| Offset 1, 3 lines modified | Offset 1, 3 lines modified | ||
| 1 | ·f68d18f0204eb407e2b5a673767acf68·76098248·debug·optional·iqtree-dbgsym_2.0.7+dfsg-1_i386.deb | ||
| 2 | · | 1 | ·724780c656273a54dda7dd619edc7071·76069952·debug·optional·iqtree-dbgsym_2.0.7+dfsg-1_i386.deb |
| 2 | ·f0c010ca57ce74766dcb006117dcd26a·3335452·science·optional·iqtree_2.0.7+dfsg-1_i386.deb | ||
| Offset 1, 3 lines modified | Offset 1, 3 lines modified | ||
| 1 | -rw-r--r--···0········0········0········4·2022-01-21·11:05:21.000000·debian-binary | 1 | -rw-r--r--···0········0········0········4·2022-01-21·11:05:21.000000·debian-binary |
| 2 | -rw-r--r--···0········0········0·····1464·2022-01-21·11:05:21.000000·control.tar.xz | 2 | -rw-r--r--···0········0········0·····1464·2022-01-21·11:05:21.000000·control.tar.xz |
| 3 | -rw-r--r--···0········0········0··333 | 3 | -rw-r--r--···0········0········0··3333796·2022-01-21·11:05:21.000000·data.tar.xz |
| Offset 1, 12 lines modified | Offset 1, 12 lines modified | ||
| 1 | Package:·iqtree | 1 | Package:·iqtree |
| 2 | Version:·2.0.7+dfsg-1 | 2 | Version:·2.0.7+dfsg-1 |
| 3 | Architecture:·i386 | 3 | Architecture:·i386 |
| 4 | Maintainer:·Debian·Med·Packaging·Team·<debian-med-packaging@lists.alioth.debian.org> | 4 | Maintainer:·Debian·Med·Packaging·Team·<debian-med-packaging@lists.alioth.debian.org> |
| 5 | Installed-Size:·228 | 5 | Installed-Size:·22890 |
| 6 | Depends:·libc6·(>=·2.38),·libgcc-s1·(>=·4.2),·libgomp1·(>=·6),·libmpich12,·libstdc++6·(>=·14),·zlib1g·(>=·1:1.1.4) | 6 | Depends:·libc6·(>=·2.38),·libgcc-s1·(>=·4.2),·libgomp1·(>=·6),·libmpich12,·libstdc++6·(>=·14),·zlib1g·(>=·1:1.1.4) |
| 7 | Section:·science | 7 | Section:·science |
| 8 | Priority:·optional | 8 | Priority:·optional |
| 9 | Homepage:·http://www.cibiv.at/software/iqtree/ | 9 | Homepage:·http://www.cibiv.at/software/iqtree/ |
| 10 | Description:·efficient·phylogenetic·software·by·maximum·likelihood | 10 | Description:·efficient·phylogenetic·software·by·maximum·likelihood |
| 11 | ·IQ-TREE·is·a·very·efficient·maximum·likelihood·phylogenetic·software | 11 | ·IQ-TREE·is·a·very·efficient·maximum·likelihood·phylogenetic·software |
| 12 | ·with·following·key·features·among·others: | 12 | ·with·following·key·features·among·others: |
| Offset 1, 13 lines modified | Offset 1, 13 lines modified | ||
| 1 | drwxr-xr-x···0·root·········(0)·root·········(0)········0·2022-01-21·11:05:21.000000·./ | 1 | drwxr-xr-x···0·root·········(0)·root·········(0)········0·2022-01-21·11:05:21.000000·./ |
| 2 | drwxr-xr-x···0·root·········(0)·root·········(0)········0·2022-01-21·11:05:21.000000·./usr/ | 2 | drwxr-xr-x···0·root·········(0)·root·········(0)········0·2022-01-21·11:05:21.000000·./usr/ |
| 3 | drwxr-xr-x···0·root·········(0)·root·········(0)········0·2022-01-21·11:05:21.000000·./usr/bin/ | 3 | drwxr-xr-x···0·root·········(0)·root·········(0)········0·2022-01-21·11:05:21.000000·./usr/bin/ |
| 4 | -rwxr-xr-x···0·root·········(0)·root·········(0)··699 | 4 | -rwxr-xr-x···0·root·········(0)·root·········(0)··6994664·2022-01-21·11:05:21.000000·./usr/bin/iqtree2 |
| 5 | -rwxr-xr-x···0·root·········(0)·root·········(0)··701 | 5 | -rwxr-xr-x···0·root·········(0)·root·········(0)··7015144·2022-01-21·11:05:21.000000·./usr/bin/iqtree2-mpi |
| 6 | -rwxr-xr-x···0·root·········(0)·root·········(0)··699 | 6 | -rwxr-xr-x···0·root·········(0)·root·········(0)··6994664·2022-01-21·11:05:21.000000·./usr/bin/iqtree2-omp |
| 7 | drwxr-xr-x···0·root·········(0)·root·········(0)········0·2022-01-21·11:05:21.000000·./usr/share/ | 7 | drwxr-xr-x···0·root·········(0)·root·········(0)········0·2022-01-21·11:05:21.000000·./usr/share/ |
| 8 | drwxr-xr-x···0·root·········(0)·root·········(0)········0·2022-01-21·11:05:21.000000·./usr/share/doc/ | 8 | drwxr-xr-x···0·root·········(0)·root·········(0)········0·2022-01-21·11:05:21.000000·./usr/share/doc/ |
| 9 | drwxr-xr-x···0·root·········(0)·root·········(0)········0·2022-01-21·11:05:21.000000·./usr/share/doc/iqtree/ | 9 | drwxr-xr-x···0·root·········(0)·root·········(0)········0·2022-01-21·11:05:21.000000·./usr/share/doc/iqtree/ |
| 10 | -rw-r--r--···0·root·········(0)·root·········(0)······278·2022-01-21·11:05:21.000000·./usr/share/doc/iqtree/README.test | 10 | -rw-r--r--···0·root·········(0)·root·········(0)······278·2022-01-21·11:05:21.000000·./usr/share/doc/iqtree/README.test |
| 11 | -rw-r--r--···0·root·········(0)·root·········(0)······587·2022-01-21·11:05:21.000000·./usr/share/doc/iqtree/changelog.Debian.gz | 11 | -rw-r--r--···0·root·········(0)·root·········(0)······587·2022-01-21·11:05:21.000000·./usr/share/doc/iqtree/changelog.Debian.gz |
| 12 | -rw-r--r--···0·root·········(0)·root·········(0)·····7971·2022-01-21·11:05:21.000000·./usr/share/doc/iqtree/copyright | 12 | -rw-r--r--···0·root·········(0)·root·········(0)·····7971·2022-01-21·11:05:21.000000·./usr/share/doc/iqtree/copyright |
| 13 | drwxr-xr-x···0·root·········(0)·root·········(0)········0·2022-01-21·11:05:21.000000·./usr/share/doc/iqtree/examples/ | 13 | drwxr-xr-x···0·root·········(0)·root·········(0)········0·2022-01-21·11:05:21.000000·./usr/share/doc/iqtree/examples/ |
| Offset 4, 17 lines modified | Offset 4, 17 lines modified | ||
| 4 | ··Data:······························2's·complement,·little·endian | 4 | ··Data:······························2's·complement,·little·endian |
| 5 | ··Version:···························1·(current) | 5 | ··Version:···························1·(current) |
| 6 | ··OS/ABI:····························UNIX·-·GNU | 6 | ··OS/ABI:····························UNIX·-·GNU |
| 7 | ··ABI·Version:·······················0 | 7 | ··ABI·Version:·······················0 |
| 8 | ··Type:······························DYN·(Position-Independent·Executable·file) | 8 | ··Type:······························DYN·(Position-Independent·Executable·file) |
| 9 | ··Machine:···························Intel·80386 | 9 | ··Machine:···························Intel·80386 |
| 10 | ··Version:···························0x1 | 10 | ··Version:···························0x1 |
| 11 | ··Entry·point·address:···············0xe7 | 11 | ··Entry·point·address:···············0xe7e30 |
| 12 | ··Start·of·program·headers:··········52·(bytes·into·file) | 12 | ··Start·of·program·headers:··········52·(bytes·into·file) |
| 13 | ··Start·of·section·headers:··········69 | 13 | ··Start·of·section·headers:··········6993464·(bytes·into·file) |
| 14 | ··Flags:·····························0x0 | 14 | ··Flags:·····························0x0 |
| 15 | ··Size·of·this·header:···············52·(bytes) | 15 | ··Size·of·this·header:···············52·(bytes) |
| 16 | ··Size·of·program·headers:···········32·(bytes) | 16 | ··Size·of·program·headers:···········32·(bytes) |
| 17 | ··Number·of·program·headers:·········12 | 17 | ··Number·of·program·headers:·········12 |
| 18 | ··Size·of·section·headers:···········40·(bytes) | 18 | ··Size·of·section·headers:···········40·(bytes) |
| 19 | ··Number·of·section·headers:·········30 | 19 | ··Number·of·section·headers:·········30 |
| 20 | ··Section·header·string·table·index:·29 | 20 | ··Section·header·string·table·index:·29 |
| Offset 1, 27 lines modified | Offset 1, 27 lines modified | ||
| 1 | Elf·file·type·is·DYN·(Position-Independent·Executable·file) | 1 | Elf·file·type·is·DYN·(Position-Independent·Executable·file) |
| 2 | Entry·point·0xe7 | 2 | Entry·point·0xe7e30 |
| 3 | There·are·12·program·headers,·starting·at·offset·52 | 3 | There·are·12·program·headers,·starting·at·offset·52 |
| 4 | Program·Headers: | 4 | Program·Headers: |
| 5 | ··Type···········Offset···VirtAddr···PhysAddr···FileSiz·MemSiz··Flg·Align | 5 | ··Type···········Offset···VirtAddr···PhysAddr···FileSiz·MemSiz··Flg·Align |
| 6 | ··PHDR···········0x000034·0x00000034·0x00000034·0x00180·0x00180·R···0x4 | 6 | ··PHDR···········0x000034·0x00000034·0x00000034·0x00180·0x00180·R···0x4 |
| 7 | ··INTERP·········0x0001d8·0x000001d8·0x000001d8·0x00013·0x00013·R···0x1 | 7 | ··INTERP·········0x0001d8·0x000001d8·0x000001d8·0x00013·0x00013·R···0x1 |
| 8 | ······[Requesting·program·interpreter:·/lib/ld-linux.so.2] | 8 | ······[Requesting·program·interpreter:·/lib/ld-linux.so.2] |
| 9 | ··LOAD···········0x000000·0x00000000·0x00000000·0x7fba8·0x7fba8·R···0x1000 | 9 | ··LOAD···········0x000000·0x00000000·0x00000000·0x7fba8·0x7fba8·R···0x1000 |
| 10 | ··LOAD···········0x080000·0x00080000·0x00080000·0x49 | 10 | ··LOAD···········0x080000·0x00080000·0x00080000·0x492e68·0x492e68·R·E·0x1000 |
| 11 | ··LOAD···········0x51 | 11 | ··LOAD···········0x513000·0x00513000·0x00513000·0x17fecc·0x17fecc·R···0x1000 |
| 12 | ··LOAD···········0x69 | 12 | ··LOAD···········0x69316c·0x0069316c·0x0069316c·0x18330·0x24614·RW··0x1000 |
| 13 | ··DYNAMIC········0x69 | 13 | ··DYNAMIC········0x69a93c·0x0069a93c·0x0069a93c·0x00128·0x00128·RW··0x4 |
| 14 | ··NOTE···········0x0001b4·0x000001b4·0x000001b4·0x00024·0x00024·R···0x4 | 14 | ··NOTE···········0x0001b4·0x000001b4·0x000001b4·0x00024·0x00024·R···0x4 |
| 15 | ··NOTE···········0x69 | 15 | ··NOTE···········0x692eac·0x00692eac·0x00692eac·0x00020·0x00020·R···0x4 |
| 16 | ··GNU_EH_FRAME···0x5d | 16 | ··GNU_EH_FRAME···0x5d72f8·0x005d72f8·0x005d72f8·0x0de0c·0x0de0c·R···0x4 |
| 17 | ··GNU_STACK······0x000000·0x00000000·0x00000000·0x00000·0x00000·RW··0x10 | 17 | ··GNU_STACK······0x000000·0x00000000·0x00000000·0x00000·0x00000·RW··0x10 |
| 18 | ··GNU_RELRO······0x69 | 18 | ··GNU_RELRO······0x69316c·0x0069316c·0x0069316c·0x07e94·0x07e94·R···0x1 |
| 19 | ·Section·to·Segment·mapping: | 19 | ·Section·to·Segment·mapping: |
| 20 | ··Segment·Sections... | 20 | ··Segment·Sections... |
| 21 | ···00····· | 21 | ···00····· |
| 22 | ···01·····.interp· | 22 | ···01·····.interp· |
| 23 | ···02·····.note.gnu.build-id·.interp·.gnu.hash·.dynsym·.dynstr·.gnu.version·.gnu.version_r·.rel.dyn·.rel.plt· | 23 | ···02·····.note.gnu.build-id·.interp·.gnu.hash·.dynsym·.dynstr·.gnu.version·.gnu.version_r·.rel.dyn·.rel.plt· |
| 24 | ···03·····.init·.plt·.plt.got·.text·.fini· | 24 | ···03·····.init·.plt·.plt.got·.text·.fini· |
| Offset 1, 8 lines modified | Offset 1, 8 lines modified | ||
| 1 | There·are·30·section·headers,·starting·at·offset·0x6a | 1 | There·are·30·section·headers,·starting·at·offset·0x6ab638: |
| 2 | Section·Headers: | 2 | Section·Headers: |
| 3 | ··[Nr]·Name··············Type············Addr·····Off····Size···ES·Flg·Lk·Inf·Al | 3 | ··[Nr]·Name··············Type············Addr·····Off····Size···ES·Flg·Lk·Inf·Al |
| 4 | ··[·0]···················NULL············00000000·000000·000000·00······0···0··0 | 4 | ··[·0]···················NULL············00000000·000000·000000·00······0···0··0 |
| 5 | ··[·1]·.note.gnu.build-id·NOTE············000001b4·0001b4·000024·00···A··0···0··4 | 5 | ··[·1]·.note.gnu.build-id·NOTE············000001b4·0001b4·000024·00···A··0···0··4 |
| 6 | ··[·2]·.interp···········PROGBITS········000001d8·0001d8·000013·00···A··0···0··1 | 6 | ··[·2]·.interp···········PROGBITS········000001d8·0001d8·000013·00···A··0···0··1 |
| 7 | ··[·3]·.gnu.hash·········GNU_HASH········000001ec·0001ec·00abb8·04···A··4···0··4 | 7 | ··[·3]·.gnu.hash·········GNU_HASH········000001ec·0001ec·00abb8·04···A··4···0··4 |
| Offset 11, 29 lines modified | Offset 11, 29 lines modified | ||
| 11 | ··[·6]·.gnu.version······VERSYM··········0006fec2·06fec2·0030a4·02···A··4···0··2 | 11 | ··[·6]·.gnu.version······VERSYM··········0006fec2·06fec2·0030a4·02···A··4···0··2 |
| 12 | ··[·7]·.gnu.version_r····VERNEED·········00072f68·072f68·0002e0·00···A··5···5··4 | 12 | ··[·7]·.gnu.version_r····VERNEED·········00072f68·072f68·0002e0·00···A··5···5··4 |
| 13 | ··[·8]·.rel.dyn··········REL·············00073248·073248·00c048·08···A··4···0··4 | 13 | ··[·8]·.rel.dyn··········REL·············00073248·073248·00c048·08···A··4···0··4 |
