size=289B + /10/8N (2|25|36): objs=5126 size=25.29KiB + /10/9N (2|25|36): objs=1082 size=4.2KiB + /10/10S (2|25|36): objs=150 size=247B + /10/11N (2|25|36): objs=1972 size=8.48KiB + /10/12S (2|25|36): objs=144 size=187B + /10/13N (2|25|36): objs=2573 size=11.21KiB + /10/14S (2|25|36): objs=134 size=265B + /10/15N (2|25|36): objs=4353 size=19.48KiB + /10/16S (2|25|36): objs=145 size=237B + /10/17N (2|25|36): objs=4800 size=20.89KiB + /10/18S (2|25|36): objs=161 size=159B + /10/20S (2|25|36): objs=144 size=131B + /10/21N (2|25|36): objs=2907 size=12.56KiB + /10/22S (2|25|36): objs=142 size=155B + /10/23N (2|25|36): objs=1497 size=5.84KiB + /10/24S (2|25|36): objs=126 size=270B + /10/25N (2|25|36): objs=339 size=1KiB + /10/26S (2|25|36): objs=150 size=138B + /10/27N (2|25|36): objs=1808 size=7.64KiB + /10/28S (2|25|36): objs=163 size=239B + /10/29N (2|25|36): objs=296 size=733B + /10/30S (2|25|36): objs=154 size=195B + /10/31N (2|25|36): objs=5948 size=29.52KiB + /10/32S (2|25|36): objs=152 size=222B + /10/33N (2|25|36): objs=3845 size=17.02KiB + /10/34S (2|25|36): objs=152 size=90B + /10/35N (2|25|36): objs=1466 size=5.9KiB + /11/0N (2|25|36): objs=38519 size=896.42KiB + /11/1N (2|25|36): objs=41684 size=1010.01KiB + /11/2N (2|25|36): objs=40129 size=828.56KiB + /11/3S (2|25|36): objs=151 size=289B + /11/4N (2|25|36): objs=1101 size=4.24KiB + /11/5S (2|25|36): objs=152 size=96B + /11/6S (2|25|36): objs=148 size=311B + /11/7S (2|25|36): objs=154 size=144B + /11/8S (2|25|36): objs=170 size=124B + /11/10S (2|25|36): objs=177 size=320B + /11/11N (2|25|36): objs=646 size=2.19KiB + /11/12S (2|25|36): objs=143 size=112B + /11/13N (2|25|36): objs=1975 size=8.11KiB + /11/14S (2|25|36): objs=134 size=286B + /11/16S (2|25|36): objs=131 size=100B + /11/17S (2|25|36): objs=158 size=211B + /11/18S (2|25|36): objs=157 size=139B + /11/19N (2|25|36): objs=311 size=802B + /11/20S (2|25|36): objs=126 size=244B + /11/21N (2|25|36): objs=4168 size=18.43KiB + /11/22S (2|25|36): objs=159 size=266B + /11/23N (2|25|36): objs=8112 size=38.61KiB + /11/24S (2|25|36): objs=154 size=309B + /11/25N (2|25|36): objs=1046 size=4.05KiB + /11/26S (2|25|36): objs=154 size=330B + /11/27N (2|25|36): objs=4952 size=23.61KiB + /11/28S (2|25|36): objs=145 size=262B + /11/29N (2|25|36): objs=775 size=2.91KiB + /11/30S (2|25|36): objs=145 size=192B + /11/31N (2|25|36): objs=1831 size=7.72KiB + /11/32S (2|25|36): objs=158 size=349B + /11/33N (2|25|36): objs=2044 size=8.92KiB + /11/34S (2|25|36): objs=145 size=126B + /11/35N (2|25|36): objs=9242 size=49.48KiB + /12/0N (2|25|36): objs=41927 size=1021.35KiB + /12/1N (2|25|36): objs=37260 size=750.13KiB + /12/2N (2|25|36): objs=39780 size=969.2KiB + /12/3S (2|25|36): objs=175 size=270B + /12/4N (2|25|36): objs=617 size=2.27KiB + /12/5N (2|25|36): objs=7042 size=32.16KiB + /12/6S (2|25|36): objs=146 size=291B + /12/7N (2|25|36): objs=3937 size=19.36KiB + /12/8S (2|25|36): objs=154 size=312B + /12/9N (2|25|36): objs=2994 size=12.86KiB + /12/10S (2|25|36): objs=146 size=98B + /12/11N (2|25|36): objs=1514 size=6.41KiB + /12/12S (2|25|36): objs=164 size=151B + /12/13N (2|25|36): objs=1997 size=8.04KiB + /12/14S (2|25|36): objs=163 size=328B + /12/15N (2|25|36): objs=928 size=3.58KiB + /12/16S (2|25|36): objs=176 size=222B + /12/17N (2|25|36): objs=305 size=816B + /12/18S (2|25|36): objs=146 size=324B + /12/19N (2|25|36): objs=266 size=818B + /12/20S (2|25|36): objs=152 size=136B + /12/21N (2|25|36): objs=3116 size=13.48KiB + /12/22S (2|25|36): objs=141 size=257B + /12/23N (2|25|36): objs=1083 size=4.26KiB + /12/24S (2|25|36): objs=161 size=246B + /12/25N (2|25|36): objs=3764 size=17.4KiB + /12/26S (2|25|36): objs=155 size=254B + /12/27N (2|25|36): objs=2255 size=10.71KiB + /12/28S (2|25|36): objs=139 size=146B + /12/29N (2|25|36): objs=305 size=928B + /12/30S (2|25|36): objs=148 size=219B + /12/31N (2|25|36): objs=303 size=1KiB + /12/32S (2|25|36): objs=150 size=298B + /12/33N (2|25|36): objs=606 size=2.34KiB + /12/34S (2|25|36): objs=160 size=322B + /12/35N (2|25|36): objs=4733 size=20.99KiB + /13/0N (2|25|36): objs=43645 size=1022.21KiB + /13/1N (2|25|36): objs=40188 size=999.23KiB + /13/2N (2|25|36): objs=39394 size=896.82KiB + /13/3N (2|25|36): objs=5558 size=25.37KiB + /13/4S (2|25|36): objs=152 size=335B + /13/5N (2|25|36): objs=2099 size=8.7KiB + /13/6S (2|25|36): objs=171 size=101B + /13/7N (2|25|36): objs=581 size=2.18KiB + /13/8S (2|25|36): objs=154 size=313B + /13/9N (2|25|36): objs=3203 size=14.69KiB + /13/10S (2|25|36): objs=152 size=173B + /13/11N (2|25|36): objs=1013 size=4.07KiB + /13/12S (2|25|36): objs=135 size=113B + /13/13N (2|25|36): objs=5646 size=27.7KiB + /13/14S (2|25|36): objs=156 size=341B + /13/15N (2|25|36): objs=2627 size=11.01KiB + /13/16S (2|25|36): objs=146 size=276B + /13/17N (2|25|36): objs=4362 size=20.42KiB + /13/18S (2|25|36): objs=156 size=241B + /13/19S (2|25|36): objs=141 size=129B + /13/20S (2|25|36): objs=166 size=189B + /13/21N (2|25|36): objs=2500 size=10.26KiB + /13/22S (2|25|36): objs=178 size=225B + /13/23N (2|25|36): objs=917 size=3.5KiB + /13/24S (2|25|36): objs=170 size=293B + /13/25S (2|25|36): objs=148 size=231B + /13/26S (2|25|36): objs=152 size=254B + /13/27N (2|25|36): objs=902 size=3.41KiB + /13/28S (2|25|36): objs=148 size=250B + /13/29N (2|25|36): objs=615 size=2.31KiB + /13/30S (2|25|36): objs=164 size=200B + /13/32S (2|25|36): objs=199 size=300B + /13/33N (2|25|36): objs=1292 size=5.13KiB + /13/34S (2|25|36): objs=135 size=304B + /13/35N (2|25|36): objs=5223 size=24.67KiB + /14/0N (2|25|36): objs=41030 size=1012.18KiB + /14/1N (2|25|36): objs=37603 size=821.72KiB + /14/2N (2|25|36): objs=37580 size=762.37KiB + /14/3N (2|25|36): objs=793 size=2.87KiB + /14/4S (2|25|36): objs=147 size=219B + /14/5N (2|25|36): objs=3489 size=15.56KiB + /14/6S (2|25|36): objs=177 size=332B + /14/7N (2|25|36): objs=4475 size=19.92KiB + /14/8S (2|25|36): objs=173 size=214B + /14/9N (2|25|36): objs=1825 size=7.33KiB + /14/10S (2|25|36): objs=133 size=308B + /14/11N (2|25|36): objs=3029 size=13.34KiB + /14/12S (2|25|36): objs=150 size=340B + /14/13N (2|25|36): objs=2312 size=9.7KiB + /14/14S (2|25|36): objs=144 size=253B + /14/15N (2|25|36): objs=2061 size=8.83KiB + /14/16S (2|25|36): objs=160 size=139B + /14/17N (2|25|36): objs=2361 size=10.53KiB + /14/18S (2|25|36): objs=171 size=155B + /14/19N (2|25|36): objs=1811 size=7.74KiB + /14/20S (2|25|36): objs=180 size=247B + /14/21N (2|25|36): objs=1325 size=5.27KiB + /14/22S (2|25|36): objs=148 size=266B + /14/23N (2|25|36): objs=312 size=943B + /14/24S (2|25|36): objs=137 size=203B + /14/25N (2|25|36): objs=1662 size=7KiB + /14/26S (2|25|36): objs=149 size=103B + /14/27N (2|25|36): objs=2916 size=13.28KiB + /14/28S (2|25|36): objs=138 size=319B + /14/29N (2|25|36): objs=468 size=1.65KiB + /14/30S (2|25|36): objs=150 size=168B + /14/31N (2|25|36): objs=7871 size=38.87KiB + /14/32S (2|25|36): objs=163 size=346B + /14/33N (2|25|36): objs=460 size=1.63KiB + /14/34S (2|25|36): objs=164 size=212B + /14/35N (2|25|36): objs=1395 size=5.66KiB + /15/0N (2|25|36): objs=40429 size=842.24KiB + /15/1N (2|25|36): objs=38626 size=859.42KiB + /15/2N (2|25|36): objs=35835 size=649.62KiB + /15/3N (2|25|36): objs=920 size=3.46KiB + /15/4S (2|25|36): objs=142 size=306B + /15/5S (2|25|36): objs=178 size=130B + /15/6S (2|25|36): objs=149 size=283B + /15/8S (2|25|36): objs=131 size=104B + /15/9N (2|25|36): objs=761 size=2.98KiB + /15/10S (2|25|36): objs=164 size=242B + /15/11N (2|25|36): objs=2290 size=9.76KiB + /15/12S (2|25|36): objs=143 size=120B + /15/13N (2|25|36): objs=889 size=3.42KiB + /15/14S (2|25|36): objs=165 size=148B + /15/15N (2|25|36): objs=1405 size=5.53KiB + /15/16S (2|25|36): objs=145 size=322B + /15/17N (2|25|36): objs=1272 size=5.13KiB + /15/18S (2|25|36): objs=148 size=116B + /15/19N (2|25|36): objs=2874 size=12.32KiB + /15/20S (2|25|36): objs=150 size=232B + /15/21N (2|25|36): objs=3515 size=15.47KiB + /15/22S (2|25|36): objs=143 size=110B + /15/23S (2|25|36): objs=157 size=327B + /15/24S (2|25|36): objs=166 size=341B + /15/25N (2|25|36): objs=7681 size=35.87KiB + /15/26S (2|25|36): objs=155 size=332B + /15/27N (2|25|36): objs=4459 size=19.5KiB + /15/28S (2|25|36): objs=157 size=292B + /15/29N (2|25|36): objs=1662 size=6.6KiB + /15/30S (2|25|36): objs=141 size=94B + /15/31N (2|25|36): objs=1812 size=7.25KiB + /15/32S (2|25|36): objs=140 size=269B + /15/33N (2|25|36): objs=2627 size=10.9KiB + /15/34S (2|25|36): objs=166 size=147B + /15/35N (2|25|36): objs=4659 size=21.71KiB + /16/0N (2|25|36): objs=33615 size=624.04KiB + /16/1S (2|25|36): objs=166 size=168B + /16/2N (2|25|36): objs=6934 size=30.37KiB + /16/3N (2|25|36): objs=37357 size=744.9KiB + /16/4N (2|25|36): objs=38242 size=927.79KiB + /16/5S (2|25|36): objs=161 size=239B + /16/6N (2|25|36): objs=3773 size=16.29KiB + /16/7N (2|25|36): objs=1428 size=5.83KiB + /16/8S (2|25|36): objs=163 size=230B + /16/9N (2|25|36): objs=6718 size=29.91KiB + /16/10S (2|25|36): objs=160 size=159B + /16/11N (2|25|36): objs=4356 size=20.73KiB + /16/12S (2|25|36): objs=147 size=167B + /16/13N (2|25|36): objs=803 size=3.08KiB + /16/14S (2|25|36): objs=154 size=315B + /16/15N (2|25|36): objs=627 size=2.28KiB + /16/16S (2|25|36): objs=149 size=231B + /16/17N (2|25|36): objs=2645 size=12KiB + /16/18S (2|25|36): objs=149 size=322B + /16/19N (2|25|36): objs=7051 size=39.42KiB + /16/20S (2|25|36): objs=141 size=122B + /16/21N (2|25|36): objs=286 size=958B + /16/22S (2|25|36): objs=175 size=263B + /16/23S (2|25|36): objs=163 size=93B + /16/24S (2|25|36): objs=172 size=252B + /16/25N (2|25|36): objs=1388 size=5.63KiB + /16/26S (2|25|36): objs=159 size=289B + /16/27N (2|25|36): objs=1214 size=4.84KiB + /16/28S (2|25|36): objs=152 size=230B + /16/29N (2|25|36): objs=2921 size=12.79KiB + /16/30S (2|25|36): objs=150 size=103B + /16/31N (2|25|36): objs=1811 size=7.78KiB + /16/32S (2|25|36): objs=166 size=99B + /16/33N (2|25|36): objs=1759 size=7.56KiB + /16/34S (2|25|36): objs=152 size=106B + /16/35N (2|25|36): objs=1119 size=4.37KiB + /17/0N (2|25|36): objs=36615 size=764.19KiB + /17/1N (2|25|36): objs=10520 size=80.83KiB + /17/2S (2|25|36): objs=155 size=329B + /17/3N (2|25|36): objs=27217 size=483.62KiB + /17/4N (2|25|36): objs=39642 size=842.41KiB + /17/5N (2|25|36): objs=12623 size=70.02KiB + /17/6S (2|25|36): objs=158 size=343B + /17/7N (2|25|36): objs=930 size=3.52KiB + /17/8S (2|25|36): objs=174 size=325B + /17/9N (2|25|36): objs=1073 size=4.2KiB + /17/10S (2|25|36): objs=177 size=237B + /17/11N (2|25|36): objs=477 size=1.63KiB + /17/12S (2|25|36): objs=173 size=342B + /17/13N (2|25|36): objs=1357 size=5.55KiB + /17/14S (2|25|36): objs=182 size=307B + /17/15N (2|25|36): objs=288 size=1010B + /17/16S (2|25|36): objs=151 size=221B + /17/18S (2|25|36): objs=135 size=246B + /17/19N (2|25|36): objs=2058 size=8.4KiB + /17/20S (2|25|36): objs=132 size=285B + /17/21N (2|25|36): objs=1514 size=6.15KiB + /17/22S (2|25|36): objs=167 size=173B + /17/23N (2|25|36): objs=3969 size=18.21KiB + /17/24S (2|25|36): objs=148 size=252B + /17/26S (2|25|36): objs=153 size=258B + /17/27N (2|25|36): objs=2412 size=10.18KiB + /17/28S (2|25|36): objs=160 size=121B + /17/29S (2|25|36): objs=163 size=188B + /17/30S (2|25|36): objs=166 size=134B + /17/31N (2|25|36): objs=5162 size=30.09KiB + /17/32S (2|25|36): objs=157 size=181B + /17/33N (2|25|36): objs=1271 size=4.76KiB + /17/34S (2|25|36): objs=171 size=101B + /17/35N (2|25|36): objs=6871 size=34.73KiB + /18/0N (2|25|36): objs=35491 size=745.92KiB + /18/1N (2|25|36): objs=47513 size=1.23MiB + /18/2N (2|25|36): objs=35737 size=691.82KiB + /18/3N (2|25|36): objs=3806 size=17.61KiB + /18/4S (2|25|36): objs=154 size=260B + /18/5N (2|25|36): objs=2440 size=10.71KiB + /18/6S (2|25|36): objs=176 size=277B + /18/7S (2|25|36): objs=143 size=128B + /18/8S (2|25|36): objs=153 size=202B + /18/9N (2|25|36): objs=714 size=2.96KiB + /18/10S (2|25|36): objs=131 size=260B + /18/11N (2|25|36): objs=9045 size=45.45KiB + /18/12S (2|25|36): objs=158 size=259B + /18/13N (2|25|36): objs=614 size=2.16KiB + /18/14S (2|25|36): objs=143 size=163B + /18/15N (2|25|36): objs=4435 size=20.81KiB + /18/16S (2|25|36): objs=150 size=242B + /18/17N (2|25|36): objs=1856 size=7.77KiB + /18/18S (2|25|36): objs=152 size=104B + /18/19N (2|25|36): objs=446 size=1.41KiB + /18/20S (2|25|36): objs=140 size=255B + /18/21N (2|25|36): objs=297 size=980B + /18/22S (2|25|36): objs=143 size=221B + /18/23N (2|25|36): objs=5898 size=31.02KiB + /18/24S (2|25|36): objs=160 size=141B + /18/26S (2|25|36): objs=159 size=255B + /18/27N (2|25|36): objs=466 size=1.47KiB + /18/28S (2|25|36): objs=173 size=278B + /18/30S (2|25|36): objs=165 size=359B + /18/31N (2|25|36): objs=1853 size=7.92KiB + /18/32S (2|25|36): objs=131 size=238B + /18/33N (2|25|36): objs=1088 size=4.4KiB + /18/34S (2|25|36): objs=159 size=343B + /18/35N (2|25|36): objs=1408 size=5.86KiB + /19/0N (2|25|36): objs=41459 size=943.34KiB + /19/1N (2|25|36): objs=38935 size=786.05KiB + /19/2N (2|25|36): objs=23810 size=301.96KiB + /19/3S (2|25|36): objs=187 size=278B + /19/4N (2|25|36): objs=11005 size=61.22KiB + /19/5S (2|25|36): objs=156 size=101B + /19/6N (2|25|36): objs=1058 size=4.21KiB + /19/7N (2|25|36): objs=1229 size=4.97KiB + /19/8S (2|25|36): objs=163 size=271B + /19/9N (2|25|36): objs=1313 size=5.14KiB + /19/10S (2|25|36): objs=152 size=139B + /19/11N (2|25|36): objs=1196 size=4.69KiB + /19/12S (2|25|36): objs=142 size=124B + /19/13S (2|25|36): objs=146 size=202B + /19/14S (2|25|36): objs=128 size=303B + /19/15N (2|25|36): objs=1829 size=7.57KiB + /19/16S (2|25|36): objs=128 size=177B + /19/17N (2|25|36): objs=1091 size=4.14KiB + /19/18S (2|25|36): objs=147 size=151B + /19/19N (2|25|36): objs=749 size=2.82KiB + /19/20S (2|25|36): objs=153 size=250B + /19/21N (2|25|36): objs=1874 size=7.73KiB + /19/22S (2|25|36): objs=165 size=100B + /19/23N (2|25|36): objs=1091 size=4.51KiB + /19/24S (2|25|36): objs=168 size=97B + /19/25N (2|25|36): objs=403 size=1.48KiB + /19/26S (2|25|36): objs=156 size=105B + /19/27N (2|25|36): objs=8954 size=42.77KiB + /19/28S (2|25|36): objs=178 size=282B + /19/29N (2|25|36): objs=1036 size=4.03KiB + /19/30S (2|25|36): objs=148 size=225B + /19/31N (2|25|36): objs=14339 size=125.59KiB + /19/32S (2|25|36): objs=148 size=97B + /19/33N (2|25|36): objs=1790 size=7.43KiB + /19/34S (2|25|36): objs=157 size=262B + /19/35N (2|25|36): objs=2451 size=10.73KiB + /20/0N (2|25|36): objs=36715 size=716.32KiB + /20/1N (2|25|36): objs=34558 size=689.09KiB + /20/2N (2|25|36): objs=41189 size=932.5KiB + /20/3N (2|25|36): objs=12131 size=64.72KiB + /20/4S (2|25|36): objs=178 size=258B + /20/6S (2|25|36): objs=153 size=201B + /20/7N (2|25|36): objs=1499 size=6.53KiB + /20/8S (2|25|36): objs=163 size=350B + /20/9N (2|25|36): objs=1843 size=7.48KiB + /20/10S (2|25|36): objs=160 size=348B + /20/11N (2|25|36): objs=753 size=2.98KiB + /20/12S (2|25|36): objs=149 size=173B + /20/13N (2|25|36): objs=574 size=2.2KiB + /20/14S (2|25|36): objs=144 size=133B + /20/16S (2|25|36): objs=177 size=111B + /20/17N (2|25|36): objs=2075 size=8.61KiB + /20/18S (2|25|36): objs=168 size=274B + /20/19N (2|25|36): objs=5063 size=25.19KiB + /20/20S (2|25|36): objs=148 size=215B + /20/21N (2|25|36): objs=2312 size=9.86KiB + /20/22S (2|25|36): objs=163 size=110B + /20/23N (2|25|36): objs=3914 size=17.34KiB + /20/24S (2|25|36): objs=145 size=281B + /20/25S (2|25|36): objs=142 size=122B + /20/26S (2|25|36): objs=143 size=85B + /20/27N (2|25|36): objs=592 size=2.13KiB + /20/28S (2|25|36): objs=155 size=140B + /20/29N (2|25|36): objs=1555 size=6.44KiB + /20/30S (2|25|36): objs=171 size=200B + /20/32S (2|25|36): objs=142 size=235B + /20/33S (2|25|36): objs=164 size=237B + /20/34S (2|25|36): objs=144 size=178B + /20/35S (2|25|36): objs=170 size=184B + /21/0N (2|25|36): objs=35743 size=818.02KiB + /21/1N (2|25|36): objs=38333 size=855.3KiB + /21/2N (2|25|36): objs=35925 size=643.5KiB + /21/3S (2|25|36): objs=156 size=290B + /21/4N (2|25|36): objs=2296 size=9.96KiB + /21/5S (2|25|36): objs=166 size=298B + /21/6N (2|25|36): objs=954 size=3.72KiB + /21/7N (2|25|36): objs=2699 size=11.51KiB + /21/8S (2|25|36): objs=150 size=183B + /21/9N (2|25|36): objs=1533 size=6.23KiB + /21/10S (2|25|36): objs=145 size=88B + /21/11N (2|25|36): objs=264 size=868B + /21/12S (2|25|36): objs=170 size=352B + /21/13N (2|25|36): objs=1578 size=6.47KiB + /21/14S (2|25|36): objs=141 size=293B + /21/15N (2|25|36): objs=3644 size=16.05KiB + /21/16S (2|25|36): objs=147 size=237B + /21/17N (2|25|36): objs=3996 size=17.99KiB + /21/18S (2|25|36): objs=160 size=319B + /21/19N (2|25|36): objs=1780 size=7.04KiB + /21/20S (2|25|36): objs=196 size=371B + /21/21N (2|25|36): objs=747 size=2.69KiB + /21/22S (2|25|36): objs=165 size=308B + /21/23N (2|25|36): objs=2681 size=12.36KiB + /21/24S (2|25|36): objs=167 size=132B + /21/25N (2|25|36): objs=746 size=2.75KiB + /21/26S (2|25|36): objs=162 size=148B + /21/27N (2|25|36): objs=473 size=1.63KiB + /21/28S (2|25|36): objs=154 size=107B + /21/29N (2|25|36): objs=474 size=1.46KiB + /21/30S (2|25|36): objs=145 size=280B + /21/31N (2|25|36): objs=7025 size=36.52KiB + /21/32S (2|25|36): objs=162 size=192B + /21/33N (2|25|36): objs=339 size=1010B + /21/34S (2|25|36): objs=155 size=249B + /21/35N (2|25|36): objs=5447 size=26.71KiB + /22/0N (1|26|34): objs=67950 size=2.39MiB + /22/1N (1|26|34): objs=38761 size=750.27KiB + /22/2S (1|26|34): objs=140 size=142B + /22/3N (1|26|34): objs=346 size=896B + /22/4S (1|26|34): objs=162 size=268B + /22/5N (1|26|34): objs=780 size=3.07KiB + /22/6S (1|26|34): objs=149 size=279B + /22/7N (1|26|34): objs=4657 size=21.6KiB + /22/8S (1|26|34): objs=171 size=156B + /22/9N (1|26|34): objs=3067 size=12.95KiB + /22/10S (1|26|34): objs=147 size=282B + /22/11N (1|26|34): objs=2611 size=10.96KiB + /22/12S (1|26|34): objs=151 size=129B + /22/13N (1|26|34): objs=1785 size=7.56KiB + /22/14S (1|26|34): objs=145 size=186B + /22/15N (1|26|34): objs=300 size=1KiB + /22/16S (1|26|34): objs=152 size=124B + /22/17N (1|26|34): objs=597 size=2.12KiB + /22/18S (1|26|34): objs=158 size=220B + /22/19N (1|26|34): objs=330 size=817B + /22/20S (1|26|34): objs=159 size=233B + /22/21N (1|26|34): objs=3619 size=16.08KiB + /22/22S (1|26|34): objs=169 size=343B + /22/23N (1|26|34): objs=1697 size=6.92KiB + /22/24S (1|26|34): objs=140 size=291B + /22/25N (1|26|34): objs=3463 size=15.71KiB + /22/26S (1|26|34): objs=159 size=97B + /22/27N (1|26|34): objs=2008 size=8.49KiB + /22/28S (1|26|34): objs=143 size=318B + /22/30S (1|26|34): objs=155 size=103B + /22/31N (1|26|34): objs=7476 size=38.67KiB + /22/32S (1|26|34): objs=147 size=209B + /22/33N (1|26|34): objs=442 size=1.44KiB + /23/0N (2|25|36): objs=40619 size=920.54KiB + /23/1N (2|25|36): objs=41832 size=921.17KiB + /23/2N (2|25|36): objs=30422 size=550.17KiB + /23/3S (2|25|36): objs=140 size=260B + /23/4N (2|25|36): objs=1502 size=6.28KiB + /23/5S (2|25|36): objs=145 size=146B + /23/6N (2|25|36): objs=613 size=2.1KiB + /23/7S (2|25|36): objs=162 size=175B + /23/8N (2|25|36): objs=574 size=2.03KiB + /23/9S (2|25|36): objs=172 size=158B + /23/10N (2|25|36): objs=1375 size=5.64KiB + /23/11S (2|25|36): objs=148 size=160B + /23/12N (2|25|36): objs=327 size=817B + /23/13N (2|25|36): objs=4611 size=20.06KiB + /23/14S (2|25|36): objs=156 size=247B + /23/15N (2|25|36): objs=3064 size=13.1KiB + /23/16S (2|25|36): objs=151 size=138B + /23/17N (2|25|36): objs=2250 size=9.44KiB + /23/18S (2|25|36): objs=154 size=163B + /23/19N (2|25|36): objs=2118 size=8.96KiB + /23/20S (2|25|36): objs=138 size=236B + /23/21N (2|25|36): objs=773 size=2.9KiB + /23/22S (2|25|36): objs=167 size=94B + /23/23N (2|25|36): objs=2230 size=9.18KiB + /23/24S (2|25|36): objs=162 size=285B + /23/25N (2|25|36): objs=2489 size=10.57KiB + /23/26S (2|25|36): objs=134 size=239B + /23/27N (2|25|36): objs=3826 size=18.41KiB + /23/28S (2|25|36): objs=147 size=138B + /23/29N (2|25|36): objs=9020 size=51.54KiB + /23/30S (2|25|36): objs=148 size=142B + /23/31N (2|25|36): objs=1536 size=6.42KiB + /23/32S (2|25|36): objs=152 size=188B + /23/33N (2|25|36): objs=3924 size=19.59KiB + /23/34S (2|25|36): objs=137 size=173B + /24/0N (2|25|36): objs=34751 size=697.52KiB + /24/1N (2|25|36): objs=40660 size=1.09MiB + /24/2N (2|25|36): objs=9135 size=51.29KiB + /24/3S (2|25|36): objs=160 size=344B + /24/4N (2|25|36): objs=23813 size=329.2KiB + /24/5N (2|25|36): objs=6884 size=29.89KiB + /24/6S (2|25|36): objs=173 size=126B + /24/7N (2|25|36): objs=4178 size=18.65KiB + /24/8S (2|25|36): objs=158 size=143B + /24/9N (2|25|36): objs=2869 size=12.94KiB + /24/10S (2|25|36): objs=142 size=274B + /24/11N (2|25|36): objs=1238 size=4.88KiB + /24/12S (2|25|36): objs=147 size=89B + /24/13N (2|25|36): objs=1190 size=4.72KiB + /24/14S (2|25|36): objs=155 size=272B + /24/15N (2|25|36): objs=887 size=3.35KiB + /24/16S (2|25|36): objs=152 size=142B + /24/17N (2|25|36): objs=472 size=1.52KiB + /24/18S (2|25|36): objs=151 size=160B + /24/19N (2|25|36): objs=909 size=3.39KiB + /24/20S (2|25|36): objs=151 size=154B + /24/21N (2|25|36): objs=1084 size=4.17KiB + /24/22S (2|25|36): objs=174 size=95B + /24/23N (2|25|36): objs=922 