| 14 | ··[·9]·.rel.plt··········REL·············0007f290·07f290·000918·08··AI··4··24··4 | 14 | ··[·9]·.rel.plt··········REL·············0007f290·07f290·000918·08··AI··4··24··4 |
| 15 | ··[10]·.init·············PROGBITS········00080000·080000·000020·00··AX··0···0··4 | 15 | ··[10]·.init·············PROGBITS········00080000·080000·000020·00··AX··0···0··4 |
| 16 | ··[11]·.plt··············PROGBITS········00080020·080020·001240·04··AX··0···0·16 | 16 | ··[11]·.plt··············PROGBITS········00080020·080020·001240·04··AX··0···0·16 |
| 17 | ··[12]·.plt.got··········PROGBITS········00081260·081260·000018·08··AX··0···0··8 | 17 | ··[12]·.plt.got··········PROGBITS········00081260·081260·000018·08··AX··0···0··8 |
| 18 | ··[13]·.text·············PROGBITS········00081280·081280·49 | 18 | ··[13]·.text·············PROGBITS········00081280·081280·491bd4·00··AX··0···0·64 |
| 19 | ··[14]·.fini·············PROGBITS········0051 | 19 | ··[14]·.fini·············PROGBITS········00512e54·512e54·000014·00··AX··0···0··4 |
| 20 | ··[15]·.rodata···········PROGBITS········0051 | 20 | ··[15]·.rodata···········PROGBITS········00513000·513000·0c42f8·00···A··0···0·32 |
| 21 | ··[16]·.eh_frame_hdr·····PROGBITS········005d | 21 | ··[16]·.eh_frame_hdr·····PROGBITS········005d72f8·5d72f8·00de0c·00···A··0···0··4 |
| 22 | ··[17]·.eh_frame·········PROGBITS········005e | 22 | ··[17]·.eh_frame·········PROGBITS········005e5104·5e5104·08f8b0·00···A··0···0··4 |
| 23 | ··[18]·.gcc_except_table·PROGBITS········0067 | 23 | ··[18]·.gcc_except_table·PROGBITS········006749b4·6749b4·01e4f5·00···A··0···0··4 |
| 24 | ··[19]·.note.ABI-tag·····NOTE············0069 | 24 | ··[19]·.note.ABI-tag·····NOTE············00692eac·692eac·000020·00···A··0···0··4 |
| 25 | ··[20]·.init_array·······INIT_ARRAY······0069 | 25 | ··[20]·.init_array·······INIT_ARRAY······0069316c·69316c·000030·04··WA··0···0··4 |
| 26 | ··[21]·.fini_array·······FINI_ARRAY······0069 | 26 | ··[21]·.fini_array·······FINI_ARRAY······0069319c·69319c·000004·04··WA··0···0··4 |
| 27 | ··[22]·.data.rel.ro······PROGBITS········0069 | 27 | ··[22]·.data.rel.ro······PROGBITS········006931a0·6931a0·00779c·00··WA··0···0·32 |
| 28 | ··[23]·.dynamic··········DYNAMIC·········0069 | 28 | ··[23]·.dynamic··········DYNAMIC·········0069a93c·69a93c·000128·08··WA··5···0··4 |
| 29 | ··[24]·.got··············PROGBITS········0069 | 29 | ··[24]·.got··············PROGBITS········0069aa64·69aa64·000580·04··WA··0···0··4 |
| 30 | ··[25]·.data·············PROGBITS········0069 | 30 | ··[25]·.data·············PROGBITS········0069b000·69b000·01049c·00··WA··0···0·32 |
| 31 | ··[26]·.bss··············NOBITS··········006a | 31 | ··[26]·.bss··············NOBITS··········006ab4a0·6ab49c·00c2e0·00··WA··0···0·32 |
| 32 | ··[27]·.gnu_debugaltlink·PROGBITS········00000000·6a | 32 | ··[27]·.gnu_debugaltlink·PROGBITS········00000000·6ab49c·000044·00······0···0··1 |
| 33 | ··[28]·.gnu_debuglink····PROGBITS········00000000·6a | 33 | ··[28]·.gnu_debuglink····PROGBITS········00000000·6ab4e0·000034·00······0···0··4 |
| 34 | ··[29]·.shstrtab·········STRTAB··········00000000·6a | 34 | ··[29]·.shstrtab·········STRTAB··········00000000·6ab514·000123·00······0···0··1 |
| 35 | Key·to·Flags: | 35 | Key·to·Flags: |
| 36 | ··W·(write),·A·(alloc),·X·(execute),·M·(merge),·S·(strings),·I·(info), | 36 | ··W·(write),·A·(alloc),·X·(execute),·M·(merge),·S·(strings),·I·(info), |
| 37 | ··L·(link·order),·O·(extra·OS·processing·required),·G·(group),·T·(TLS), | 37 | ··L·(link·order),·O·(extra·OS·processing·required),·G·(group),·T·(TLS), |
| 38 | ··C·(compressed),·x·(unknown),·o·(OS·specific),·E·(exclude), | 38 | ··C·(compressed),·x·(unknown),·o·(OS·specific),·E·(exclude), |
| 39 | ··R·(retain),·D·(mbind),·p·(processor·specific) | 39 | ··R·(retain),·D·(mbind),·p·(processor·specific) |
| Offset 360, 5870 lines modified | Offset 360, 5870 lines modified | ||
| 360 | ···356:·00000000·····0·FUNC····GLOBAL·DEFAULT··UND·_ZNKSt7__cxx1112basic_stringIcSt11char_traitsIcESaIcEE16find_last_not_ofEPKcjj@GLIBCXX_3.4.21·(5) | 360 | ···356:·00000000·····0·FUNC····GLOBAL·DEFAULT··UND·_ZNKSt7__cxx1112basic_stringIcSt11char_traitsIcESaIcEE16find_last_not_ofEPKcjj@GLIBCXX_3.4.21·(5) |
| 361 | ···357:·00000000·····0·FUNC····GLOBAL·DEFAULT··UND·_ZNSt7__cxx1112basic_stringIcSt11char_traitsIcESaIcEE9_M_mutateEjjPKcj@GLIBCXX_3.4.21·(5) | 361 | ···357:·00000000·····0·FUNC····GLOBAL·DEFAULT··UND·_ZNSt7__cxx1112basic_stringIcSt11char_traitsIcESaIcEE9_M_mutateEjjPKcj@GLIBCXX_3.4.21·(5) |
| 362 | ···358:·00000000·····0·FUNC····GLOBAL·DEFAULT··UND·__isoc23_strtol@GLIBC_2.38·(14) | 362 | ···358:·00000000·····0·FUNC····GLOBAL·DEFAULT··UND·__isoc23_strtol@GLIBC_2.38·(14) |
| 363 | ···359:·00000000·····0·FUNC····GLOBAL·DEFAULT··UND·realloc@GLIBC_2.0·(4) | 363 | ···359:·00000000·····0·FUNC····GLOBAL·DEFAULT··UND·realloc@GLIBC_2.0·(4) |
| 364 | ···360:·00000000·····0·FUNC····GLOBAL·DEFAULT··UND·fopen@GLIBC_2.1·(10) | 364 | ···360:·00000000·····0·FUNC····GLOBAL·DEFAULT··UND·fopen@GLIBC_2.1·(10) |
| 365 | ···361:·00000000·····0·FUNC····GLOBAL·DEFAULT··UND·_ZNSt6localeC1Ev@GLIBCXX_3.4·(3) | 365 | ···361:·00000000·····0·FUNC····GLOBAL·DEFAULT··UND·_ZNSt6localeC1Ev@GLIBCXX_3.4·(3) |
| 366 | ···362:·00000000·····0·FUNC····GLOBAL·DEFAULT··UND·ftell@GLIBC_2.0·(4) | 366 | ···362:·00000000·····0·FUNC····GLOBAL·DEFAULT··UND·ftell@GLIBC_2.0·(4) |
| 367 | ···363:·003d2 | 367 | ···363:·003d2a00····71·FUNC····GLOBAL·DEFAULT···13·_ZN8RateFree9meanRatesEv |
| 368 | ···364:·004aad | 368 | ···364:·004aadf0····37·FUNC····GLOBAL·DEFAULT···13·_ZN10Checkpoint11setFileNameENSt7__cxx1112basic_stringIcSt11char_traitsIcESaIcEEE |
| 369 | ···365:·0038f9 | 369 | ···365:·0038f9e0···792·FUNC····GLOBAL·DEFAULT···13·bitVectorInitravSpecial |
| 370 | ···366:·00187 | 370 | ···366:·00187810··1892·FUNC····GLOBAL·DEFAULT···13·_ZN6IQTreeD2Ev |
| 371 | ···367:·004051 | 371 | ···367:·004051a0····42·FUNC····GLOBAL·DEFAULT···13·_ZTv0_n188_N16ModelPoMoMixture9writeInfoERSo |
| 372 | ···368:·0016e4 | 372 | ···368:·0016e4e0··1025·FUNC····WEAK···DEFAULT···13·_ZNSt6vectorIxSaIxEE14_M_fill_insertEN9__gnu_cxx17__normal_iteratorIPxS1_EEjRKx |
| 373 | ···369:·00398a | 373 | ···369:·00398ad0···959·FUNC····GLOBAL·DEFAULT···13·makenewzGeneric |
| 374 | ···370:·002710 | 374 | ···370:·00271080··2196·FUNC····WEAK···DEFAULT···13·_ZN9PhyloTree38computeLikelihoodFromBufferGenericSIMDI5Vec2dLb0ELb1EEEdv |
| 375 | ···371:·003554 | 375 | ···371:·00355480·····1·FUNC····GLOBAL·DEFAULT···13·_ZN22PhyloSuperTreeUnlinked8mapTreesEv |
| 376 | ···372:·003179 | 376 | ···372:·003179f0··5548·FUNC····GLOBAL·DEFAULT···13·_ZN9PDNetwork13findPDArea_LPER6ParamsRSt6vectorI8SplitSetSaIS3_EE |
| 377 | ···373:·004ef | 377 | ···373:·004efd60···172·FUNC····GLOBAL·DEFAULT···13·_ZN8NxsTokenC2ERSi |
| 378 | ···374:·00245e | 378 | ···374:·00245e80··4134·FUNC····GLOBAL·DEFAULT···13·_Z18doKmeansClusteringR6ParamsP14PhyloSuperTreeiRSt6vectorIdSaIdEER15ModelCheckpointP11ModelsBlockiRS3_ISt3setIiSt4lessIiESaIiEESaISF_EERS3_INSt7__cxx1112basic_stringIcSt11char_traitsIcESaIcEEESaISO_EE |
| 379 | ···375:·00337 | 379 | ···375:·00337a20···121·FUNC····GLOBAL·DEFAULT···13·_ZN6PDTreeC1ERS_ |
| 380 | ···376:·001b47 | 380 | ···376:·001b47e0···552·FUNC····WEAK···DEFAULT···13·_ZNSt6vectorIS_IP4NodeSaIS1_EESaIS3_EE17_M_realloc_appendIJRKS3_EEEvDpOT_ |
| 381 | ···377:·006a | 381 | ···377:·006ac628·····8·OBJECT··UNIQUE·DEFAULT···26·_ZGVZN4YAML3Exp8EscBreakEvE1e |
| 382 | ···378:·0050 | 382 | ···378:·005055b0···592·FUNC····GLOBAL·DEFAULT···13·_ZN8terraces15bad_input_errorC1ENS_20bad_input_error_typeENSt7__cxx1112basic_stringIcSt11char_traitsIcESaIcEEE |
| 383 | ···379:·003be | 383 | ···379:·003bee60····58·FUNC····GLOBAL·DEFAULT···13·_ZN18PartitionModelPlenC2ER6ParamsP18PhyloSuperTreePlenP11ModelsBlock |
| 384 | ···380:·0019a | 384 | ···380:·0019ad70···408·FUNC····GLOBAL·DEFAULT···13·_ZN5MTreeC1ERS_ |
| 385 | ···381:·00155 | 385 | ···381:·00155f50···407·FUNC····WEAK···DEFAULT···13·_ZNSt8_Rb_treeINSt7__cxx1112basic_stringIcSt11char_traitsIcESaIcEEESt4pairIKS5_dESt10_Select1stIS8_ESt4lessIS5_ESaIS8_EE16_M_insert_uniqueIS8_EES6_ISt17_Rb_tree_iteratorIS8_EbEOT_ |
| 386 | ···382:·001c5 | 386 | ···382:·001c5430···185·FUNC····GLOBAL·DEFAULT···13·_ZN18PhyloSuperTreePlen11linkCheckReEiP4NodeS1_P13PhyloNeighborS3_ |
| 387 | ···383:·001f0 | 387 | ···383:·001f0870···141·FUNC····GLOBAL·DEFAULT···13·_ZN12outstreambuf5closeEv |
| 388 | ···384:·002a2f | 388 | ···384:·002a2fa0··1123·FUNC····WEAK···DEFAULT···13·_ZN9PhyloTree27computeLikelihoodBufferSIMDI5Vec2dLb0ELi4ELb0ELb1EEEvP13PhyloNeighborP9PhyloNodejji |
| 389 | ···385:·004f6 | 389 | ···385:·004f6f80···734·FUNC····GLOBAL·DEFAULT···13·_ZN8terraces31maximum_comprehensive_columnsetERKNS_9bitmatrixE |
| 390 | ···386:·003422 | 390 | ···386:·003422a0····59·FUNC····GLOBAL·DEFAULT···13·_ZN12MSplitsBlock5ResetEv |
| 391 | ···387:·0069 | 391 | ···387:·00693ce8···120·OBJECT··WEAK···DEFAULT···22·_ZTV9Alignment |
| 392 | ···388:·004d38 | 392 | ···388:·004d38a0···154·FUNC····GLOBAL·DEFAULT···13·_ZN19NxsAssumptionsBlockD2Ev |
| 393 | ···389:·0050 | 393 | ···389:·0050f370···681·FUNC····GLOBAL·DEFAULT···13·_ZN8terraces14print_tree_dotERKSt6vectorINS_4nodeESaIS1_EERKS0_INSt7__cxx1112basic_stringIcSt11char_traitsIcESaIcEEESaISB_EERSob |
| 394 | ···390:·0045b | 394 | ···390:·0045b900····98·FUNC····GLOBAL·DEFAULT···13·_ZN11ModelUnrest9setBoundsEPdS0_Pb |
| 395 | ···391:·001546 | 395 | ···391:·001546c0···394·FUNC····WEAK···DEFAULT···13·_Z9quicksortIdiEvPT_iiPT0_ |
| 396 | ···392:·00348 | 396 | ···392:·00348e20···848·FUNC····GLOBAL·DEFAULT···13·FixDistance |
| 397 | ···393:·0019c | 397 | ···393:·0019ce10···463·FUNC····GLOBAL·DEFAULT···13·_ZN5MTree19getPreOrderBranchesERSt6vectorIP4NodeSaIS2_EES5_S2_S2_ |
| 398 | ···394:·00176 | 398 | ···394:·00176c70····82·FUNC····GLOBAL·DEFAULT···13·_ZN6IQTree12getBestTreesB5cxx11Ei |
| 399 | ···395:·00454 | 399 | ···395:·00454b00···119·FUNC····WEAK···DEFAULT···13·_ZN8ModelDNAD1Ev |
| 400 | ···396:·0047af | 400 | ···396:·0047aff0···269·FUNC····WEAK···DEFAULT···13·_ZN5Eigen8internal21dense_assignment_loopINS0_31generic_dense_assignment_kernelINS0_9evaluatorINS_6MatrixISt7complexIdELi4ELi4ELi0ELi4ELi4EEEEENS3_INS_7ProductINS9_INS_3MapIS7_Li16ENS_6StrideILi0ELi0EEEEENS4_IdLi4ELi4ELi0ELi4ELi4EEELi0EEESD_Li1EEEEENS0_9assign_opIS6_S6_EELi0EEELi2ELi0EE3runERSK_ |
| 401 | ···397:·0038ac | 401 | ···397:·0038acf0····72·FUNC····GLOBAL·DEFAULT···13·getUndetermined |
| 402 | ···398:·004d2b | 402 | ···398:·004d2bf0··1363·FUNC····WEAK···DEFAULT···13·_ZNSt6vectorI7PatternSaIS0_EE14_M_fill_insertEN9__gnu_cxx17__normal_iteratorIPS0_S2_EEjRKS0_ |
| 403 | ···399:·003c07 | 403 | ···399:·003c07c0···115·FUNC····GLOBAL·DEFAULT···13·_ZN9RateGamma9setBoundsEPdS0_Pb |
| 404 | ···400:·005c | 404 | ···400:·005c2c90····10·OBJECT··WEAK···DEFAULT···15·_ZTS8MyReader |
| 405 | ···401:·005c | 405 | ···401:·005cdec8····11·OBJECT··WEAK···DEFAULT···15·_ZTS9SuperNode |
| 406 | ···402:·002fe8 | 406 | ···402:·002fe8c0···370·FUNC····GLOBAL·DEFAULT···13·sample_from_counts |
| 407 | ···403:·00151 | 407 | ···403:·00151a60····20·FUNC····WEAK···DEFAULT···13·_ZN9PhyloTree14getAlnNPatternEv |
| 408 | ···404:·004b0 | 408 | ···404:·004b0c00·····1·FUNC····GLOBAL·DEFAULT···13·_ZN9MPIHelper8finalizeEv | Diff chunk too large, falling back to line-by-line diff (605 lines added, 605 lines removed) |
| 409 | ···405:·0008a2a0···135·FUNC····WEAK···DEFAULT···13·_ZN5boost15throw_exceptionISt14overflow_errorEEvRKT_ | 409 | ···405:·0008a2a0···135·FUNC····WEAK···DEFAULT···13·_ZN5boost15throw_exceptionISt14overflow_errorEEvRKT_ |
| 410 | ···406:·001b62 | 410 | ···406:·001b62c0···642·FUNC····GLOBAL·DEFAULT···13·_ZN13PhyloNeighbor21clearForwardPartialLhEP4Node |
| 411 | ···407:·0041a | 411 | ···407:·0041a460··6713·FUNC····GLOBAL·DEFAULT···13·_ZN11ModelMarkov25decomposeRateMatrixNonrevEv |
| 412 | ···408:·00385 | 412 | ···408:·00385370···526·FUNC····GLOBAL·DEFAULT···13·testInsertRestoreBIG |
| 413 | ···409:·003138 | 413 | ···409:·00313880···248·FUNC····GLOBAL·DEFAULT···13·_ZN9PDNetwork12readRootNodeEPKc |
| 414 | ···410:·0069 | 414 | ···410:·006955d0·····8·OBJECT··WEAK···DEFAULT···22·_ZTINSt3tr18__detail12_Rehash_baseINS0_20_Prime_rehash_policyENS_10_HashtableINSt7__cxx1112basic_stringIcSt11char_traitsIcESaIcEEESt4pairIKS9_8NxsModelESaISD_ESt10_Select1stISD_ESt8equal_toIS9_ENS_4hashIS9_EENS0_18_Mod_range_hashingENS0_20_Default_ranged_hashES2_Lb0ELb0ELb1EEEEE |
| 415 | ···411:·003b60 | 415 | ···411:·003b60f0····64·FUNC····WEAK···DEFAULT···13·_ZN12ModelProteinD1Ev |
| 416 | ···412:·00179 | 416 | ···412:·00179e70··1963·FUNC····GLOBAL·DEFAULT···13·_ZN6IQTree15saveCurrentTreeEd |
| 417 | ···413:·006a | 417 | ···413:·006ace50·····4·OBJECT··GLOBAL·DEFAULT···26·seqData |
| 418 | ···414:·00455 | 418 | ···414:·00455370····71·FUNC····GLOBAL·DEFAULT···13·_ZN10ModelCodon8initGY94Eb15CodonKappaStyle |
| 419 | ···415:·0023a4 | 419 | ···415:·0023a4c0···429·FUNC····GLOBAL·DEFAULT···13·_ZN14CandidateModel21evaluateConcatenationB5cxx11ER6ParamsP14SuperAlignmentR15ModelCheckpointP11ModelsBlocki |
| 420 | ···416:·00121 | 420 | ···416:·00121350····91·FUNC····WEAK···DEFAULT···13·_ZThn4_N5boost10wrapexceptISt14overflow_errorED1Ev |
| 421 | ···417:·00130 | 421 | ···417:·00130400····99·FUNC····GLOBAL·DEFAULT···13·_ZN9PhyloTree27computeLikelihoodZeroBranchEP13PhyloNeighborP9PhyloNode |
| 422 | ···418:·00121 | 422 | ···418:·00121a30···103·FUNC····WEAK···DEFAULT···13·_ZThn12_N5boost10wrapexceptISt12domain_errorED0Ev |
| 423 | ···419:·004bd9 | 423 | ···419:·004bd9c0···916·FUNC····GLOBAL·DEFAULT···13·_ZN17AlignmentPairwiseC2EP9PhyloTreeii |
| 424 | ···420:·0033 | 424 | ···420:·0033a000··1028·FUNC····GLOBAL·DEFAULT···13·_ZN6PDTree21calcPDComplementarityERSt6vectorI9PDTaxaSetSaIS1_EEPcRS0_IdSaIdEE |
| 425 | ···421:·0069 | 425 | ···421:·00693a5c····52·OBJECT··WEAK···DEFAULT···22·_ZTV9NxsReader |
| 426 | ···422:·0069 | 426 | ···422:·00693e58····24·OBJECT··WEAK···DEFAULT···22·_ZTISt6vectorIjSaIjEE |
| 427 | ···423:·005c | 427 | ···423:·005ce574····25·OBJECT··WEAK···DEFAULT···15·_ZTSN4YAML15ParserExceptionE |
| 428 | ···424:·0038 | 428 | ···424:·0038b000····85·FUNC····GLOBAL·DEFAULT···13·hookup |
| 429 | ···425:·0013bd | 429 | ···425:·0013bd80··1269·FUNC····GLOBAL·DEFAULT···13·_Z27Statistics_To_Probabilitiesd |
| 430 | ···426:·0069 | 430 | ···426:·00695628·····8·OBJECT··WEAK···DEFAULT···22·_ZTI8NxsModel |
| 431 | ···427:·0045c | 431 | ···427:·0045cb10···199·FUNC····GLOBAL·DEFAULT···13·_ZN14ModelLieMarkov12setVariablesEPd |
| 432 | ···428:·00139d | 432 | ···428:·00139db0···237·FUNC····GLOBAL·DEFAULT···13·_ZN9PhyloTree14computeObsDistEPd |
| 433 | ···429:·003d2 | 433 | ···429:·003d2f40···386·FUNC····GLOBAL·DEFAULT···13·_ZN8RateFree9setBoundsEPdS0_Pb |
| 434 | ···430:·004bb | 434 | ···430:·004bb620···121·FUNC····GLOBAL·DEFAULT···13·free_rng |
| 435 | ···431:·003c8 | 435 | ···431:·003c8f10····21·FUNC····GLOBAL·DEFAULT···13·_ZTvn4_n56_N9RateInvar14saveCheckpointEv |
| 436 | ···432:·0069 | 436 | ···432:·0069a900····20·OBJECT··WEAK···DEFAULT···22·_ZTVN8terraces15bad_input_errorE |
| 437 | ···433:·0047b | 437 | ···433:·0047b100····67·FUNC····WEAK···DEFAULT···13·_ZN5Eigen8internal19gemm_blocking_spaceILi0EddLin1ELi4ELin1ELi4ELb0EED1Ev |
| 438 | ···434:·00427 | 438 | ···434:·00427c20···851·FUNC····WEAK···DEFAULT···13·_ZN5Eigen15PlainObjectBaseINS_6MatrixIdLin1ELin1ELi0ELin1ELin1EEEEC2INS_13CwiseBinaryOpINS_8internal13scalar_sum_opIddEEKS2_S9_EEEERKNS_9DenseBaseIT_EE |
| 439 | ···435:·004c66 | 439 | ···435:·004c66c0··1901·FUNC····GLOBAL·DEFAULT···13·_ZN14SuperAlignment16removePartitionsERSt3setIiSt4lessIiESaIiEE |
| 440 | ···436:·003d3 | 440 | ···436:·003d3760···126·FUNC····GLOBAL·DEFAULT···13·_ZN8RateFree12getVariablesEPd |
| 441 | ···437:·003d94 | 441 | ···437:·003d9490···679·FUNC····GLOBAL·DEFAULT···13·_ZN15RateHeterotachy9writeInfoERSo |
| 442 | ···438:·0019e | 442 | ···438:·0019eb20···993·FUNC····GLOBAL·DEFAULT···13·_ZN5MTree9printTaxaEPKc |
| 443 | ···439:·00195 | 443 | ···439:·00195970···137·FUNC····GLOBAL·DEFAULT···13·_ZN5MTree17countZeroBranchesEP4NodeS1_d |
| 444 | ···440:·00444 | 444 | ···440:·00444360···406·FUNC····WEAK···DEFAULT···13·_ZN5Eigen8internal20generic_product_implINS_3RefINS_6MatrixIdLin1ELin1ELi0ELin1ELin1EEELi0ENS_11OuterStrideILin1EEEEEKNS_5BlockIKS7_Lin1ELi1ELb1EEENS_10DenseShapeESC_Li7EE13scaleAndAddToINS8_IS7_Lin1ELi1ELb1EEEEEvRT_RS9_RSB_RKd |
| 445 | ···441:·004d28 | 445 | ···441:·004d28d0···146·FUNC····GLOBAL·DEFAULT···13·_ZN22SuperAlignmentUnlinked12computeConstER7Pattern |
| 446 | ···442:·001848 | 446 | ···442:·001848c0···777·FUNC····GLOBAL·DEFAULT···13·_ZN6IQTree11doNNISearchEb |
| 447 | ···443:·0069 | 447 | ···443:·006944b8····12·OBJECT··WEAK···DEFAULT···22·_ZTI6IQTree |
| 448 | ···444:·00384 | 448 | ···444:·00384850···867·FUNC····GLOBAL·DEFAULT···13·testInsertBIG |
| 449 | ···445:·003c4 | 449 | ···445:·003c4d60····18·FUNC····GLOBAL·DEFAULT···13·_ZTv0_n80_N14RateGammaInvar12setNCategoryEi |
| 450 | ···446:·004d0 | 450 | ···446:·004d0750····57·FUNC····WEAK···DEFAULT···13·_ZNSt3tr110_HashtableINSt7__cxx1112basic_stringIcSt11char_traitsIcESaIcEEES6_SaIS6_ESt9_IdentityIS6_ESt8equal_toIS6_ENS_4hashIS6_EENS_8__detail18_Mod_range_hashingENSE_20_Default_ranged_hashENSE_20_Prime_rehash_policyELb0ELb1ELb1EED2Ev |
| 451 | ···447:·003b6 | 451 | ···447:·003b6130····67·FUNC····WEAK···DEFAULT···13·_ZThn4_N12ModelProteinD1Ev |
| 452 | ···448:·004d1 | 452 | ···448:·004d1420····47·FUNC····GLOBAL·DEFAULT···13·_ZN26SuperAlignmentPairwisePlenD1Ev |
| 453 | ···449:·003d8 | 453 | ···449:·003d8520····21·FUNC····WEAK···DEFAULT···13·_ZTv0_n92_N13RateFreeInvar7getRateEi |
| 454 | ···450:·004d25 | 454 | ···450:·004d25f0····79·FUNC····GLOBAL·DEFAULT···13·_ZN22SuperAlignmentUnlinkedC1ER6Params |
| 455 | ···451:·003c7 | 455 | ···451:·003c7330···185·FUNC····WEAK···DEFAULT···13·_ZTv0_n48_N14RateGammaInvarD0Ev |
| 456 | ···452:·00486 | 456 | ···452:·00486a00··2236·FUNC····GLOBAL·DEFAULT···13·_ZN12Optimization6lbfgsbEiiPdS0_S0_PiS0_S1_ddS1_S1_iPcii |
| 457 | ···453:·002abf | 457 | ···453:·002abf80··1630·FUNC····WEAK···DEFAULT···13·_ZN9PhyloTree27computeLikelihoodBufferSIMDI5Vec2dLb0ELi4ELb0ELb0EEEvP13PhyloNeighborP9PhyloNodejji |
| 458 | ···454:·000f3 | 458 | ···454:·000f3b10···861·FUNC····GLOBAL·DEFAULT···13·_ZN9AlignmentC1Ev |
| 459 | ···455:·002fe | 459 | ···455:·002fe560····53·FUNC····GLOBAL·DEFAULT···13·unif |
| 460 | ···456:·000f8 | 460 | ···456:·000f8860···143·FUNC····GLOBAL·DEFAULT···13·_ZN9Alignment14getPatternFreqERSt6vectorIiSaIiEE |
| 461 | ···457:·0044 | 461 | ···457:·00449000··3602·FUNC····WEAK···DEFAULT···13·_ZNK5Eigen19HouseholderSequenceINS_6MatrixIdLin1ELin1ELi0ELin1ELin1EEENS1_IdLin1ELi1ELi0ELin1ELi1EEELi1EE6evalToIS2_S3_EEvRT_RT0_ |
| 462 | ···458:·0014f3 | 462 | ···458:·0014f3e0···890·FUNC····GLOBAL·DEFAULT···13·_ZN9PhyloTreeC1Ev |
| 463 | ···459:·004d3a | 463 | ···459:·004d3aa0··3768·FUNC····GLOBAL·DEFAULT···13·_ZN19NxsAssumptionsBlock6ReportERSo |
| 464 | ···460:·002d82 | 464 | ···460:·002d82c0··1079·FUNC····GLOBAL·DEFAULT···13·_ZN4YAML4LoadERKNSt7__cxx1112basic_stringIcSt11char_traitsIcESaIcEEE |
| 465 | ···461:·001219 | 465 | ···461:·001219c0···101·FUNC····WEAK···DEFAULT···13·_ZThn4_N5boost10wrapexceptISt12domain_errorED0Ev |
| 466 | ···462:·00442 | 466 | ···462:·00442820··2599·FUNC····WEAK···DEFAULT···13·_ZN5Eigen8internal40make_block_householder_triangular_factorINS_6MatrixIdLin1ELin1ELi1ELin1ELin1EEENS_5BlockINS2_IdLin1ELin1ELi0ELin1ELin1EEELin1ELin1ELb0EEENS4_IKNS2_IdLin1ELi1ELi0ELin1ELi1EEELin1ELi1ELb0EEEEEvRT_RKT0_RKT1_ |
| 467 | ···463:·0018d | 467 | ···463:·0018d620···101·FUNC····WEAK···DEFAULT···13·_ZSteqIcSt11char_traitsIcESaIcEEbRKNSt7__cxx1112basic_stringIT_T0_T1_EEPKS5_ |
| 468 | ···464:·002c3a | 468 | ···464:·002c3a80··4598·FUNC····WEAK···DEFAULT···13·_ZN9PhyloTree25computeLikelihoodDervSIMDI5Vec2dLb1ELi20ELb0ELb1EEEvP13PhyloNeighborP9PhyloNodePdS6_ |
| 469 | ···465:·004e8b | 469 | ···465:·004e8bd0·····1·FUNC····GLOBAL·DEFAULT···13·_ZN9NxsReader13OutputCommentERK9NxsString |
| 470 | ···466:·0013e | 470 | ···466:·0013e450··3256·FUNC····GLOBAL·DEFAULT···13·_ZN9PhyloTree20computeTraversalInfoEP13PhyloNeighborP9PhyloNodeRPd |
| 471 | ···467:·003b6d | 471 | ···467:·003b6d90····41·FUNC····GLOBAL·DEFAULT···13·_ZN8ModelSet16computeTransDervEdPdS0_S0_i |
| 472 | ···468:·00376d | 472 | ···468:·00376d90··1460·FUNC····GLOBAL·DEFAULT···13·newviewAncestralIterative |
| 473 | ···469:·003e76 | 473 | ···469:·003e76a0····18·FUNC····GLOBAL·DEFAULT···13·_ZTv0_n288_N9ModelPoMo9setBoundsEPdS0_Pb |
| 474 | ···470:·0040 | 474 | ···470:·00403000···910·FUNC····WEAK···DEFAULT···13·_ZN5Eigen8internal20generic_product_implINS_6MatrixIdLin1ELin1ELi1ELin1ELin1EEES3_NS_10DenseShapeES4_Li8EE13scaleAndAddToINS2_IdLin1ELin1ELi0ELin1ELin1EEEEEvRT_RKS3_SB_RKd |
| 475 | ···471:·003dbc | 475 | ···471:·003dbce0·····3·FUNC····GLOBAL·DEFAULT···13·_ZTv0_n92_N20RateHeterotachyInvar7getRateEi |
| 476 | ···472:·0038a | 476 | ···472:·0038af60····30·FUNC····GLOBAL·DEFAULT···13·isTip |
| 477 | ···473:·0050 | 477 | ···473:·005055b0···592·FUNC····GLOBAL·DEFAULT···13·_ZN8terraces15bad_input_errorC2ENS_20bad_input_error_typeENSt7__cxx1112basic_stringIcSt11char_traitsIcESaIcEEE |
| 478 | ···474:·0015fb | 478 | ···474:·0015fbf0··1136·FUNC····GLOBAL·DEFAULT···13·_ZN9PhyloTree29computeMarginalAncestralStateEP13PhyloNeighborP9PhyloNodePdPi |
| 479 | ···475:·0014e6 | 479 | ···475:·0014e6f0···264·FUNC····GLOBAL·DEFAULT···13·_ZN9PhyloTree19optimizeSPRBranchesEv |
| 480 | ···476:·004cbe | 480 | ···476:·004cbea0··1834·FUNC····GLOBAL·DEFAULT···13·_ZN14SuperAlignment16readPartitionDirENSt7__cxx1112basic_stringIcSt11char_traitsIcESaIcEEEPcR9InputTypeS5_b |
| 481 | ···477:·001c4 | 481 | ···477:·001c4770····10·FUNC····GLOBAL·DEFAULT···13·_ZThn128_N18PhyloSuperTreePlen15computeFunctionEd |
| 482 | ···478:·00260 | 482 | ···478:·00260620·····6·FUNC····WEAK···DEFAULT···13·_ZN10ModelSubst12isReversibleEv |
| 483 | ···479:·005c | 483 | ···479:·005cd5e8····11·OBJECT··WEAK···DEFAULT···15·_ZTS9CkpStream |
| 484 | ···480:·00491c | 484 | ···480:·00491cf0··1351·FUNC····GLOBAL·DEFAULT···13·_Z15detectInputFilePKc |
| 485 | ···481:·004df | 485 | ···481:·004df130···282·FUNC····GLOBAL·DEFAULT···13·_ZN18NxsCharactersBlockD1Ev |
| Max diff block lines reached; 1079684/1217219 bytes (88.70%) of diff not shown. | |||
| Offset 1, 680 lines modified | Offset 1, 13 lines modified | ||
| 1 | Relocation·section·'.rel.dyn'·at·offset·0x73248·contains·6153·entries: | 1 | Relocation·section·'.rel.dyn'·at·offset·0x73248·contains·6153·entries: |
| 2 | ·Offset·····Info····Type················Sym.·Value··Symbol's·Name | 2 | ·Offset·····Info····Type················Sym.·Value··Symbol's·Name |
| 3 | 0069216c··00000008·R_386_RELATIVE········ | ||
| 4 | 00692170··00000008·R_386_RELATIVE········ | ||
| 5 | 00692174··00000008·R_386_RELATIVE········ | ||
| 6 | 00692178··00000008·R_386_RELATIVE········ | ||
| 7 | 0069217c··00000008·R_386_RELATIVE········ | ||
| 8 | 00692180··00000008·R_386_RELATIVE········ | ||
| 9 | 00692184··00000008·R_386_RELATIVE········ | ||
| 10 | 00692188··00000008·R_386_RELATIVE········ | ||
| 11 | 0069218c··00000008·R_386_RELATIVE········ | ||
| 12 | 00692190··00000008·R_386_RELATIVE········ | ||
| 13 | 00692194··00000008·R_386_RELATIVE········ | ||
| 14 | 00692198··00000008·R_386_RELATIVE········ | ||
| 15 | 0069219c··00000008·R_386_RELATIVE········ | ||
| 16 | 006921a4··00000008·R_386_RELATIVE········ | ||
| 17 | 006921a8··00000008·R_386_RELATIVE········ | ||
| 18 | 006921ac··00000008·R_386_RELATIVE········ | ||
| 19 | 006921b0··00000008·R_386_RELATIVE········ | ||
| 20 | 006921b4··00000008·R_386_RELATIVE········ | ||
| 21 | 006921b8··00000008·R_386_RELATIVE········ | ||
| 22 | 006921bc··00000008·R_386_RELATIVE········ | ||