size=3.72KiB + /24/24S (2|25|36): objs=141 size=142B + /24/25N (2|25|36): objs=2547 size=11.81KiB + /24/26S (2|25|36): objs=161 size=219B + /24/27N (2|25|36): objs=6203 size=29.85KiB + /24/28S (2|25|36): objs=149 size=194B + /24/29N (2|25|36): objs=988 size=3.87KiB + /24/30S (2|25|36): objs=159 size=344B + /24/31N (2|25|36): objs=902 size=3.49KiB + /24/32S (2|25|36): objs=143 size=316B + /24/33N (2|25|36): objs=4834 size=21.98KiB + /24/34S (2|25|36): objs=167 size=215B + /24/35N (2|25|36): objs=1828 size=7.86KiB + /25/0N (2|25|36): objs=38353 size=913.27KiB + /25/1N (2|25|36): objs=37016 size=741.63KiB + /25/2N (2|25|36): objs=38084 size=809.62KiB + /25/3N (2|25|36): objs=4761 size=22.76KiB + /25/4S (2|25|36): objs=134 size=232B + /25/5S (2|25|36): objs=140 size=237B + /25/6S (2|25|36): objs=143 size=115B + /25/7S (2|25|36): objs=151 size=338B + /25/8S (2|25|36): objs=124 size=105B + /25/9N (2|25|36): objs=750 size=2.98KiB + /25/10S (2|25|36): objs=142 size=307B + /25/11N (2|25|36): objs=2271 size=9.29KiB + /25/12S (2|25|36): objs=178 size=259B + /25/13N (2|25|36): objs=2807 size=11.77KiB + /25/14S (2|25|36): objs=143 size=145B + /25/15N (2|25|36): objs=5379 size=26.47KiB + /25/16S (2|25|36): objs=136 size=226B + /25/17N (2|25|36): objs=4122 size=18.9KiB + /25/18S (2|25|36): objs=158 size=91B + /25/19S (2|25|36): objs=146 size=111B + /25/20S (2|25|36): objs=176 size=295B + /25/21N (2|25|36): objs=6225 size=32KiB + /25/22S (2|25|36): objs=151 size=100B + /25/23N (2|25|36): objs=1145 size=4.7KiB + /25/24S (2|25|36): objs=157 size=242B + /25/25N (2|25|36): objs=2681 size=12.12KiB + /25/26S (2|25|36): objs=158 size=190B + /25/27S (2|25|36): objs=147 size=239B + /25/28S (2|25|36): objs=141 size=165B + /25/29N (2|25|36): objs=3419 size=14.91KiB + /25/30S (2|25|36): objs=145 size=244B + /25/31N (2|25|36): objs=924 size=3.77KiB + /25/32S (2|25|36): objs=159 size=346B + /25/33N (2|25|36): objs=3796 size=17.43KiB + /25/34S (2|25|36): objs=166 size=287B + /25/35N (2|25|36): objs=428 size=1.45KiB + /26/0N (2|25|36): objs=40540 size=861.33KiB + /26/1N (2|25|36): objs=38641 size=972.64KiB + /26/2N (2|25|36): objs=38659 size=908.9KiB + /26/3N (2|25|36): objs=9953 size=52.27KiB + /26/4S (2|25|36): objs=153 size=271B + /26/5N (2|25|36): objs=612 size=2.12KiB + /26/6S (2|25|36): objs=174 size=293B + /26/7S (2|25|36): objs=161 size=154B + /26/8S (2|25|36): objs=160 size=149B + /26/9S (2|25|36): objs=161 size=149B + /26/10S (2|25|36): objs=158 size=321B + /26/11N (2|25|36): objs=2613 size=10.92KiB + /26/12S (2|25|36): objs=151 size=103B + /26/13N (2|25|36): objs=3222 size=13.92KiB + /26/14S (2|25|36): objs=160 size=204B + /26/16S (2|25|36): objs=149 size=166B + /26/17N (2|25|36): objs=1493 size=6.37KiB + /26/18S (2|25|36): objs=142 size=260B + /26/20S (2|25|36): objs=156 size=237B + /26/21N (2|25|36): objs=6354 size=29.4KiB + /26/22S (2|25|36): objs=157 size=333B + /26/23N (2|25|36): objs=774 size=3.11KiB + /26/24S (2|25|36): objs=160 size=201B + /26/25N (2|25|36): objs=3542 size=15.85KiB + /26/26S (2|25|36): objs=169 size=267B + /26/27N (2|25|36): objs=4645 size=20.15KiB + /26/28S (2|25|36): objs=165 size=348B + /26/29N (2|25|36): objs=1241 size=5.07KiB + /26/30S (2|25|36): objs=133 size=244B + /26/31N (2|25|36): objs=1536 size=6.29KiB + /26/32S (2|25|36): objs=140 size=309B + /26/33N (2|25|36): objs=1637 size=6.89KiB + /26/34S (2|25|36): objs=172 size=117B + /26/35N (2|25|36): objs=311 size=995B + /27/0N (2|25|36): objs=42887 size=1MiB + /27/1N (2|25|36): objs=38913 size=836.42KiB + /27/2N (2|25|36): objs=38162 size=874.97KiB + /27/3N (2|25|36): objs=6315 size=31.61KiB + /27/4S (2|25|36): objs=147 size=299B + /27/5N (2|25|36): objs=1833 size=7.55KiB + /27/6S (2|25|36): objs=134 size=251B + /27/7N (2|25|36): objs=1947 size=7.92KiB + /27/8S (2|25|36): objs=161 size=208B + /27/9N (2|25|36): objs=4911 size=23.99KiB + /27/10S (2|25|36): objs=151 size=294B + /27/11N (2|25|36): objs=4451 size=20.57KiB + /27/12S (2|25|36): objs=141 size=101B + /27/13N (2|25|36): objs=913 size=3.69KiB + /27/14S (2|25|36): objs=149 size=108B + /27/15S (2|25|36): objs=154 size=318B + /27/16S (2|25|36): objs=143 size=128B + /27/17N (2|25|36): objs=3013 size=13.58KiB + /27/18S (2|25|36): objs=181 size=90B + /27/19N (2|25|36): objs=459 size=1.58KiB + /27/20S (2|25|36): objs=139 size=300B + /27/21N (2|25|36): objs=1704 size=6.86KiB + /27/22S (2|25|36): objs=145 size=334B + /27/23N (2|25|36): objs=2414 size=10.46KiB + /27/24S (2|25|36): objs=176 size=111B + /27/25N (2|25|36): objs=1329 size=5.42KiB + /27/26S (2|25|36): objs=147 size=102B + /27/27N (2|25|36): objs=2747 size=11.57KiB + /27/28S (2|25|36): objs=192 size=276B + /27/29N (2|25|36): objs=877 size=3.53KiB + /27/30S (2|25|36): objs=171 size=132B + /27/31N (2|25|36): objs=2342 size=11.13KiB + /27/32S (2|25|36): objs=169 size=341B + /27/33N (2|25|36): objs=2745 size=11.55KiB + /27/34S (2|25|36): objs=151 size=287B + /27/35N (2|25|36): objs=2165 size=9.17KiB + /28/0N (2|25|36): objs=38812 size=927.08KiB + /28/1N (2|25|36): objs=39361 size=849.9KiB + /28/2N (2|25|36): objs=41361 size=956.06KiB + /28/3N (2|25|36): objs=5847 size=25.43KiB + /28/4S (2|25|36): objs=145 size=248B + /28/5S (2|25|36): objs=124 size=252B + /28/6S (2|25|36): objs=149 size=265B + /28/7N (2|25|36): objs=1806 size=7.51KiB + /28/8S (2|25|36): objs=144 size=180B + /28/9N (2|25|36): objs=422 size=1.53KiB + /28/10S (2|25|36): objs=137 size=174B + /28/11N (2|25|36): objs=2122 size=8.82KiB + /28/12S (2|25|36): objs=149 size=326B + /28/13N (2|25|36): objs=740 size=2.84KiB + /28/14S (2|25|36): objs=149 size=262B + /28/15N (2|25|36): objs=476 size=1.68KiB + /28/16S (2|25|36): objs=161 size=292B + /28/17N (2|25|36): objs=3746 size=16.84KiB + /28/18S (2|25|36): objs=143 size=270B + /28/19N (2|25|36): objs=3583 size=16.21KiB + /28/20S (2|25|36): objs=141 size=164B + /28/21N (2|25|36): objs=3013 size=13.72KiB + /28/22S (2|25|36): objs=127 size=293B + /28/23N (2|25|36): objs=795 size=2.89KiB + /28/24S (2|25|36): objs=141 size=90B + /28/25N (2|25|36): objs=2064 size=8.83KiB + /28/26S (2|25|36): objs=170 size=339B + /28/27N (2|25|36): objs=616 size=2.25KiB + /28/28S (2|25|36): objs=155 size=316B + /28/29N (2|25|36): objs=1488 size=6.02KiB + /28/30S (2|25|36): objs=159 size=128B + /28/31N (2|25|36): objs=3611 size=18.14KiB + /28/32S (2|25|36): objs=165 size=213B + /28/33N (2|25|36): objs=1049 size=4.27KiB + /28/34S (2|25|36): objs=140 size=213B + /28/35N (2|25|36): objs=7182 size=35.51KiB + /29/0N (2|25|36): objs=39697 size=895.1KiB + /29/1N (2|25|36): objs=35534 size=654.36KiB + /29/2N (2|25|36): objs=42681 size=1.01MiB + /29/3N (2|25|36): objs=6318 size=34.76KiB + /29/4S (2|25|36): objs=148 size=269B + /29/5N (2|25|36): objs=2688 size=12.87KiB + /29/6S (2|25|36): objs=143 size=312B + /29/7N (2|25|36): objs=1062 size=4.3KiB + /29/8S (2|25|36): objs=168 size=347B + /29/9N (2|25|36): objs=1953 size=8.01KiB + /29/10S (2|25|36): objs=148 size=282B + /29/11N (2|25|36): objs=1504 size=6.33KiB + /29/12S (2|25|36): objs=150 size=317B + /29/13N (2|25|36): objs=1516 size=6.12KiB + /29/14S (2|25|36): objs=163 size=292B + /29/15N (2|25|36): objs=905 size=3.47KiB + /29/16S (2|25|36): objs=137 size=115B + /29/17N (2|25|36): objs=3797 size=16.75KiB + /29/18S (2|25|36): objs=162 size=199B + /29/19N (2|25|36): objs=612 size=2.21KiB + /29/20S (2|25|36): objs=186 size=297B + /29/21N (2|25|36): objs=1685 size=6.98KiB + /29/22S (2|25|36): objs=153 size=213B + /29/23N (2|25|36): objs=446 size=1.64KiB + /29/24S (2|25|36): objs=138 size=92B + /29/25N (2|25|36): objs=3359 size=16.35KiB + /29/26S (2|25|36): objs=153 size=107B + /29/27N (2|25|36): objs=3846 size=16.51KiB + /29/28S (2|25|36): objs=157 size=173B + /29/29N (2|25|36): objs=1865 size=7.75KiB + /29/30S (2|25|36): objs=162 size=93B + /29/31N (2|25|36): objs=1360 size=5.51KiB + /29/32S (2|25|36): objs=172 size=232B + /29/33N (2|25|36): objs=5301 size=24.57KiB + /29/34S (2|25|36): objs=167 size=146B + /29/35N (2|25|36): objs=2436 size=10.49KiB + /30/0N (2|25|36): objs=42958 size=1.05MiB + /30/1N (2|25|36): objs=41939 size=1003.3KiB + /30/2N (2|25|36): objs=3939 size=17.23KiB + /30/3S (2|25|36): objs=156 size=86B + /30/4N (2|25|36): objs=3842 size=17.06KiB + /30/5S (2|25|36): objs=147 size=209B + /30/6N (2|25|36): objs=31233 size=612.76KiB + /30/7S (2|25|36): objs=160 size=252B + /30/8S (2|25|36): objs=151 size=211B + /30/9S (2|25|36): objs=153 size=180B + /30/10N (2|25|36): objs=303 size=741B + /30/11S (2|25|36): objs=143 size=316B + /30/12N (2|25|36): objs=1222 size=5.14KiB + /30/13S (2|25|36): objs=135 size=113B + /30/14S (2|25|36): objs=143 size=185B + /30/15N (2|25|36): objs=4849 size=21.08KiB + /30/16S (2|25|36): objs=153 size=144B + /30/17N (2|25|36): objs=2868 size=12.9KiB + /30/18S (2|25|36): objs=159 size=304B + /30/19S (2|25|36): objs=152 size=117B + /30/20S (2|25|36): objs=160 size=106B + /30/21N (2|25|36): objs=6975 size=33.25KiB + /30/22S (2|25|36): objs=147 size=127B + /30/23N (2|25|36): objs=9123 size=53.31KiB + /30/24S (2|25|36): objs=161 size=221B + /30/25N (2|25|36): objs=2450 size=10.55KiB + /30/26S (2|25|36): objs=131 size=325B + /30/27N (2|25|36): objs=7083 size=31.71KiB + /30/28S (2|25|36): objs=141 size=261B + /30/29N (2|25|36): objs=1652 size=6.81KiB + /30/30S (2|25|36): objs=153 size=255B + /30/31N (2|25|36): objs=1076 size=4.58KiB + /30/32S (2|25|36): objs=162 size=87B + /30/33S (2|25|36): objs=156 size=280B + /30/34S (2|25|36): objs=161 size=165B + /31/0N (2|25|36): objs=42194 size=1.02MiB + /31/1N (2|25|36): objs=38519 size=949.86KiB + /31/2N (2|25|36): objs=7190 size=39.19KiB + /31/3S (2|25|36): objs=137 size=296B + /31/4N (2|25|36): objs=29224 size=454.18KiB + /31/5N (2|25|36): objs=4340 size=19.94KiB + /31/6S (2|25|36): objs=160 size=158B + /31/7N (2|25|36): objs=2239 size=9.9KiB + /31/8S (2|25|36): objs=149 size=252B + /31/9S (2|25|36): objs=149 size=310B + /31/10S (2|25|36): objs=156 size=325B + /31/11N (2|25|36): objs=1500 size=6.26KiB + /31/12S (2|25|36): objs=188 size=327B + /31/13N (2|25|36): objs=4702 size=20.35KiB + /31/14S (2|25|36): objs=155 size=265B + /31/16S (2|25|36): objs=153 size=108B + /31/17N (2|25|36): objs=2924 size=12.94KiB + /31/18S (2|25|36): objs=159 size=332B + /31/19N (2|25|36): objs=3446 size=15.38KiB + /31/20S (2|25|36): objs=166 size=328B + /31/21S (2|25|36): objs=169 size=160B + /31/22S (2|25|36): objs=143 size=126B + /31/23N (2|25|36): objs=1428 size=5.86KiB + /31/24S (2|25|36): objs=182 size=197B + /31/25N (2|25|36): objs=306 size=892B + /31/26S (2|25|36): objs=164 size=342B + /31/27N (2|25|36): objs=3676 size=16.52KiB + /31/28S (2|25|36): objs=146 size=270B + /31/29N (2|25|36): objs=2183 size=9.22KiB + /31/30S (2|25|36): objs=156 size=155B + /31/32S (2|25|36): objs=147 size=318B + /31/33N (2|25|36): objs=4158 size=17.98KiB + /31/34S (2|25|36): objs=161 size=338B + /31/35N (2|25|36): objs=5560 size=26.31KiB + +com.milaboratory.util.sorting.HashSorterTest > test2 SKIPPED + +com.milaboratory.util.CacheTest > test1 STANDARD_OUT + Cache misses:400 + Cache hits:800 + +com.milaboratory.util.AtomicEnumHistogramTest > test1 STANDARD_OUT + {"labels":["A","B","C","null"],"hist":[1,2,0,1]} + +com.milaboratory.util.ByteStringTest > testSpeed1 STANDARD_OUT + Time per hash: 2.75us + Addition to hash set (per operation): 8.28us + Hash set removal (per operation): 4.92us + a + +com.milaboratory.test.TestUtil > testLT STANDARD_OUT + Short tests. + No system env properties. +Gradle Test Executor 1 finished executing tests. WARNING: A terminally deprecated method in java.lang.System has been called WARNING: System::setSecurityManager has been called by org.gradle.api.internal.tasks.testing.worker.TestWorker (file:/usr/share/gradle/lib/plugins/gradle-testing-base-4.4.1.jar) WARNING: Please consider reporting this to the maintainers of org.gradle.api.internal.tasks.testing.worker.TestWorker WARNING: System::setSecurityManager will be removed in a future release -Gradle Test Executor 1 finished executing tests. -Finished generating test XML results (1.008 secs) into: /build/reproducible-path/milib-2.2.0+dfsg/build/test-results/test + +501 tests completed, 1 failed, 17 skipped +Finished generating test XML results (3.82 secs) into: /build/reproducible-path/milib-2.2.0+dfsg/build/test-results/test Generating HTML test report... -Finished generating test html results (1.268 secs) into: /build/reproducible-path/milib-2.2.0+dfsg/build/reports/tests/test -:test (Thread[Daemon worker,5,main]) completed. Took 22 mins 31.199 secs. +Finished generating test html results (5.451 secs) into: /build/reproducible-path/milib-2.2.0+dfsg/build/reports/tests/test +:test FAILED +:test (Thread[Task worker for ':' Thread 2,5,main]) completed. Took 43 mins 9.049 secs. + +FAILURE: Build failed with an exception. + +* What went wrong: +Execution failed for task ':test'. +> There were failing tests. See the report at: file:///build/reproducible-path/milib-2.2.0+dfsg/build/reports/tests/test/index.html + +* Try: +Run with --debug option to get more log output. Run with --scan to get full insights. + +* Exception is: +org.gradle.api.tasks.TaskExecutionException: Execution failed for task ':test'. + at org.gradle.api.internal.tasks.execution.ExecuteActionsTaskExecuter.executeActions(ExecuteActionsTaskExecuter.java:100) + at org.gradle.api.internal.tasks.execution.ExecuteActionsTaskExecuter.execute(ExecuteActionsTaskExecuter.java:70) + at org.gradle.api.internal.tasks.execution.OutputDirectoryCreatingTaskExecuter.execute(OutputDirectoryCreatingTaskExecuter.java:51) + at org.gradle.api.internal.tasks.execution.SkipUpToDateTaskExecuter.execute(SkipUpToDateTaskExecuter.java:62) + at org.gradle.api.internal.tasks.execution.ResolveTaskOutputCachingStateExecuter.execute(ResolveTaskOutputCachingStateExecuter.java:54) + at org.gradle.api.internal.tasks.execution.ValidatingTaskExecuter.execute(ValidatingTaskExecuter.java:60) + at org.gradle.api.internal.tasks.execution.SkipEmptySourceFilesTaskExecuter.execute(SkipEmptySourceFilesTaskExecuter.java:97) + at org.gradle.api.internal.tasks.execution.CleanupStaleOutputsExecuter.execute(CleanupStaleOutputsExecuter.java:87) + at org.gradle.api.internal.tasks.execution.ResolveTaskArtifactStateTaskExecuter.execute(ResolveTaskArtifactStateTaskExecuter.java:52) + at org.gradle.api.internal.tasks.execution.SkipTaskWithNoActionsExecuter.execute(SkipTaskWithNoActionsExecuter.java:52) + at org.gradle.api.internal.tasks.execution.SkipOnlyIfTaskExecuter.execute(SkipOnlyIfTaskExecuter.java:54) + at org.gradle.api.internal.tasks.execution.ExecuteAtMostOnceTaskExecuter.execute(ExecuteAtMostOnceTaskExecuter.java:43) + at org.gradle.api.internal.tasks.execution.CatchExceptionTaskExecuter.execute(CatchExceptionTaskExecuter.java:34) + at org.gradle.execution.taskgraph.DefaultTaskGraphExecuter$EventFiringTaskWorker$1.run(DefaultTaskGraphExecuter.java:248) + at org.gradle.internal.progress.DefaultBuildOperationExecutor$RunnableBuildOperationWorker.execute(DefaultBuildOperationExecutor.java:336) + at org.gradle.internal.progress.DefaultBuildOperationExecutor$RunnableBuildOperationWorker.execute(DefaultBuildOperationExecutor.java:328) + at org.gradle.internal.progress.DefaultBuildOperationExecutor.execute(DefaultBuildOperationExecutor.java:199) + at org.gradle.internal.progress.DefaultBuildOperationExecutor.run(DefaultBuildOperationExecutor.java:110) + at org.gradle.execution.taskgraph.DefaultTaskGraphExecuter$EventFiringTaskWorker.execute(DefaultTaskGraphExecuter.java:241) + at org.gradle.execution.taskgraph.DefaultTaskGraphExecuter$EventFiringTaskWorker.execute(DefaultTaskGraphExecuter.java:230) + at org.gradle.execution.taskgraph.DefaultTaskPlanExecutor$TaskExecutorWorker.processTask(DefaultTaskPlanExecutor.java:123) + at org.gradle.execution.taskgraph.DefaultTaskPlanExecutor$TaskExecutorWorker.access$200(DefaultTaskPlanExecutor.java:79) + at