| 23 | 006921c0··00000008·R_386_RELATIVE········ | ||
| 24 | 006921c4··00000008·R_386_RELATIVE········ | ||
| 25 | 006921c8··00000008·R_386_RELATIVE········ | ||
| 26 | 006921cc··00000008·R_386_RELATIVE········ | ||
| 27 | 006921d8··00000008·R_386_RELATIVE········ | ||
| 28 | 006921dc··00000008·R_386_RELATIVE········ | ||
| 29 | 006921e0··00000008·R_386_RELATIVE········ | ||
| 30 | 006921ec··00000008·R_386_RELATIVE········ | ||
| 31 | 006921f0··00000008·R_386_RELATIVE········ | ||
| 32 | 006921f4··00000008·R_386_RELATIVE········ | ||
| 33 | 00692200··00000008·R_386_RELATIVE········ | ||
| 34 | 00692204··00000008·R_386_RELATIVE········ | ||
| 35 | 00692208··00000008·R_386_RELATIVE········ | ||
| 36 | 00692210··00000008·R_386_RELATIVE········ | ||
| 37 | 00692214··00000008·R_386_RELATIVE········ | ||
| 38 | 00692218··00000008·R_386_RELATIVE········ | ||
| 39 | 0069221c··00000008·R_386_RELATIVE········ | ||
| 40 | 00692220··00000008·R_386_RELATIVE········ | ||
| 41 | 00692224··00000008·R_386_RELATIVE········ | ||
| 42 | 00692228··00000008·R_386_RELATIVE········ | ||
| 43 | 0069222c··00000008·R_386_RELATIVE········ | ||
| 44 | 00692230··00000008·R_386_RELATIVE········ | ||
| 45 | 00692234··00000008·R_386_RELATIVE········ | ||
| 46 | 00692238··00000008·R_386_RELATIVE········ | ||
| 47 | 0069223c··00000008·R_386_RELATIVE········ | ||
| 48 | 00692240··00000008·R_386_RELATIVE········ | ||
| 49 | 00692244··00000008·R_386_RELATIVE········ | ||
| 50 | 00692248··00000008·R_386_RELATIVE········ | ||
| 51 | 0069224c··00000008·R_386_RELATIVE········ | ||
| 52 | 00692258··00000008·R_386_RELATIVE········ | ||
| 53 | 0069225c··00000008·R_386_RELATIVE········ | ||
| 54 | 00692260··00000008·R_386_RELATIVE········ | ||
| 55 | 0069226c··00000008·R_386_RELATIVE········ | ||
| 56 | 00692270··00000008·R_386_RELATIVE········ | ||
| 57 | 00692274··00000008·R_386_RELATIVE········ | ||
| 58 | 00692280··00000008·R_386_RELATIVE········ | ||
| 59 | 00692284··00000008·R_386_RELATIVE········ | ||
| 60 | 00692288··00000008·R_386_RELATIVE········ | ||
| 61 | 00692290··00000008·R_386_RELATIVE········ | ||
| 62 | 00692294··00000008·R_386_RELATIVE········ | ||
| 63 | 00692298··00000008·R_386_RELATIVE········ | ||
| 64 | 0069229c··00000008·R_386_RELATIVE········ | ||
| 65 | 006922a0··00000008·R_386_RELATIVE········ | ||
| 66 | 006922a4··00000008·R_386_RELATIVE········ | ||
| 67 | 006922a8··00000008·R_386_RELATIVE········ | ||
| 68 | 006922ac··00000008·R_386_RELATIVE········ | ||
| 69 | 006922b0··00000008·R_386_RELATIVE········ | ||
| 70 | 006922b4··00000008·R_386_RELATIVE········ | ||
| 71 | 006922b8··00000008·R_386_RELATIVE········ | ||
| 72 | 006922c0··00000008·R_386_RELATIVE········ | ||
| 73 | 006922c4··00000008·R_386_RELATIVE········ | ||
| 74 | 006922c8··00000008·R_386_RELATIVE········ | ||
| 75 | 006922cc··00000008·R_386_RELATIVE········ | ||
| 76 | 006922d0··00000008·R_386_RELATIVE········ | ||
| 77 | 006922d4··00000008·R_386_RELATIVE········ | ||
| 78 | 006922d8··00000008·R_386_RELATIVE········ | ||
| 79 | 006922dc··00000008·R_386_RELATIVE········ | ||
| 80 | 006922e0··00000008·R_386_RELATIVE········ | ||
| 81 | 006922e4··00000008·R_386_RELATIVE········ | ||
| 82 | 006922e8··00000008·R_386_RELATIVE········ | ||
| 83 | 006922ec··00000008·R_386_RELATIVE········ | ||
| 84 | 006922f0··00000008·R_386_RELATIVE········ | ||
| 85 | 006922f4··00000008·R_386_RELATIVE········ | ||
| 86 | 006922f8··00000008·R_386_RELATIVE········ | ||
| 87 | 006922fc··00000008·R_386_RELATIVE········ | ||
| 88 | 00692300··00000008·R_386_RELATIVE········ | ||
| 89 | 00692304··00000008·R_386_RELATIVE········ | ||
| 90 | 00692308··00000008·R_386_RELATIVE········ | ||
| 91 | 0069230c··00000008·R_386_RELATIVE········ | ||
| 92 | 00692314··00000008·R_386_RELATIVE········ | ||
| 93 | 00692318··00000008·R_386_RELATIVE········ | ||
| 94 | 0069231c··00000008·R_386_RELATIVE········ | ||
| 95 | 00692320··00000008·R_386_RELATIVE········ | ||
| 96 | 00692328··00000008·R_386_RELATIVE········ | ||
| 97 | 0069232c··00000008·R_386_RELATIVE········ | ||
| 98 | 00692330··00000008·R_386_RELATIVE········ | ||
| 99 | 00692334··00000008·R_386_RELATIVE········ | ||
| 100 | 00692338··00000008·R_386_RELATIVE········ | ||
| 101 | 0069233c··00000008·R_386_RELATIVE········ | ||
| 102 | 00692344··00000008·R_386_RELATIVE········ | ||
| 103 | 00692348··00000008·R_386_RELATIVE········ | ||
| 104 | 0069234c··00000008·R_386_RELATIVE········ | ||
| 105 | 00692350··00000008·R_386_RELATIVE········ | ||
| 106 | 00692354··00000008·R_386_RELATIVE········ | ||
| 107 | 00692358··00000008·R_386_RELATIVE········ | ||
| 108 | 0069235c··00000008·R_386_RELATIVE········ | ||
| 109 | 00692360··00000008·R_386_RELATIVE········ | ||
| 110 | 00692364··00000008·R_386_RELATIVE········ | ||
| 111 | 00692368··00000008·R_386_RELATIVE········ | ||
| 112 | 0069236c··00000008·R_386_RELATIVE········ | ||
| 113 | 00692374··00000008·R_386_RELATIVE········ | ||
| 114 | 00692378··00000008·R_386_RELATIVE········ | ||
| 115 | 0069237c··00000008·R_386_RELATIVE········ | ||
| 116 | 00692380··00000008·R_386_RELATIVE········ | ||
| 117 | 00692384··00000008·R_386_RELATIVE········ | ||
| 118 | 00692388··00000008·R_386_RELATIVE········ | ||
| 119 | 0069238c··00000008·R_386_RELATIVE········ | ||
| 120 | 00692390··00000008·R_386_RELATIVE········ | ||
| 121 | 00692394··00000008·R_386_RELATIVE········ | ||
| 122 | 00692398··00000008·R_386_RELATIVE········ | ||
| 123 | 0069239c··00000008·R_386_RELATIVE········ | ||
| 124 | 006923a4··00000008·R_386_RELATIVE········ | ||
| 125 | 006923a8··00000008·R_386_RELATIVE········ | ||
| 126 | 006923ac··00000008·R_386_RELATIVE········ | ||
| Max diff block lines reached; 407696/436623 bytes (93.37%) of diff not shown. | |||
| Offset 1, 29 lines modified | Offset 1, 29 lines modified | ||
| 1 | Dynamic·section·at·offset·0x69 | 1 | Dynamic·section·at·offset·0x69a93c·contains·32·entries: |
| 2 | ··Tag········Type·························Name/Value | 2 | ··Tag········Type·························Name/Value |
| 3 | ·0x00000001·(NEEDED)·····················Shared·library:·[libz.so.1] | 3 | ·0x00000001·(NEEDED)·····················Shared·library:·[libz.so.1] |
| 4 | ·0x00000001·(NEEDED)·····················Shared·library:·[libstdc++.so.6] | 4 | ·0x00000001·(NEEDED)·····················Shared·library:·[libstdc++.so.6] |
| 5 | ·0x00000001·(NEEDED)·····················Shared·library:·[libm.so.6] | 5 | ·0x00000001·(NEEDED)·····················Shared·library:·[libm.so.6] |
| 6 | ·0x00000001·(NEEDED)·····················Shared·library:·[libgomp.so.1] | 6 | ·0x00000001·(NEEDED)·····················Shared·library:·[libgomp.so.1] |
| 7 | ·0x00000001·(NEEDED)·····················Shared·library:·[libgcc_s.so.1] | 7 | ·0x00000001·(NEEDED)·····················Shared·library:·[libgcc_s.so.1] |
| 8 | ·0x00000001·(NEEDED)·····················Shared·library:·[libc.so.6] | 8 | ·0x00000001·(NEEDED)·····················Shared·library:·[libc.so.6] |
| 9 | ·0x0000000c·(INIT)·······················0x80000 | 9 | ·0x0000000c·(INIT)·······················0x80000 |
| 10 | ·0x0000000d·(FINI)·······················0x51 | 10 | ·0x0000000d·(FINI)·······················0x512e54 |
| 11 | ·0x00000019·(INIT_ARRAY)·················0x69 | 11 | ·0x00000019·(INIT_ARRAY)·················0x69316c |
| 12 | ·0x0000001b·(INIT_ARRAYSZ)···············48·(bytes) | 12 | ·0x0000001b·(INIT_ARRAYSZ)···············48·(bytes) |
| 13 | ·0x0000001a·(FINI_ARRAY)·················0x69 | 13 | ·0x0000001a·(FINI_ARRAY)·················0x69319c |
| 14 | ·0x0000001c·(FINI_ARRAYSZ)···············4·(bytes) | 14 | ·0x0000001c·(FINI_ARRAYSZ)···············4·(bytes) |
| 15 | ·0x6ffffef5·(GNU_HASH)···················0x1ec | 15 | ·0x6ffffef5·(GNU_HASH)···················0x1ec |
| 16 | ·0x00000005·(STRTAB)·····················0x232c4 | 16 | ·0x00000005·(STRTAB)·····················0x232c4 |
| 17 | ·0x00000006·(SYMTAB)·····················0xada4 | 17 | ·0x00000006·(SYMTAB)·····················0xada4 |
| 18 | ·0x0000000a·(STRSZ)······················314365·(bytes) | 18 | ·0x0000000a·(STRSZ)······················314365·(bytes) |
| 19 | ·0x0000000b·(SYMENT)·····················16·(bytes) | 19 | ·0x0000000b·(SYMENT)·····················16·(bytes) |
| 20 | ·0x00000015·(DEBUG)······················0x0 | 20 | ·0x00000015·(DEBUG)······················0x0 |
| 21 | ·0x00000003·(PLTGOT)·····················0x69 | 21 | ·0x00000003·(PLTGOT)·····················0x69aa64 |
| 22 | ·0x00000002·(PLTRELSZ)···················2328·(bytes) | 22 | ·0x00000002·(PLTRELSZ)···················2328·(bytes) |
| 23 | ·0x00000014·(PLTREL)·····················REL | 23 | ·0x00000014·(PLTREL)·····················REL |
| 24 | ·0x00000017·(JMPREL)·····················0x7f290 | 24 | ·0x00000017·(JMPREL)·····················0x7f290 |
| 25 | ·0x00000011·(REL)························0x73248 | 25 | ·0x00000011·(REL)························0x73248 |
| 26 | ·0x00000012·(RELSZ)······················49224·(bytes) | 26 | ·0x00000012·(RELSZ)······················49224·(bytes) |
| 27 | ·0x00000013·(RELENT)·····················8·(bytes) | 27 | ·0x00000013·(RELENT)·····················8·(bytes) |
| 28 | ·0x0000001e·(FLAGS)······················BIND_NOW | 28 | ·0x0000001e·(FLAGS)······················BIND_NOW |
| Offset 1, 8 lines modified | Offset 1, 8 lines modified | ||
| 1 | Displaying·notes·found·in:·.note.gnu.build-id | 1 | Displaying·notes·found·in:·.note.gnu.build-id |
| 2 | ··Owner················Data·size·» Description | 2 | ··Owner················Data·size·» Description |
| 3 | ··GNU··················0x00000014» NT_GNU_BUILD_ID·(unique·build·ID·bitstring)» ····Build·ID:· | 3 | ··GNU··················0x00000014» NT_GNU_BUILD_ID·(unique·build·ID·bitstring)» ····Build·ID:·af6a21c80fc63827ad9ba4fb14784f02c16f66ae |
| 4 | Displaying·notes·found·in:·.note.ABI-tag | 4 | Displaying·notes·found·in:·.note.ABI-tag |
| 5 | ··Owner················Data·size·» Description | 5 | ··Owner················Data·size·» Description |
| 6 | ··GNU··················0x00000010» NT_GNU_ABI_TAG·(ABI·version·tag)» ····OS:·Linux,·ABI:·3.2.0 | 6 | ··GNU··················0x00000010» NT_GNU_ABI_TAG·(ABI·version·tag)» ····OS:·Linux,·ABI:·3.2.0 |
| Offset 1, 7119 lines modified | Offset 1, 7119 lines modified | ||
| 1 | Contents·of·the·.eh_frame_hdr·section: | 1 | Contents·of·the·.eh_frame_hdr·section: |
| 2 | ··Version:·················1 | 2 | ··Version:·················1 |
| 3 | ··Pointer·Encoding·Format:·0x1b·(sdata4,·pcrel) | 3 | ··Pointer·Encoding·Format:·0x1b·(sdata4,·pcrel) |
| 4 | ··Count·Encoding·Format:···0x3·(udata4,·absolute) | 4 | ··Count·Encoding·Format:···0x3·(udata4,·absolute) |
| 5 | ··Table·Encoding·Format:···0x3b·(sdata4,·datarel) | 5 | ··Table·Encoding·Format:···0x3b·(sdata4,·datarel) |
| 6 | ··Start·of·frame·section:··0xde08·(offset:·0x5e | 6 | ··Start·of·frame·section:··0xde08·(offset:·0x5e5104) | Diff chunk too large, falling back to line-by-line diff (7104 lines added, 7104 lines removed) |
| 7 | ··Entries·in·search·table:·0x1bc0 | 7 | ··Entries·in·search·table:·0x1bc0 |
| 8 | ··0xffffffffffaa | 8 | ··0xffffffffffaa8d28·(offset:·0x80020)·->·0xde50·fde=[····44] |
| 9 | ··0xffffffffffaa | 9 | ··0xffffffffffaa9f68·(offset:·0x81260)·->·0xde74·fde=[····68] |
| 10 | ··0xffffffffffaa | 10 | ··0xffffffffffaa9f88·(offset:·0x81280)·->·0xdef8·fde=[····ec] |
| 11 | ··0xffffffffffaa | 11 | ··0xffffffffffaaa03e·(offset:·0x81336)·->·0xe6e4·fde=[···8d8] |
| 12 | ··0xffffffffffaa | 12 | ··0xffffffffffaaa130·(offset:·0x81428)·->·0xe710·fde=[···904] |
| 13 | ··0xffffffffffaa | 13 | ··0xffffffffffaaa222·(offset:·0x8151a)·->·0xe73c·fde=[···930] |
| 14 | ··0xffffffffffaa | 14 | ··0xffffffffffaaa31a·(offset:·0x81612)·->·0xe768·fde=[···95c] |
| 15 | ··0xffffffffffaa | 15 | ··0xffffffffffaaa412·(offset:·0x8170a)·->·0xefe0·fde=[··11d4] |
| 16 | ··0xffffffffffaa | 16 | ··0xffffffffffaaa434·(offset:·0x8172c)·->·0xf050·fde=[··1244] |
| 17 | ··0xffffffffffaa | 17 | ··0xffffffffffaaa464·(offset:·0x8175c)·->·0xf070·fde=[··1264] |
| 18 | ··0xffffffffffaa | 18 | ··0xffffffffffaaa524·(offset:·0x8181c)·->·0xf1a8·fde=[··139c] |
| 19 | ··0xffffffffffaa | 19 | ··0xffffffffffaaa5a6·(offset:·0x8189e)·->·0xf280·fde=[··1474] |
| 20 | ··0xffffffffffaa | 20 | ··0xffffffffffaaa64e·(offset:·0x81946)·->·0xf7a0·fde=[··1994] |
| 21 | ··0xffffffffffaa | 21 | ··0xffffffffffaaa6ac·(offset:·0x819a4)·->·0xf9dc·fde=[··1bd0] |
| 22 | ··0xffffffffffaa | 22 | ··0xffffffffffaaa6b2·(offset:·0x819aa)·->·0xfa30·fde=[··1c24] |
| 23 | ··0xffffffffffaa | 23 | ··0xffffffffffaaa790·(offset:·0x81a88)·->·0xfaec·fde=[··1ce0] |
| 24 | ··0xffffffffffaa | 24 | ··0xffffffffffaaa7ac·(offset:·0x81aa4)·->·0xfe50·fde=[··2044] |
| 25 | ··0xffffffffffaa | 25 | ··0xffffffffffaaa84d·(offset:·0x81b45)·->·0xff28·fde=[··211c] |
| 26 | ··0xffffffffffaa | 26 | ··0xffffffffffaaa990·(offset:·0x81c88)·->·0x1019c·fde=[··2390] |
| 27 | ··0xffffffffffaa | 27 | ··0xffffffffffaaa996·(offset:·0x81c8e)·->·0x103c0·fde=[··25b4] |
| 28 | ··0xffffffffffaa | 28 | ··0xffffffffffaaaa1c·(offset:·0x81d14)·->·0x10430·fde=[··2624] |
| 29 | ··0xffffffffffaa | 29 | ··0xffffffffffaaab98·(offset:·0x81e90)·->·0x10494·fde=[··2688] |
| 30 | ··0xffffffffffaa | 30 | ··0xffffffffffaaabe6·(offset:·0x81ede)·->·0x10724·fde=[··2918] |
| 31 | ··0xffffffffffaa | 31 | ··0xffffffffffaaac06·(offset:·0x81efe)·->·0x10788·fde=[··297c] |
| 32 | ··0xffffffffffaa | 32 | ··0xffffffffffaaad36·(offset:·0x8202e)·->·0x10928·fde=[··2b1c] |
| 33 | ··0xffffffffffaa | 33 | ··0xffffffffffaaad3c·(offset:·0x82034)·->·0x10a48·fde=[··2c3c] |
| 34 | ··0xffffffffffaa | 34 | ··0xffffffffffaaad50·(offset:·0x82048)·->·0x10b98·fde=[··2d8c] |
| 35 | ··0xffffffffffaa | 35 | ··0xffffffffffaaad6c·(offset:·0x82064)·->·0x10eb0·fde=[··30a4] |
| 36 | ··0xffffffffffaa | 36 | ··0xffffffffffaaad76·(offset:·0x8206e)·->·0x10f84·fde=[··3178] |
| 37 | ··0xffffffffffaa | 37 | ··0xffffffffffaaad80·(offset:·0x82078)·->·0x11110·fde=[··3304] |
| 38 | ··0xffffffffffaa | 38 | ··0xffffffffffaaadc0·(offset:·0x820b8)·->·0x111d4·fde=[··33c8] |
| 39 | ··0xffffffffffaa | 39 | ··0xffffffffffaaade8·(offset:·0x820e0)·->·0x1126c·fde=[··3460] |
| 40 | ··0xffffffffffaa | 40 | ··0xffffffffffaaadf9·(offset:·0x820f1)·->·0x1131c·fde=[··3510] |
| 41 | ··0xffffffffffaa | 41 | ··0xffffffffffaab09e·(offset:·0x82396)·->·0x114e4·fde=[··36d8] |
| 42 | ··0xffffffffffaa | 42 | ··0xffffffffffaab182·(offset:·0x8247a)·->·0x11980·fde=[··3b74] |
| 43 | ··0xffffffffffaa | 43 | ··0xffffffffffaab39c·(offset:·0x82694)·->·0x119ec·fde=[··3be0] |
| 44 | ··0xffffffffffaa | 44 | ··0xffffffffffaab50c·(offset:·0x82804)·->·0x11a50·fde=[··3c44] |
| 45 | ··0xffffffffffaa | 45 | ··0xffffffffffaab69c·(offset:·0x82994)·->·0x11d00·fde=[··3ef4] |
| 46 | ··0xffffffffffaa | 46 | ··0xffffffffffaab6b4·(offset:·0x829ac)·->·0x11d54·fde=[··3f48] |
| 47 | ··0xffffffffffaa | 47 | ··0xffffffffffaab708·(offset:·0x82a00)·->·0x11db0·fde=[··3fa4] |
| 48 | ··0xffffffffffaa | 48 | ··0xffffffffffaab7ce·(offset:·0x82ac6)·->·0x11e10·fde=[··4004] |
| 49 | ··0xffffffffffaa | 49 | ··0xffffffffffaab896·(offset:·0x82b8e)·->·0x11e70·fde=[··4064] |
| 50 | ··0xffffffffffaa | 50 | ··0xffffffffffaabc82·(offset:·0x82f7a)·->·0x11edc·fde=[··40d0] |
| 51 | ··0xffffffffffaa | 51 | ··0xffffffffffaabd2c·(offset:·0x83024)·->·0x11f40·fde=[··4134] |
| 52 | ··0xffffffffffaa | 52 | ··0xffffffffffaabdd6·(offset:·0x830ce)·->·0x11fa4·fde=[··4198] |
| 53 | ··0xffffffffffaa | 53 | ··0xffffffffffaabf16·(offset:·0x8320e)·->·0x12150·fde=[··4344] |
| 54 | ··0xffffffffffaa | 54 | ··0xffffffffffaac280·(offset:·0x83578)·->·0x121cc·fde=[··43c0] |
| 55 | ··0xffffffffffaa | 55 | ··0xffffffffffaac418·(offset:·0x83710)·->·0x126ac·fde=[··48a0] |
| 56 | ··0xffffffffffaa | 56 | ··0xffffffffffaac780·(offset:·0x83a78)·->·0x12710·fde=[··4904] |
| 57 | ··0xffffffffffaa | 57 | ··0xffffffffffaaca78·(offset:·0x83d70)·->·0x12cb0·fde=[··4ea4] |
| 58 | ··0xffffffffffaa | 58 | ··0xffffffffffaacae6·(offset:·0x83dde)·->·0x12d4c·fde=[··4f40] |
| 59 | ··0xffffffffffaa | 59 | ··0xffffffffffaaccfa·(offset:·0x83ff2)·->·0x12f1c·fde=[··5110] |
| 60 | ··0xffffffffffaa | 60 | ··0xffffffffffaacd32·(offset:·0x8402a)·->·0x13d64·fde=[··5f58] |
| 61 | ··0xffffffffffaa | 61 | ··0xffffffffffaacd9c·(offset:·0x84094)·->·0x13f20·fde=[··6114] |
| 62 | ··0xffffffffffaa | 62 | ··0xffffffffffaacdfc·(offset:·0x840f4)·->·0x13ff4·fde=[··61e8] |
| 63 | ··0xffffffffffaa | 63 | ··0xffffffffffaace12·(offset:·0x8410a)·->·0x143d8·fde=[··65cc] |
| 64 | ··0xffffffffffaa | 64 | ··0xffffffffffaacf30·(offset:·0x84228)·->·0x145a4·fde=[··6798] |
| 65 | ··0xffffffffffaa | 65 | ··0xffffffffffaad064·(offset:·0x8435c)·->·0x14618·fde=[··680c] |
| 66 | ··0xffffffffffaa | 66 | ··0xffffffffffaad176·(offset:·0x8446e)·->·0x14674·fde=[··6868] |
| 67 | ··0xffffffffffaa | 67 | ··0xffffffffffaad35a·(offset:·0x84652)·->·0x146d0·fde=[··68c4] |
| 68 | ··0xffffffffffaa | 68 | ··0xffffffffffaad3c0·(offset:·0x846b8)·->·0x1472c·fde=[··6920] |
| 69 | ··0xffffffffffaa | 69 | ··0xffffffffffaad492·(offset:·0x8478a)·->·0x14788·fde=[··697c] |
| 70 | ··0xffffffffffaa | 70 | ··0xffffffffffaad4d6·(offset:·0x847ce)·->·0x147e4·fde=[··69d8] |
| 71 | ··0xffffffffffaa | 71 | ··0xffffffffffaad59e·(offset:·0x84896)·->·0x1483c·fde=[··6a30] |
| 72 | ··0xffffffffffaa | 72 | ··0xffffffffffaad63a·(offset:·0x84932)·->·0x1489c·fde=[··6a90] |
| 73 | ··0xffffffffffaa | 73 | ··0xffffffffffaad6ee·(offset:·0x849e6)·->·0x148f8·fde=[··6aec] |
| 74 | ··0xffffffffffaa | 74 | ··0xffffffffffaadc6a·(offset:·0x84f62)·->·0x14990·fde=[··6b84] |
| 75 | ··0xffffffffffaa | 75 | ··0xffffffffffaae1f4·(offset:·0x854ec)·->·0x14a34·fde=[··6c28] |
| 76 | ··0xffffffffffaa | 76 | ··0xffffffffffaae610·(offset:·0x85908)·->·0x14ab4·fde=[··6ca8] |
| 77 | ··0xffffffffffaa | 77 | ··0xffffffffffaaed54·(offset:·0x8604c)·->·0x14b48·fde=[··6d3c] |
| 78 | ··0xffffffffffa | 78 | ··0xffffffffffaaf198·(offset:·0x86490)·->·0x14bd4·fde=[··6dc8] |
| 79 | ··0xffffffffffa | 79 | ··0xffffffffffaaf7b4·(offset:·0x86aac)·->·0x14c64·fde=[··6e58] |
| 80 | ··0xffffffffffab | 80 | ··0xffffffffffab06e8·(offset:·0x879e0)·->·0x14ce0·fde=[··6ed4] |
| 81 | ··0xffffffffffab | 81 | ··0xffffffffffab17e4·(offset:·0x88adc)·->·0x14db8·fde=[··6fac] |
| 82 | ··0xffffffffffab | 82 | ··0xffffffffffab1b00·(offset:·0x88df8)·->·0x14e20·fde=[··7014] |
| 83 | ··0xffffffffffab | 83 | ··0xffffffffffab1b4c·(offset:·0x88e44)·->·0x14e80·fde=[··7074] |
| 84 | ··0xffffffffffab | 84 | ··0xffffffffffab1ba2·(offset:·0x88e9a)·->·0x14ef4·fde=[··70e8] |
| 85 | ··0xffffffffffab | 85 | ··0xffffffffffab1c4e·(offset:·0x88f46)·->·0x14f50·fde=[··7144] |
| 86 | ··0xffffffffffab | 86 | ··0xffffffffffab1cd8·(offset:·0x88fd0)·->·0x14fac·fde=[··71a0] |
| 87 | ··0xffffffffffab | 87 | ··0xffffffffffab1d24·(offset:·0x8901c)·->·0x15004·fde=[··71f8] |
| 88 | ··0xffffffffffab | 88 | ··0xffffffffffab1d9a·(offset:·0x89092)·->·0x1505c·fde=[··7250] |
| 89 | ··0xffffffffffab | 89 | ··0xffffffffffab1dce·(offset:·0x890c6)·->·0x150c8·fde=[··72bc] |
| 90 | ··0xffffffffffab | 90 | ··0xffffffffffab2014·(offset:·0x8930c)·->·0x1512c·fde=[··7320] |
| 91 | ··0xffffffffffab | 91 | ··0xffffffffffab20ae·(offset:·0x893a6)·->·0x15188·fde=[··737c] |
| 92 | ··0xffffffffffab | 92 | ··0xffffffffffab21ce·(offset:·0x894c6)·->·0x151ec·fde=[··73e0] |
| 93 | ··0xffffffffffab | 93 | ··0xffffffffffab24d0·(offset:·0x897c8)·->·0x1524c·fde=[··7440] |
| 94 | ··0xffffffffffab | 94 | ··0xffffffffffab24fe·(offset:·0x897f6)·->·0x152a8·fde=[··749c] |
| 95 | ··0xffffffffffab | 95 | ··0xffffffffffab25da·(offset:·0x898d2)·->·0x15308·fde=[··74fc] |
| 96 | ··0xffffffffffab | 96 | ··0xffffffffffab268a·(offset:·0x89982)·->·0x15364·fde=[··7558] |
| 97 | ··0xffffffffffab | 97 | ··0xffffffffffab26dc·(offset:·0x899d4)·->·0x153c4·fde=[··75b8] |
| 98 | ··0xffffffffffab | 98 | ··0xffffffffffab272c·(offset:·0x89a24)·->·0x1542c·fde=[··7620] |
| 99 | ··0xffffffffffab | 99 | ··0xffffffffffab28f8·(offset:·0x89bf0)·->·0x154c0·fde=[··76b4] |
| 100 | ··0xffffffffffab | 100 | ··0xffffffffffab2eeb·(offset:·0x8a1e3)·->·0xfb18·fde=[··1d0c] |
| 101 | ··0xffffffffffab | 101 | ··0xffffffffffab2f21·(offset:·0x8a219)·->·0x12944·fde=[··4b38] |
| 102 | ··0xffffffffffab | 102 | ··0xffffffffffab2fa8·(offset:·0x8a2a0)·->·0x129b8·fde=[··4bac] |
| 103 | ··0xffffffffffab | 103 | ··0xffffffffffab302f·(offset:·0x8a327)·->·0x13628·fde=[··581c] |
| 104 | ··0xffffffffffab | 104 | ··0xffffffffffab30b6·(offset:·0x8a3ae)·->·0x1561c·fde=[··7810] |
| 105 | ··0xffffffffffab | 105 | ··0xffffffffffab30c6·(offset:·0x8a3be)·->·0x15b0c·fde=[··7d00] |
| 106 | ··0xffffffffffab | 106 | ··0xffffffffffab30da·(offset:·0x8a3d2)·->·0x15b64·fde=[··7d58] |
| 107 | ··0xffffffffffab | 107 | ··0xffffffffffab30ee·(offset:·0x8a3e6)·->·0x15ec8·fde=[··80bc] |
| 108 | ··0xffffffffffab | 108 | ··0xffffffffffab3104·(offset:·0x8a3fc)·->·0x164bc·fde=[··86b0] |
| 109 | ··0xffffffffffab | 109 | ··0xffffffffffab312e·(offset:·0x8a426)·->·0x16514·fde=[··8708] |
| 110 | ··0xffffffffffab | 110 | ··0xffffffffffab3158·(offset:·0x8a450)·->·0x1699c·fde=[··8b90] |
| 111 | ··0xffffffffffab | 111 | ··0xffffffffffab3182·(offset:·0x8a47a)·->·0x16ccc·fde=[··8ec0] |
| 112 | ··0xffffffffffab | 112 | ··0xffffffffffab31e0·(offset:·0x8a4d8)·->·0x16df0·fde=[··8fe4] |
| 113 | ··0xffffffffffab | 113 | ··0xffffffffffab323e·(offset:·0x8a536)·->·0x16e64·fde=[··9058] |
| 114 | ··0xffffffffffab | 114 | ··0xffffffffffab343a·(offset:·0x8a732)·->·0x16f64·fde=[··9158] |
| 115 | ··0xffffffffffab | 115 | ··0xffffffffffab3444·(offset:·0x8a73c)·->·0x170e0·fde=[··92d4] |
| 116 | ··0xffffffffffab45 | 116 | ··0xffffffffffab345c·(offset:·0x8a754)·->·0x17754·fde=[··9948] |
| 117 | ··0xffffffffffab | 117 | ··0xffffffffffab356a·(offset:·0x8a862)·->·0x177b4·fde=[··99a8] |
| 118 | ··0xffffffffffab | 118 | ··0xffffffffffab35ce·(offset:·0x8a8c6)·->·0x17810·fde=[··9a04] |
| 119 | ··0xffffffffffab | 119 | ··0xffffffffffab3622·(offset:·0x8a91a)·->·0x1786c·fde=[··9a60] |
| 120 | ··0xffffffffffab | 120 | ··0xffffffffffab3686·(offset:·0x8a97e)·->·0x17ca8·fde=[··9e9c] |
| 121 | ··0xffffffffffab | 121 | ··0xffffffffffab3690·(offset:·0x8a988)·->·0x17d00·fde=[··9ef4] |
| 122 | ··0xffffffffffab | 122 | ··0xffffffffffab36da·(offset:·0x8a9d2)·->·0x17d58·fde=[··9f4c] |
| 123 | ··0xffffffffffab | 123 | ··0xffffffffffab3726·(offset:·0x8aa1e)·->·0x17dd8·fde=[··9fcc] |
| 124 | ··0xffffffffffab | 124 | ··0xffffffffffab372c·(offset:·0x8aa24)·->·0x17e68·fde=[··a05c] |
| 125 | ··0xffffffffffab | 125 | ··0xffffffffffab3740·(offset:·0x8aa38)·->·0x180a4·fde=[··a298] |
| Max diff block lines reached; 14661250/15581660 bytes (94.09%) of diff not shown. | |||
| Offset 1, 8 lines modified | Offset 1, 8 lines modified | ||
| 1 | 1 | /lib/ld-linux.so.2 | |
| 2 | $"A3*<BB | 2 | $"A3*<BB |
| 3 | :*N&kHX&7 | 3 | :*N&kHX&7 |
| 4 | ^I·#I@Sn | 4 | ^I·#I@Sn |
| 5 | \z+Iv`T?Wu | 5 | \z+Iv`T?Wu |
| 6 | J2`A~=91 | 6 | J2`A~=91 |
| 7 | ZZK&)OC} | 7 | ZZK&)OC} |
| 8 | _&:=$\» \ | 8 | _&:=$\» \ |
| Offset 6141, 15 lines modified | Offset 6141, 15 lines modified | ||
| 6141 | |$49|$$t | 6141 | |$49|$$t |
| 6142 | D$,9D$P~ | 6142 | D$,9D$P~ |
| 6143 | D$(9D$`~4 | 6143 | D$(9D$`~4 |
| 6144 | |$89T$<t| | 6144 | |$89T$<t| |
| 6145 | t$H+t$D) | 6145 | t$H+t$D) |
| 6146 | D$H9D$$uh | 6146 | D$H9D$$uh |
| 6147 | y<-t]<.u( | 6147 | y<-t]<.u( |
| 6148 | t | 6148 | tT9t$4sV |
| 6149 | l"Htotal·length:· | 6149 | l"Htotal·length:· |
| 6150 | mean·length:· | 6150 | mean·length:· |
| 6151 | Parsimony·score·is:· | 6151 | Parsimony·score·is:· |
| 6152 | Error·found·at·line· | 6152 | Error·found·at·line· |
| 6153 | ,·column· | 6153 | ,·column· |
| 6154 | ·(file·position· | 6154 | ·(file·position· |
| 6155 | shuffleAlignment | 6155 | shuffleAlignment |
| Offset 13842, 18 lines modified | Offset 13842, 14 lines modified | ||