org.gradle.execution.taskgraph.DefaultTaskPlanExecutor$TaskExecutorWorker$1.execute(DefaultTaskPlanExecutor.java:104) + at org.gradle.execution.taskgraph.DefaultTaskPlanExecutor$TaskExecutorWorker$1.execute(DefaultTaskPlanExecutor.java:98) + at org.gradle.execution.taskgraph.DefaultTaskExecutionPlan.execute(DefaultTaskExecutionPlan.java:626) + at org.gradle.execution.taskgraph.DefaultTaskExecutionPlan.executeWithTask(DefaultTaskExecutionPlan.java:581) + at org.gradle.execution.taskgraph.DefaultTaskPlanExecutor$TaskExecutorWorker.run(DefaultTaskPlanExecutor.java:98) + at org.gradle.internal.concurrent.ExecutorPolicy$CatchAndRecordFailures.onExecute(ExecutorPolicy.java:63) + at org.gradle.internal.concurrent.ManagedExecutorImpl$1.run(ManagedExecutorImpl.java:46) + at org.gradle.internal.concurrent.ThreadFactoryImpl$ManagedThreadRunnable.run(ThreadFactoryImpl.java:55) +Caused by: org.gradle.api.GradleException: There were failing tests. See the report at: file:///build/reproducible-path/milib-2.2.0+dfsg/build/reports/tests/test/index.html + at org.gradle.api.tasks.testing.AbstractTestTask.handleTestFailures(AbstractTestTask.java:547) + at org.gradle.api.tasks.testing.AbstractTestTask.executeTests(AbstractTestTask.java:464) + at org.gradle.api.tasks.testing.Test.executeTests(Test.java:530) + at java.base/jdk.internal.reflect.NativeMethodAccessorImpl.invoke0(Native Method) + at java.base/jdk.internal.reflect.NativeMethodAccessorImpl.invoke(NativeMethodAccessorImpl.java:77) + at java.base/jdk.internal.reflect.DelegatingMethodAccessorImpl.invoke(DelegatingMethodAccessorImpl.java:43) + at org.gradle.internal.reflect.JavaMethod.invoke(JavaMethod.java:73) + at org.gradle.api.internal.project.taskfactory.StandardTaskAction.doExecute(StandardTaskAction.java:46) + at org.gradle.api.internal.project.taskfactory.StandardTaskAction.execute(StandardTaskAction.java:39) + at org.gradle.api.internal.project.taskfactory.StandardTaskAction.execute(StandardTaskAction.java:26) + at org.gradle.api.internal.AbstractTask$TaskActionWrapper.execute(AbstractTask.java:780) + at org.gradle.api.internal.AbstractTask$TaskActionWrapper.execute(AbstractTask.java:747) + at org.gradle.api.internal.tasks.execution.ExecuteActionsTaskExecuter$1.run(ExecuteActionsTaskExecuter.java:121) + at org.gradle.internal.progress.DefaultBuildOperationExecutor$RunnableBuildOperationWorker.execute(DefaultBuildOperationExecutor.java:336) + at org.gradle.internal.progress.DefaultBuildOperationExecutor$RunnableBuildOperationWorker.execute(DefaultBuildOperationExecutor.java:328) + at org.gradle.internal.progress.DefaultBuildOperationExecutor.execute(DefaultBuildOperationExecutor.java:199) + at org.gradle.internal.progress.DefaultBuildOperationExecutor.run(DefaultBuildOperationExecutor.java:110) + at org.gradle.api.internal.tasks.execution.ExecuteActionsTaskExecuter.executeAction(ExecuteActionsTaskExecuter.java:110) + at org.gradle.api.internal.tasks.execution.ExecuteActionsTaskExecuter.executeActions(ExecuteActionsTaskExecuter.java:92) + ... 29 more + -BUILD SUCCESSFUL in 24m 11s +* Get more help at https://help.gradle.org + +BUILD FAILED in 48m 8s 5 actionable tasks: 3 executed, 2 up-to-date - create-stamp debian/debhelper-build-stamp - dh_prep - dh_auto_install --destdir=debian/libmilib-java/ - mh_install - jh_installjavadoc - dh_installdocs - dh_installchangelogs - dh_perl - dh_link - jh_installlibs - jh_classpath - jh_manifest - jh_depends - dh_strip_nondeterminism - dh_compress - dh_fixperms - dh_missing - dh_installdeb - dh_gencontrol - dh_md5sums - dh_builddeb -dpkg-deb: building package 'libmilib-java' in '../libmilib-java_2.2.0+dfsg-1_all.deb'. - dpkg-genbuildinfo --build=binary -O../milib_2.2.0+dfsg-1_armhf.buildinfo - dpkg-genchanges --build=binary -O../milib_2.2.0+dfsg-1_armhf.changes -dpkg-genchanges: info: binary-only upload (no source code included) - dpkg-source --after-build . -dpkg-buildpackage: info: binary-only upload (no source included) -dpkg-genchanges: info: including full source code in upload +dh_auto_test: error: gradle --info --console plain --offline --stacktrace --no-daemon --refresh-dependencies --gradle-user-home .gradle -Duser.home=. -Duser.name=debian -Ddebian.package=milib -Dfile.encoding=UTF-8 --parallel --max-workers=4 test returned exit code 1 +make: *** [debian/rules:6: binary] Error 25 +dpkg-buildpackage: error: debian/rules binary subprocess returned exit status 2 I: copying local configuration +E: Failed autobuilding of package +I: user script /srv/workspace/pbuilder/28295/tmp/hooks/C01_cleanup starting +debug output: disk usage on i-capture-the-hostname at Fri Feb 9 18:30:39 UTC 2024 +Filesystem Size Used Avail Use% Mounted on +tmpfs 1.9G 0 1.9G 0% /dev/shm + +I: user script /srv/workspace/pbuilder/28295/tmp/hooks/C01_cleanup finished I: unmounting dev/ptmx filesystem I: unmounting dev/pts filesystem I: unmounting dev/shm filesystem I: unmounting proc filesystem I: unmounting sys filesystem I: cleaning the build env -I: removing directory /srv/workspace/pbuilder/10537 and its subdirectories -I: Current time: Fri Feb 9 05:30:25 -12 2024 -I: pbuilder-time-stamp: 1707499825 +I: removing directory /srv/workspace/pbuilder/28295 and its subdirectories