| 13842 | i·<=·basic_bitvector<Alloc>::m_size | 13842 | i·<=·basic_bitvector<Alloc>::m_size |
| 13843 | bool·terraces::bitmatrix::get(terraces::index,·terraces::index)·const | 13843 | bool·terraces::bitmatrix::get(terraces::index,·terraces::index)·const |
| 13844 | ./terraphast/lib/bitmatrix.cpp | 13844 | ./terraphast/lib/bitmatrix.cpp |
| 13845 | void·terraces::bitmatrix::set(terraces::index,·terraces::index,·bool) | 13845 | void·terraces::bitmatrix::set(terraces::index,·terraces::index,·bool) |
| 13846 | terraces::bitmatrix·terraces::bitmatrix::get_cols(const·std::vector<unsigned·int>&)·const | 13846 | terraces::bitmatrix·terraces::bitmatrix::get_cols(const·std::vector<unsigned·int>&)·const |
| 13847 | bool·terraces::is_leaf(const·node&) | 13847 | bool·terraces::is_leaf(const·node&) |
| 13848 | (n.lchild()·==·n.rchild())·==·(n.lchild()·==·none) | 13848 | (n.lchild()·==·n.rchild())·==·(n.lchild()·==·none) |
| 13849 | Mismatching·parentheses·in·nwk·tree | ||
| 13850 | Only·bifurcating·trees·are·supported | ||
| 13851 | Mismatching·number·of·rows/columns·between·bitmatrix·header·and·content | ||
| 13852 | Mismatching·size·between·tree·and·bitmatrix | ||
| 13853 | std::ostream&·terraces::print_multitree_node(std::ostream&,·const·multitree_node*,·const·name_map&) | 13849 | std::ostream&·terraces::print_multitree_node(std::ostream&,·const·multitree_node*,·const·name_map&) |
| 13854 | ./terraphast/lib/multitree.cpp | 13850 | ./terraphast/lib/multitree.cpp |
| 13855 | static·terraces::small_bipartition·terraces::small_bipartition::full_set(terraces::index) | 13851 | static·terraces::small_bipartition·terraces::small_bipartition::full_set(terraces::index) |
| 13856 | ./terraphast/lib/small_bipartition.hpp | 13852 | ./terraphast/lib/small_bipartition.hpp |
| 13857 | void·terraces::multitree_iterator::init_subtree(terraces::index) | 13853 | void·terraces::multitree_iterator::init_subtree(terraces::index) |
| 13858 | ./terraphast/lib/multitree_iterator.cpp | 13854 | ./terraphast/lib/multitree_iterator.cpp |
| 13859 | false·&&·"Malformed·multitree:·Nested·alternative_arrays" | 13855 | false·&&·"Malformed·multitree:·Nested·alternative_arrays" |
| Offset 13986, 14 lines modified | Offset 13982, 15 lines modified | ||
| 13986 | ERROR:·FTOL·.LT.ERROR:·GTOL·.LT.ERROR:·XTOL·.LT.ERROR:·STPMIN·.LERROR:·STPMAX·.LMAX·.LT.·STPMIN | 13982 | ERROR:·FTOL·.LT.ERROR:·GTOL·.LT.ERROR:·XTOL·.LT.ERROR:·STPMIN·.LERROR:·STPMAX·.LMAX·.LT.·STPMIN |
| 13987 | WARNING:·ROUNDING·ERRORS·PREVENTREVENT·PROGRESS | 13983 | WARNING:·ROUNDING·ERRORS·PREVENTREVENT·PROGRESS |
| 13988 | WARNING:·XTOL·TE·TEST·SATISFIED | 13984 | WARNING:·XTOL·TE·TEST·SATISFIED |
| 13989 | WARNING:·STP·=·SCONVERGENCE:·NORM·OF·PROJECTED·GRADIENT·<=·PGTOLWARNING:·ABNORMAL_TERMINATION_INRESTART_FROM_LNSCONVERGENCE:·REL_REDUCTION_OF_F·<=·FACTR*EPSMCH | 13985 | WARNING:·STP·=·SCONVERGENCE:·NORM·OF·PROJECTED·GRADIENT·<=·PGTOLWARNING:·ABNORMAL_TERMINATION_INRESTART_FROM_LNSCONVERGENCE:·REL_REDUCTION_OF_F·<=·FACTR*EPSMCH |
| 13990 | PAACDEFGHIKLMNPQRS·among·stored·chcharacter·labels)·is·invalid;·must·be·greater·th0123456789ABCDEF()[]{}/\,;:=*'"`·block·contains··command,·but·fo]·is·not·a·valid·command·comment | 13986 | PAACDEFGHIKLMNPQRS·among·stored·chcharacter·labels)·is·invalid;·must·be·greater·th0123456789ABCDEF()[]{}/\,;:=*'"`·block·contains··command,·but·fo]·is·not·a·valid·command·comment |
| 13991 | The·number·of·TRANSLATE·entries·should·equal·the·number·of·taxa | 13987 | The·number·of·TRANSLATE·entries·should·equal·the·number·of·taxa |
| 13992 | Perhaps·there·were·fewer·taxa·in·the·tree·file·than·previously· | 13988 | Perhaps·there·were·fewer·taxa·in·the·tree·file·than·previously· |
| 13989 | Mismatching·quototes·in·nwk·treeUnknown·taxon·inaxon·in·nwk·treeDuplicate·taxon·Malformed·nwk·trLess·than·4·taxataxa·in·nwk·treeon·in·bitmatrix·Empty·taxon·nameame·in·bitmatrixMalformed·bitmatee·and·bitmatrixUnnamed·leaf·fouaf·found·in·treeUUU | ||
| 13993 | f?=UUUUU | 13990 | f?=UUUUU |
| 13994 | ?St12_Vector_baseIjSaIjEE | 13991 | ?St12_Vector_baseIjSaIjEE |
| 13995 | St6vectorIjSaIjEE | 13992 | St6vectorIjSaIjEE |
| 13996 | 7Pattern | 13993 | 7Pattern |
| 13997 | __root__ | 13994 | __root__ |
| 13998 | Number·of·taxa·must·be·greater·than·2. | 13995 | Number·of·taxa·must·be·greater·than·2. |
| 13999 | 9CkpStream | 13996 | 9CkpStream |
| Offset 14359, 14 lines modified | Offset 14356, 15 lines modified | ||
| 14359 | 12NxsTaxaBlock | 14356 | 12NxsTaxaBlock |
| 14360 | 8NxsToken | 14357 | 8NxsToken |
| 14361 | 13NxsTreesBlock | 14358 | 13NxsTreesBlock |
| 14362 | 16NxsDiscreteDatum | 14359 | 16NxsDiscreteDatum |
| 14363 | N8terraces15bad_input_errorE | 14360 | N8terraces15bad_input_errorE |
| 14364 | N8terraces20no_usable_root_errorE | 14361 | N8terraces20no_usable_root_errorE |
| 14365 | N8terraces25tree_count_overflow_errorE | 14362 | N8terraces25tree_count_overflow_errorE |
| 14363 | Mismatching·parentheses·in·nwk·tOnly·bifurcating·trees·are·suppoMismatching·number·of·rows/columns·between·bitmatrix·header·and·Mismatching·size·between·tree·an | ||
| 14366 | o.0z.·\. | 14364 | o.0z.·\. |
| 14367 | KNKNTTTTRSRSIIMIQHQHPPPPRRRRLLLLEDEDAAAAGGGGVVVV*Y*YSSSSGCWCLFLF | 14365 | KNKNTTTTRSRSIIMIQHQHPPPPRRRRLLLLEDEDAAAAGGGGVVVV*Y*YSSSSGCWCLFLF |
| 14368 | KNKNTTTTSSKSIIMIQHQHPPPPRRRRLLLLEDEDAAAAGGGGVVVV*Y*YSSSSWCWCLFLF | 14366 | KNKNTTTTSSKSIIMIQHQHPPPPRRRRLLLLEDEDAAAAGGGGVVVV*Y*YSSSSWCWCLFLF |
| 14369 | KNKNTTTTRSRSIIMIQHQHPPPPRRRRLLLLEDEDAAAAGGGGVVVV*Y*YSSSS*CWC*FLF | 14367 | KNKNTTTTRSRSIIMIQHQHPPPPRRRRLLLLEDEDAAAAGGGGVVVV*Y*YSSSS*CWC*FLF |
| 14370 | KNKNTTTTRSRSIIMIQHQHPPPPRRRRLLLLEDEDAAAAGGGGVVVV*YLY*SSS*CWCLFLF | 14368 | KNKNTTTTRSRSIIMIQHQHPPPPRRRRLLLLEDEDAAAAGGGGVVVV*YLY*SSS*CWCLFLF |
| 14371 | NNKNTTTTSSSSMIMIQHQHPPPPRRRRLLLLEDEDAAAAGGGGVVVV*Y*YSSSSWCWCLFLF | 14369 | NNKNTTTTSSSSMIMIQHQHPPPPRRRRLLLLEDEDAAAAGGGGVVVV*Y*YSSSSWCWCLFLF |
| 14372 | KNKNTTTTRSRSIIMIQHQHPPPPRRRRLLLLEDEDAAAAGGGGVVVV*YLYSSSS*CWCLFLF | 14370 | KNKNTTTTRSRSIIMIQHQHPPPPRRRRLLLLEDEDAAAAGGGGVVVV*YLYSSSS*CWCLFLF |
| Offset 3, 16 lines modified | Offset 3, 16 lines modified | ||
| 3 | Disassembly·of·section·.init: | 3 | Disassembly·of·section·.init: |
| 4 | 00080000·<.init>: | 4 | 00080000·<.init>: |
| 5 | _init(): | 5 | _init(): |
| 6 | » push···%ebx | 6 | » push···%ebx |
| 7 | » sub····$0x8,%esp | 7 | » sub····$0x8,%esp |
| 8 | » call···e7 | 8 | » call···e7e60·<_start@@Base+0x30> |
| 9 | » add····$0x61 | 9 | » add····$0x61aa5b,%ebx |
| 10 | » mov····0x56c(%ebx),%eax | 10 | » mov····0x56c(%ebx),%eax |
| 11 | » test···%eax,%eax | 11 | » test···%eax,%eax |
| 12 | » je·····8001b·<__printf_chk@plt-0x15> | 12 | » je·····8001b·<__printf_chk@plt-0x15> |
| 13 | » call···*%eax | 13 | » call···*%eax |
| 14 | » add····$0x8,%esp | 14 | » add····$0x8,%esp |
| 15 | » pop····%ebx | 15 | » pop····%ebx |
| 16 | » ret | 16 | » ret |
| Offset 10, 28 lines modified | Offset 10, 28 lines modified | ||
| 10 | » sub····%gs:0x14,%eax | 10 | » sub····%gs:0x14,%eax |
| 11 | » jne····812a2·<free@plt+0x32> | 11 | » jne····812a2·<free@plt+0x32> |
| 12 | » call···80b40·<std::__throw_bad_cast()@plt> | 12 | » call···80b40·<std::__throw_bad_cast()@plt> |
| 13 | » mov····-0x1c(%ebp),%eax | 13 | » mov····-0x1c(%ebp),%eax |
| 14 | » sub····%gs:0x14,%eax | 14 | » sub····%gs:0x14,%eax |
| 15 | » jne····812a7·<free@plt+0x37> | 15 | » jne····812a7·<free@plt+0x37> |
| 16 | » call···80b40·<std::__throw_bad_cast()@plt> | 16 | » call···80b40·<std::__throw_bad_cast()@plt> |
| 17 | » call···51 | 17 | » call···512e40·<terraces::basic_bitvector<std::allocator<unsigned·int>·>*·std::__do_uninit_fill_n<terraces::basic_bitvector<std::allocator<unsigned·int>·>*,·unsigned·int,·terraces::basic_bitvector<std::allocator<unsigned·int>·>·>(terraces::basic_bitvector<std::allocator<unsigned·int>·>*,·unsigned·int,·terraces::basic_bitvector<std::allocator<unsigned·int>·>·const&)@@Base+0x180> |
| 18 | » call···51 | 18 | » call···512e40·<terraces::basic_bitvector<std::allocator<unsigned·int>·>*·std::__do_uninit_fill_n<terraces::basic_bitvector<std::allocator<unsigned·int>·>*,·unsigned·int,·terraces::basic_bitvector<std::allocator<unsigned·int>·>·>(terraces::basic_bitvector<std::allocator<unsigned·int>·>*,·unsigned·int,·terraces::basic_bitvector<std::allocator<unsigned·int>·>·const&)@@Base+0x180> |
| 19 | ./build.serial/./obsolete/parsmultistate.cpp:48 | 19 | ./build.serial/./obsolete/parsmultistate.cpp:48 |
| 20 | » sub····$0xc,%esp | 20 | » sub····$0xc,%esp |
| 21 | » mov····%eax,-0xf9c(%ebp) | 21 | » mov····%eax,-0xf9c(%ebp) |
| 22 | » mov····%esi,%ebx | 22 | » mov····%esi,%ebx |
| 23 | » push···%edi | 23 | » push···%edi |
| 24 | » call···161 | 24 | » call···161c00·<ParsTree::~ParsTree()@@Base> |
| 25 | » mov····-0xf9c(%ebp),%edi | 25 | » mov····-0xf9c(%ebp),%edi |
| 26 | » add····$0x10,%esp | 26 | » add····$0x10,%esp |
| 27 | » sub····$0xc,%esp | 27 | » sub····$0xc,%esp |
| 28 | » push···-0xfa0(%ebp) | 28 | » push···-0xfa0(%ebp) |
| 29 | » mov····%esi,%ebx | 29 | » mov····%esi,%ebx |
| 30 | » call···f3 | 30 | » call···f3e70·<Alignment::~Alignment()@@Base> |
| 31 | » add····$0x10,%esp | 31 | » add····$0x10,%esp |
| 32 | » mov····-0x1c(%ebp),%eax | 32 | » mov····-0x1c(%ebp),%eax |
| 33 | » sub····%gs:0x14,%eax | 33 | » sub····%gs:0x14,%eax |
| 34 | » jne····81331·<free@plt+0xc1> | 34 | » jne····81331·<free@plt+0xc1> |
| 35 | » sub····$0xc,%esp | 35 | » sub····$0xc,%esp |
| 36 | » push···%edi | 36 | » push···%edi |
| 37 | » call···80fc0·<_Unwind_Resume@plt> | 37 | » call···80fc0·<_Unwind_Resume@plt> |
| Offset 50, 27 lines modified | Offset 50, 27 lines modified | ||
| 50 | » mov····-0x1c(%ebp),%eax | 50 | » mov····-0x1c(%ebp),%eax |
| 51 | » sub····%gs:0x14,%eax | 51 | » sub····%gs:0x14,%eax |
| 52 | » jne····8132c·<free@plt+0xbc> | 52 | » jne····8132c·<free@plt+0xbc> |
| 53 | » sub····$0xc,%esp | 53 | » sub····$0xc,%esp |
| 54 | » push···-0xf9c(%ebp) | 54 | » push···-0xf9c(%ebp) |
| 55 | » call···80fc0·<_Unwind_Resume@plt> | 55 | » call···80fc0·<_Unwind_Resume@plt> |
| 56 | /usr/include/c++/14/bits/basic_ios.h:50 | 56 | /usr/include/c++/14/bits/basic_ios.h:50 |
| 57 | » call···51 | 57 | » call···512e40·<terraces::basic_bitvector<std::allocator<unsigned·int>·>*·std::__do_uninit_fill_n<terraces::basic_bitvector<std::allocator<unsigned·int>·>*,·unsigned·int,·terraces::basic_bitvector<std::allocator<unsigned·int>·>·>(terraces::basic_bitvector<std::allocator<unsigned·int>·>*,·unsigned·int,·terraces::basic_bitvector<std::allocator<unsigned·int>·>·const&)@@Base+0x180> |
| 58 | » call···51 | 58 | » call···512e40·<terraces::basic_bitvector<std::allocator<unsigned·int>·>*·std::__do_uninit_fill_n<terraces::basic_bitvector<std::allocator<unsigned·int>·>*,·unsigned·int,·terraces::basic_bitvector<std::allocator<unsigned·int>·>·>(terraces::basic_bitvector<std::allocator<unsigned·int>·>*,·unsigned·int,·terraces::basic_bitvector<std::allocator<unsigned·int>·>·const&)@@Base+0x180> |
| 59 | » call···51 | 59 | » call···512e40·<terraces::basic_bitvector<std::allocator<unsigned·int>·>*·std::__do_uninit_fill_n<terraces::basic_bitvector<std::allocator<unsigned·int>·>*,·unsigned·int,·terraces::basic_bitvector<std::allocator<unsigned·int>·>·>(terraces::basic_bitvector<std::allocator<unsigned·int>·>*,·unsigned·int,·terraces::basic_bitvector<std::allocator<unsigned·int>·>·const&)@@Base+0x180> |
| 60 | 00081336·<boost::wrapexcept<std::overflow_error>::rethrow()·const@@Base>: | 60 | 00081336·<boost::wrapexcept<std::overflow_error>::rethrow()·const@@Base>: |
| 61 | boost::wrapexcept<std::overflow_error>::rethrow()·const: | 61 | boost::wrapexcept<std::overflow_error>::rethrow()·const: |
| 62 | /usr/include/boost/throw_exception.hpp:123 | 62 | /usr/include/boost/throw_exception.hpp:123 |
| 63 | » push···%ebp | 63 | » push···%ebp |
| 64 | » mov····%esp,%ebp | 64 | » mov····%esp,%ebp |
| 65 | » push···%edi | 65 | » push···%edi |
| 66 | » push···%esi | 66 | » push···%esi |
| 67 | » call···e8 | 67 | » call···e8366·<std::ctype<char>::do_widen(char)·const@@Base+0x6> |
| 68 | » add····$0x61 | 68 | » add····$0x619724,%esi |
| 69 | » push···%ebx | 69 | » push···%ebx |
| 70 | » sub····$0x28,%esp | 70 | » sub····$0x28,%esp |
| 71 | /usr/include/boost/throw_exception.hpp:131 | 71 | /usr/include/boost/throw_exception.hpp:131 |
| 72 | » push···$0x24 | 72 | » push···$0x24 |
| 73 | » lea····-0x6ca8(%esi),%eax | 73 | » lea····-0x6ca8(%esi),%eax |
| 74 | » mov····%esi,%ebx | 74 | » mov····%esi,%ebx |
| 75 | » lea····-0x18(%eax),%edx | 75 | » lea····-0x18(%eax),%edx |
| Offset 124, 15 lines modified | Offset 124, 15 lines modified | ||
| 124 | /usr/include/boost/throw_exception.hpp:71·(discriminator·2) | 124 | /usr/include/boost/throw_exception.hpp:71·(discriminator·2) |
| 125 | » lea····-0x6c94(%esi),%eax | 125 | » lea····-0x6c94(%esi),%eax |
| 126 | /usr/include/boost/throw_exception.hpp:131·(discriminator·2) | 126 | /usr/include/boost/throw_exception.hpp:131·(discriminator·2) |
| 127 | » push···%edx | 127 | » push···%edx |
| 128 | /usr/include/boost/throw_exception.hpp:71·(discriminator·2) | 128 | /usr/include/boost/throw_exception.hpp:71·(discriminator·2) |
| 129 | » mov····%eax,0xc(%edi) | 129 | » mov····%eax,0xc(%edi) |
| 130 | /usr/include/boost/throw_exception.hpp:131·(discriminator·2) | 130 | /usr/include/boost/throw_exception.hpp:131·(discriminator·2) |
| 131 | » lea····-0x57 | 131 | » lea····-0x579774(%esi),%eax |
| 132 | » push···%eax | 132 | » push···%eax |
| 133 | » lea····-0x6ec8(%esi),%eax | 133 | » lea····-0x6ec8(%esi),%eax |
| 134 | » push···%eax | 134 | » push···%eax |
| 135 | » push···%edi | 135 | » push···%edi |
| 136 | /usr/include/boost/exception/exception.hpp:250·(discriminator·1) | 136 | /usr/include/boost/exception/exception.hpp:250·(discriminator·1) |
| 137 | » movq···%xmm2,-0x20(%ebp) | 137 | » movq···%xmm2,-0x20(%ebp) |
| 138 | » movq···%xmm2,0x14(%edi) | 138 | » movq···%xmm2,0x14(%edi) |
| Offset 165, 16 lines modified | Offset 165, 16 lines modified | ||
| 165 | 00081428·<boost::wrapexcept<std::domain_error>::rethrow()·const@@Base>: | 165 | 00081428·<boost::wrapexcept<std::domain_error>::rethrow()·const@@Base>: |
| 166 | boost::wrapexcept<std::domain_error>::rethrow()·const: | 166 | boost::wrapexcept<std::domain_error>::rethrow()·const: |
| 167 | /usr/include/boost/throw_exception.hpp:123 | 167 | /usr/include/boost/throw_exception.hpp:123 |
| 168 | » push···%ebp | 168 | » push···%ebp |
| 169 | » mov····%esp,%ebp | 169 | » mov····%esp,%ebp |
| 170 | » push···%edi | 170 | » push···%edi |
| 171 | » push···%esi | 171 | » push···%esi |
| 172 | » call···e8 | 172 | » call···e8366·<std::ctype<char>::do_widen(char)·const@@Base+0x6> |
| 173 | » add····$0x61 | 173 | » add····$0x619632,%esi |
| 174 | » push···%ebx | 174 | » push···%ebx |
| 175 | » sub····$0x28,%esp | 175 | » sub····$0x28,%esp |
| 176 | /usr/include/boost/throw_exception.hpp:131 | 176 | /usr/include/boost/throw_exception.hpp:131 |
| 177 | » push···$0x24 | 177 | » push···$0x24 |
| 178 | » lea····-0x6ce4(%esi),%eax | 178 | » lea····-0x6ce4(%esi),%eax |
| 179 | » mov····%esi,%ebx | 179 | » mov····%esi,%ebx |
| 180 | » lea····-0x18(%eax),%edx | 180 | » lea····-0x18(%eax),%edx |
| Offset 228, 15 lines modified | Offset 228, 15 lines modified | ||
| 228 | /usr/include/boost/throw_exception.hpp:71·(discriminator·2) | 228 | /usr/include/boost/throw_exception.hpp:71·(discriminator·2) |
| 229 | » lea····-0x6cd0(%esi),%eax | 229 | » lea····-0x6cd0(%esi),%eax |
| 230 | /usr/include/boost/throw_exception.hpp:131·(discriminator·2) | 230 | /usr/include/boost/throw_exception.hpp:131·(discriminator·2) |
| 231 | » push···%edx | 231 | » push···%edx |
| 232 | /usr/include/boost/throw_exception.hpp:71·(discriminator·2) | 232 | /usr/include/boost/throw_exception.hpp:71·(discriminator·2) |
| 233 | » mov····%eax,0xc(%edi) | 233 | » mov····%eax,0xc(%edi) |
| 234 | /usr/include/boost/throw_exception.hpp:131·(discriminator·2) | 234 | /usr/include/boost/throw_exception.hpp:131·(discriminator·2) |
| 235 | » lea····-0x5789 | 235 | » lea····-0x579894(%esi),%eax |
| 236 | » push···%eax | 236 | » push···%eax |
| 237 | » lea····-0x6ef0(%esi),%eax | 237 | » lea····-0x6ef0(%esi),%eax |
| 238 | » push···%eax | 238 | » push···%eax |
| 239 | » push···%edi | 239 | » push···%edi |
| 240 | /usr/include/boost/exception/exception.hpp:250·(discriminator·1) | 240 | /usr/include/boost/exception/exception.hpp:250·(discriminator·1) |
| 241 | » movq···%xmm2,-0x20(%ebp) | 241 | » movq···%xmm2,-0x20(%ebp) |
| 242 | » movq···%xmm2,0x14(%edi) | 242 | » movq···%xmm2,0x14(%edi) |
| Offset 268, 16 lines modified | Offset 268, 16 lines modified | ||
| 268 | 0008151a·<boost::wrapexcept<boost::math::rounding_error>::rethrow()·const@@Base>: | 268 | 0008151a·<boost::wrapexcept<boost::math::rounding_error>::rethrow()·const@@Base>: |
| 269 | boost::wrapexcept<boost::math::rounding_error>::rethrow()·const: | 269 | boost::wrapexcept<boost::math::rounding_error>::rethrow()·const: |
| 270 | /usr/include/boost/throw_exception.hpp:123 | 270 | /usr/include/boost/throw_exception.hpp:123 |
| 271 | » push···%ebp | 271 | » push···%ebp |
| 272 | » mov····%esp,%ebp | 272 | » mov····%esp,%ebp |
| 273 | » push···%edi | 273 | » push···%edi |
| 274 | » call···12fb | 274 | » call···12fbed·<Eigen::ScalarBinaryOpTraits<double,·Eigen::internal::traits<Eigen::Block<Eigen::Inverse<Eigen::FullPivLU<Eigen::Matrix<double,·-1,·-1,·0,·-1,·-1>·>·>·const,·-1,·1,·true>·>::Scalar,·Eigen::internal::scalar_product_op<double,·Eigen::internal::traits<Eigen::Block<Eigen::Inverse<Eigen::FullPivLU<Eigen::Matrix<double,·-1,·-1,·0,·-1,·-1>·>·>·const,·-1,·1,·true>·>::Scalar>·>::ReturnType·Eigen::MatrixBase<Eigen::Block<Eigen::Transpose<Eigen::Matrix<double,·-1,·1,·0,·-1,·1>·>·const,·1,·-1,·true>·>::dot<Eigen::Block<Eigen::Inverse<Eigen::FullPivLU<Eigen::Matrix<double,·-1,·-1,·0,·-1,·-1>·>·>·const,·-1,·1,·true>·>(Eigen::MatrixBase<Eigen::Block<Eigen::Inverse<Eigen::FullPivLU<Eigen::Matrix<double,·-1,·-1,·0,·-1,·-1>·>·>·const,·-1,·1,·true>·>·const&)·const@@Base+0x76d> |
| 275 | » add····$0x61 | 275 | » add····$0x619541,%edi |
| 276 | » push···%esi | 276 | » push···%esi |
| 277 | » push···%ebx | 277 | » push···%ebx |
| 278 | » sub····$0x38,%esp | 278 | » sub····$0x38,%esp |
| 279 | /usr/include/boost/throw_exception.hpp:131 | 279 | /usr/include/boost/throw_exception.hpp:131 |
| 280 | » push···$0x24 | 280 | » push···$0x24 |
| 281 | » lea····-0x6c6c(%edi),%eax | 281 | » lea····-0x6c6c(%edi),%eax |
| 282 | » mov····%edi,%ebx | 282 | » mov····%edi,%ebx |
| Offset 332, 15 lines modified | Offset 332, 15 lines modified | ||
| 332 | /usr/include/boost/throw_exception.hpp:71·(discriminator·2) | 332 | /usr/include/boost/throw_exception.hpp:71·(discriminator·2) |
| 333 | » lea····-0x6c58(%edi),%eax | 333 | » lea····-0x6c58(%edi),%eax |
| 334 | /usr/include/boost/throw_exception.hpp:131·(discriminator·2) | 334 | /usr/include/boost/throw_exception.hpp:131·(discriminator·2) |
| 335 | » push···%edx | 335 | » push···%edx |
| Max diff block lines reached; 84694297/84703807 bytes (99.99%) of diff not shown. | |||
| Offset 1, 14 lines modified | Offset 1, 14 lines modified | ||
| 1 | Disassembly·of·section·.fini: | 1 | Disassembly·of·section·.fini: |
| 2 | 0051 | 2 | 00512e54·<.fini>: |
| 3 | _fini(): | 3 | _fini(): |
| 4 | » push···%ebx | 4 | » push···%ebx |
| 5 | » sub····$0x8,%esp | 5 | » sub····$0x8,%esp |
| 6 | » call···e7 | 6 | » call···e7e60·<_start@@Base+0x30> |
| 7 | » add····$0x187 | 7 | » add····$0x187c07,%ebx |
| 8 | » add····$0x8,%esp | 8 | » add····$0x8,%esp |
| 9 | » pop····%ebx | 9 | » pop····%ebx |
| 10 | » ret | 10 | » ret |
| Offset 1, 50213 lines modified | Offset 1, 50227 lines modified | ||
| Diff chunk too large, falling back to line-by-line diff (9717 lines added, 9973 lines removed) | |||
| 1 | Hex·dump·of·section·'.rodata': | 1 | Hex·dump·of·section·'.rodata': |
| 2 | ··0x0051 | 2 | ··0x00513000·03000000·01000200·0000805f·0000803f·..........._...? |
| 3 | ··0x0051 | 3 | ··0x00513010·00000040·00004040·60c7223e·0000c03f·...@..@@`.">...? |
| 4 | ··0x0051 | 4 | ··0x00513020·1035073f·d06ee73e·000000bf·0000003f·.5.?.n.>.......? |
| 5 | ··0x0051 | 5 | ··0x00513030·0000903f·e0c0853f·0000dc42·d0d6cf3e·...?...?...B...> |
| 6 | ··0x0051 | 6 | ··0x00513040·00002040·f0b8013f·00009040·00006040·..·@...?...@..`@ |
| 7 | ··0x0051 | 7 | ··0x00513050·20630a3f·d0e90e3f·00001041·0000c842··c.?...?...A...B |
| 8 | ··0x0051 | 8 | ··0x00513060·00004842·00703146·006c3146·006c31c6·..HB.p1F.l1F.l1. |
| 9 | ··0x0051 | 9 | ··0x00513070·f9021550·006ce63c·b099833f·0000a0c1·...P.l.<...?.... |
| 10 | ··0x0051 | 10 | ··0x00513080·00002a43·0000803e·00008040·00007041·..*C...>...@..pA |
| 11 | ··0x0051 | 11 | ··0x00513090·0000a041·00002041·00001643·00004041·...A..·A...C..@A |
| 12 | ··0x0051 | 12 | ··0x005130a0·00009043·0000f041·0000004f·000000cf·...C...A...O.... |
| 13 | ··0x0051 | 13 | ··0x005130b0·00007a44·0000403f·00004843·0000005f·..zD..@?..HC..._ |
| 14 | ··0x0051 | 14 | ··0x005130c0·00002042·00504347·00008025·0000c843·..·B.PCG...%...C |
| 15 | ··0x0051 | 15 | ··0x005130d0·0000c07f·00008035·000000c0·0000807f·.......5........ |
| 16 | ··0x0051 | 16 | ··0x005130e0·00000000·00401c46·002474c9·010e020d·.....@.F.$t..... |
| 17 | ··0x0051 | 17 | ··0x005130f0·0b0a0c02·0e05010f·13111612·00007042·..............pB |
| 18 | ··0x0051 | 18 | ··0x00513100·000080ff·00247449·0000803a·00008030·.....$tI...:...0 |
| 19 | ··0x0051 | 19 | ··0x00513110·0000a040·00007043·00003041·0000c040·...@..pC..0A...@ |
| 20 | ··0x0051 | 20 | ··0x00513120·0050c347·00007ac4·0000802f·000080ce·.P.G..z..../.... |
| 21 | ··0x0051 | 21 | ··0x00513130·000040bf·000080bf·0000e0be·00008032·..@............2 |
| 22 | ··0x0051 | 22 | ··0x00513140·000020c2·00009841·00008039·0000803b·..·....A...9...; |
| 23 | ··0x0051 | 23 | ··0x00513150·0000d841·00406244·0000a242·0000e040·...A.@bD...B...@ |
| 24 | ··0x0051 | 24 | ··0x00513160·00009041·0000b842·00007543·0000e041·...A...B..uC...A |
| 25 | ··0x0051 | 25 | ··0x00513170·00006842·00000444·0000ee42·00008041·..hB...D...B...A |
| 26 | ··0x0051 | 26 | ··0x00513180·00006041·00002c42·00808e43·00000842·..`A..,B...C...B |
| 27 | ··0x0051 | 27 | ··0x00513190·0000c043·00008c42·0000b841·00007743·...C...B...A..wC |
| 28 | ··0x0051 | 28 | ··0x005131a0·00000643·00006c42·0000d242·00988a45·...C..lB...B...E |
| 29 | ··0x0051 | 29 | ··0x005131b0·0080bd43·0000e841·00005a43·0080a343·...C...A..ZC...C |
| 30 | ··0x0051 | 30 | ··0x005131c0·00409644·00000042·00005844·0000b041·.@.D...B..XD...A |
| 31 | ··0x0051 | 31 | ··0x005131d0·00004a43·0000fa43·00003042·0000a143·..JC...C..0B...C |
| 32 | ··0x0051 | 32 | ··0x005131e0·0000ae42·00401a44·003c1cc6·0000a842·...B.@.D.<.....B |
| 33 | ··0x0051 | 33 | ··0x005131f0·00000c43·00005243·0000d243·00c09f44·...C..RC...C...D |
| 34 | ··0x0051 | 34 | ··0x00513200·00a08e44·00807144·00c03744·00801d45·...D..qD..7D...E |
| 35 | ··0x0051 | 35 | ··0x00513210·00006944·00c03044·0000e743·0080d944·..iD..0D...C...D |
| 36 | ··0x0051 | 36 | ··0x00513220·00405e44·00009343·00c09344·00002844·.@^D...C...D..(D |
| 37 | ··0x0051 | 37 | ··0x00513230·00007c43·00809d45·00801744·00002f43·..|C...E...D../C |
| 38 | ··0x0051 | 38 | ··0x00513240·00008443·0000fe42·0000ad43·0000f042·...C...B...C...B |
| 39 | ··0x0051 | 39 | ··0x00513250·0000c642·00406c46·0040ec46·00005245·...B.@lF.@.F..RE |
| 40 | ··0x0051 | 40 | ··0x00513260·0000bd44·005a8748·c0f7034b·00006042·...D.Z.H...K..`B |
| 41 | ··0x0051 | 41 | ··0x00513270·00e0c446·00a2f349·c0f7834b·00807745·...F...I...K..wE |
| 42 | ··0x0051 | 42 | ··0x00513280·c0f7034a·fa56904d·0000b442·0090d847·...J.V.M...B...G |
| 43 | ··0x0051 | 43 | ··0x00513290·90f1e64b·8870f74e·00f07f46·98cb1b4c·...K.p.N...F...L |
| 44 | ··0x0051 | 44 | ··0x005132a0·00003643·009c6a49·00000026·00008059·..6C..jI...&...Y |
| 45 | ··0x0051 | 45 | ··0x005132b0·0000800b·000080c0·000080be·00c07944·..............yD |
| 46 | ··0x0051 | 46 | ··0x005132c0·0000804e·00008049·00008034·0000801f·...N...I...4.... |
| 47 | ··0x0051 | 47 | ··0x005132d0·0000803d·0000a441·0000203f·00000443·...=...A..·?...C |
| 48 | ··0x0051 | 48 | ··0x005132e0·00905846·006c2248·746f7461·6c206c65·..XF.l"Htotal·le |
| 49 | ··0x0051 | 49 | ··0x005132f0·6e677468·3a20006d·65616e20·6c656e67·ngth:·.mean·leng |
| 50 | ··0x0051 | 50 | ··0x00513300·74683a20·00506172·73696d6f·6e792073·th:·.Parsimony·s |
| 51 | ··0x0051 | 51 | ··0x00513310·636f7265·2069733a·20004572·726f7220·core·is:·.Error· |
| 52 | ··0x0051 | 52 | ··0x00513320·666f756e·64206174·206c696e·6520002c·found·at·line·., |
| 53 | ··0x0051 | 53 | ··0x00513330·20636f6c·756d6e20·00202866·696c6520··column·.·(file· |
| 54 | ··0x0051 | 54 | ··0x00513340·706f7369·74696f6e·2000293a·00736875·position·.):.shu |
| 55 | ··0x0051 | 55 | ··0x00513350·66666c65·416c6967·6e6d656e·7400496e·ffleAlignment.In |
| 56 | ··0x0051 | 56 | ··0x00513360·7465726e·616c2065·72726f72·3a200062·ternal·error:·.b |
| 57 | ··0x0051 | 57 | ··0x00513370·61736963·5f737472·696e673a·3a617070·asic_string::app |
| 58 | ··0x0051 | 58 | ··0x00513380·656e6400·2e2f616c·69676e6d·656e742f·end../alignment/ |
| 59 | ··0x0051 | 59 | ··0x00513390·616c6967·6e6d656e·742e6370·7000416c·alignment.cpp.Al |
| 60 | ··0x0051 | 60 | ··0x005133a0·69676e6d·656e7420·66696c65·20697320·ignment·file·is· |
| 61 | ··0x0051 | 61 | ··0x005133b0·746f6f20·73686f72·742e0073·74617465·too·short..state |
| 62 | ··0x0051 | 62 | ··0x005133c0·3a202020·20202020·20202020·20202000·:··············. |
| 63 | ··0x0051 | 63 | ··0x005133d0·706f6d6f·5f73616d·706c6564·5f737461·pomo_sampled_sta |
| 64 | ··0x0051 | 64 | ··0x005133e0·7465732e·73697a65·28293a20·00737461·tes.size():·.sta |
| 65 | ··0x0051 | 65 | ··0x005133f0·7465203c·206e756d·5f737461·74657300·te·<·num_states. |
| 66 | ··0x0051 | 66 | ··0x00513400·70616972·5f667265·71007365·715f6964·pair_freq.seq_id |
| 67 | ··0x0051 | 67 | ··0x00513410·203c2067·65744e53·65712829·0067656e··<·getNSeq().gen |
| 68 | ··0x0051 | 68 | ··0x00513420·65746963·5f636f64·65002e2f·6e636c2f·etic_code../ncl/ |
| 69 | ··0x0051 | 69 | ··0x00513430·6e787363·68617261·63746572·73626c6f·nxscharactersblo |
| 70 | ··0x0051 | 70 | ··0x00513440·636b2e68·0073796d·626f6c73·0070203c·ck.h.symbols.p·< |
| 71 | ··0x0051 | 71 | ··0x00513450·20737472·6c656e28·73796d62·6f6c7329··strlen(symbols) |
| 72 | ··0x0051 | 72 | ··0x00513460·00206861·7320696e·76616c69·64207369·.·has·invalid·si |
| 73 | ··0x0051 | 73 | ··0x00513470·6e676c65·20737461·74652000·20617420·ngle·state·.·at· |
| 74 | ··0x0051 | 74 | ··0x00513480·73697465·20002320·416c6967·6e6d656e·site·.#·Alignmen |
| 75 | ··0x0051 | 75 | ··0x00513490·74207369·74652073·74617469·73746963·t·site·statistic |
| 76 | ··0x0051 | 76 | ··0x005134a0·73002320·20207461·623d7265·61642e74·s.#···tab=read.t |
| 77 | ··0x0051 | 77 | ··0x005134b0·61626c65·28270023·20202050·6172743a·able('.#···Part: |
| 78 | ··0x0051 | 78 | ··0x005134c0·20202050·61727469·74696f6e·20494400····Partition·ID. |
| 79 | ··0x0051 | 79 | ··0x005134d0·23202020·53697465·3a202020·53697465·#···Site:···Site |
| 80 | ··0x0051 | 80 | ··0x005134e0·20494400·50617274·09005369·74650953··ID.Part..Site.S |
| 81 | ··0x0051 | 81 | ··0x005134f0·74617400·53544154·455f554e·4b4e4f57·tat.STATE_UNKNOW |
| 82 | ··0x0051 | 82 | ··0x00513500·4e203c20·31323600·636f646f·6e5f7461·N·<·126.codon_ta |
| 83 | ··0x0051 | 83 | ··0x00513510·626c6500·4e4f5445·3a205374·61746528·ble.NOTE:·State( |
| 84 | ··0x0051 | 84 | ··0x00513520·73292000·206e6f74·20707265·73656e74·s)·.·not·present |
| 85 | ··0x0051 | 85 | ··0x00513530·20696e20·00574152·4e494e47·3a205374··in·.WARNING:·St |
| 86 | ··0x0051 | 86 | ··0x00513540·61746573·28732920·00207261·72656c79·ates(s)·.·rarely |
| 87 | ··0x0051 | 87 | ··0x00513550·20617070·65617220·696e2000·57726f6e··appear·in·.Wron |
| 88 | ··0x0051 | 88 | ··0x00513560·67206765·6e657469·6320636f·64652000·g·genetic·code·. |
| 89 | ··0x0051 | 89 | ··0x00513570·7374726c·656e2867·656e6574·69635f63·strlen(genetic_c |
| 90 | ··0x0051 | 90 | ··0x00513580·6f646529·203d3d20·36340042·494e0050·ode)·==·64.BIN.P |
| 91 | ··0x0051 | 91 | ··0x00513590·524f5400·4e543241·41004d4f·52504800·ROT.NT2AA.MORPH. |
| 92 | ··0x0051 | 92 | ··0x005135a0·54494e41·004d554c·54490043·4f444f4e·TINA.MULTI.CODON |
| 93 | ··0x0051 | 93 | ··0x005135b0·00222069·6e737465·61640073·74617465·."·instead.state |
| 94 | ··0x0051 | 94 | ··0x005135c0·3c323300·69735f69·6e766172·69616e74·<23.is_invariant |
| 95 | ··0x0051 | 95 | ··0x005135d0·203e3d20·69735f63·6f6e7374·00456d70··>=·is_const.Emp |
| 96 | ··0x0051 | 96 | ··0x005135e0·69726963·616c2073·74617465·20667265·irical·state·fre |
| 97 | ··0x0051 | 97 | ··0x005135f0·7175656e·63696573·3a200066·61627328·quencies:·.fabs( |
| 98 | ··0x0051 | 98 | ··0x00513600·73756d2d·312e3029·3c31652d·3500556e·sum-1.0)<1e-5.Un |
| 99 | ··0x0051 | 99 | ··0x00513610·73757070·6f727465·6420636f·646f6e20·supported·codon· |
| 100 | ··0x0051 | 100 | ··0x00513620·66726571·75656e63·79006e73·69746520·frequency.nsite· |
| 101 | ··0x0051 | 101 | ··0x00513630·3d3d2072·6566416c·69676e2e·6765744e·==·refAlign.getN |
| 102 | ··0x0051 | 102 | ··0x00513640·53697465·28290073·697a6528·29203d3d·Site().size()·== |
| 103 | ··0x0051 | 103 | ··0x00513650·20706174·7465726e·5f667265·712e7369··pattern_freq.si |
| 104 | ··0x0051 | 104 | ··0x00513660·7a652829·004e4f54·453a204c·696e6520·ze().NOTE:·Line· |
| 105 | ··0x0051 | 105 | ··0x00513670·00626173·69635f73·7472696e·673a3a73·.basic_string::s |
| 106 | ··0x0051 | 106 | ··0x00513680·75627374·72003a20·556e7265·636f676e·ubstr.:·Unrecogn |
| 107 | ··0x0051 | 107 | ··0x00513690·697a6564·20636861·72616374·65722000·ized·character·. |
| 108 | ··0x0051 | 108 | ··0x005136a0·53697465·5f476170·20200053·6974655f·Site_Gap··.Site_ |
| 109 | ··0x0051 | 109 | ··0x005136b0·416d6269·20005369·74652067·61702d63·Ambi·.Site·gap-c |
| 110 | ··0x0051 | 110 | ··0x005136c0·6f756e74·73207072·696e7465·6420746f·ounts·printed·to |
| 111 | ··0x0051 | 111 | ··0x005136d0·2000416c·69676e6d·656e7420·77617320··.Alignment·was· |
| 112 | ··0x0051 | 112 | ··0x005136e0·7072696e·74656420·746f2000·5741524e·printed·to·.WARN |
| 113 | ··0x0051 | 113 | ··0x005136f0·494e473a·20496465·6e746963·616c2073·ING:·Identical·s |
| 114 | ··0x0051 | 114 | ··0x00513700·65717565·6e636573·20006c6f·674c4c2e·equences·.logLL. |
| 115 | ··0x0051 | 115 | ··0x00513710·73697a65·2829203d·3d207061·744e756d·size()·==·patNum |
| 116 | ··0x0051 | 116 | ··0x00513720·00526561·64696e67·20736974·6520706f·.Reading·site·po |
| 117 | ··0x0051 | 117 | ··0x00513730·73697469·6f6e206c·69737420·0052616e·sition·list·.Ran |
| 118 | ··0x0051 | 118 | ··0x00513740·6765206d·75737420·62652070·6f736974·ge·must·be·posit |
| 119 | ··0x0051 | 119 | ··0x00513750·69766500·236e6578·75730062·6567696e·ive.#nexus.begin |
| 120 | ··0x0051 | 120 | ··0x00513760·20646174·613b0020·2064696d·656e7369··data;.··dimensi |
| 121 | ··0x0051 | 121 | ··0x00513770·6f6e7320·6e746178·3d00206e·63686172·ons·ntax=.·nchar |
| 122 | ··0x0051 | 122 | ··0x00513780·3d002020·666f726d·61742064·61746174·=.··format·datat |
| 123 | ··0x0051 | 123 | ··0x00513790·7970653d·006e7563·6c656f74·69646500·ype=.nucleotide. |
| 124 | ··0x0051 | 124 | ··0x005137a0·7374616e·64617264·0070726f·7465696e·standard.protein |
| 125 | ··0x0051 | 125 | ··0x005137b0·00206d69·7373696e·673d3f20·6761703d·.·missing=?·gap= |
| Max diff block lines reached; 5401187/6720542 bytes (80.37%) of diff not shown. | |||
| Offset 1, 3556 lines modified | Offset 1, 3556 lines modified | ||
| Diff chunk too large, falling back to line-by-line diff (3553 lines added, 3553 lines removed) | |||
| 1 | Hex·dump·of·section·'.eh_frame_hdr': | 1 | Hex·dump·of·section·'.eh_frame_hdr': |
| 2 | ··0x005d | 2 | ··0x005d72f8·011b033b·08de0000·c01b0000·288daaff·...;........(... |
| 3 | ··0x005d | 3 | ··0x005d7308·50de0000·689faaff·74de0000·889faaff·P...h...t....... |
| 4 | ··0x005d | 4 | ··0x005d7318·f8de0000·3ea0aaff·e4e60000·30a1aaff·....>.......0... |
| 5 | ··0x005d | 5 | ··0x005d7328·10e70000·22a2aaff·3ce70000·1aa3aaff·...."...<....... |
| 6 | ··0x005d | 6 | ··0x005d7338·68e70000·12a4aaff·e0ef0000·34a4aaff·h...........4... |
| 7 | ··0x005d | 7 | ··0x005d7348·50f00000·64a4aaff·70f00000·24a5aaff·P...d...p...$... |
| 8 | ··0x005d | 8 | ··0x005d7358·a8f10000·a6a5aaff·80f20000·4ea6aaff·............N... |
| 9 | ··0x005d | 9 | ··0x005d7368·a0f70000·aca6aaff·dcf90000·b2a6aaff·................ |
| 10 | ··0x005d | 10 | ··0x005d7378·30fa0000·90a7aaff·ecfa0000·aca7aaff·0............... |
| 11 | ··0x005d | 11 | ··0x005d7388·50fe0000·4da8aaff·28ff0000·90a9aaff·P...M...(....... |
| 12 | ··0x005d | 12 | ··0x005d7398·9c010100·96a9aaff·c0030100·1caaaaff·................ |
| 13 | ··0x005d | 13 | ··0x005d73a8·30040100·98abaaff·94040100·e6abaaff·0............... |
| 14 | ··0x005d | 14 | ··0x005d73b8·24070100·06acaaff·88070100·36adaaff·$...........6... |
| 15 | ··0x005d | 15 | ··0x005d73c8·28090100·3cadaaff·480a0100·50adaaff·(...<...H...P... |
| 16 | ··0x005d | 16 | ··0x005d73d8·980b0100·6cadaaff·b00e0100·76adaaff·....l.......v... |
| 17 | ··0x005d | 17 | ··0x005d73e8·840f0100·80adaaff·10110100·c0adaaff·................ |
| 18 | ··0x005d | 18 | ··0x005d73f8·d4110100·e8adaaff·6c120100·f9adaaff·........l....... |
| 19 | ··0x005d | 19 | ··0x005d7408·1c130100·9eb0aaff·e4140100·82b1aaff·................ |
| 20 | ··0x005d | 20 | ··0x005d7418·80190100·9cb3aaff·ec190100·0cb5aaff·................ |
| 21 | ··0x005d | 21 | ··0x005d7428·501a0100·9cb6aaff·001d0100·b4b6aaff·P............... |
| 22 | ··0x005d | 22 | ··0x005d7438·541d0100·08b7aaff·b01d0100·ceb7aaff·T............... |
| 23 | ··0x005d | 23 | ··0x005d7448·101e0100·96b8aaff·701e0100·82bcaaff·........p....... |
| 24 | ··0x005d | 24 | ··0x005d7458·dc1e0100·2cbdaaff·401f0100·d6bdaaff·....,...@....... |
| 25 | ··0x005d | 25 | ··0x005d7468·a41f0100·16bfaaff·50210100·80c2aaff·........P!...... |
| 26 | ··0x005d | 26 | ··0x005d7478·cc210100·18c4aaff·ac260100·80c7aaff·.!.......&...... |
| 27 | ··0x005d | 27 | ··0x005d7488·10270100·78caaaff·b02c0100·e6caaaff·.'..x....,...... |
| 28 | ··0x005d | 28 | ··0x005d7498·4c2d0100·faccaaff·1c2f0100·32cdaaff·L-......./..2... |
| 29 | ··0x005d | 29 | ··0x005d74a8·643d0100·9ccdaaff·203f0100·fccdaaff·d=......·?...... |
| 30 | ··0x005d | 30 | ··0x005d74b8·f43f0100·12ceaaff·d8430100·30cfaaff·.?.......C..0... |
| 31 | ··0x005d | 31 | ··0x005d74c8·a4450100·64d0aaff·18460100·76d1aaff·.E..d....F..v... |
| 32 | ··0x005d | 32 | ··0x005d74d8·74460100·5ad3aaff·d0460100·c0d3aaff·tF..Z....F...... |
| 33 | ··0x005d | 33 | ··0x005d74e8·2c470100·92d4aaff·88470100·d6d4aaff·,G.......G...... |
| 34 | ··0x005d | 34 | ··0x005d74f8·e4470100·9ed5aaff·3c480100·3ad6aaff·.G......<H..:... |
| 35 | ··0x005d | 35 | ··0x005d7508·9c480100·eed6aaff·f8480100·6adcaaff·.H.......H..j... |
| 36 | ··0x005d | 36 | ··0x005d7518·90490100·f4e1aaff·344a0100·10e6aaff·.I......4J...... |
| 37 | ··0x005d | 37 | ··0x005d7528·b44a0100·54edaaff·484b0100·98f1aaff·.J..T...HK...... |
| 38 | ··0x005d | 38 | ··0x005d7538·d44b0100·b4f7aaff·644c0100·e806abff·.K......dL...... |
| 39 | ··0x005d | 39 | ··0x005d7548·e04c0100·e417abff·b84d0100·001babff·.L.......M...... |
| 40 | ··0x005d | 40 | ··0x005d7558·204e0100·4c1babff·804e0100·a21babff··N..L....N...... |
| 41 | ··0x005d | 41 | ··0x005d7568·f44e0100·4e1cabff·504f0100·d81cabff·.N..N...PO...... |
| 42 | ··0x005d | 42 | ··0x005d7578·ac4f0100·241dabff·04500100·9a1dabff·.O..$....P...... |
| 43 | ··0x005d | 43 | ··0x005d7588·5c500100·ce1dabff·c8500100·1420abff·\P.......P...·.. |
| 44 | ··0x005d | 44 | ··0x005d7598·2c510100·ae20abff·88510100·ce21abff·,Q...·...Q...!.. |
| 45 | ··0x005d | 45 | ··0x005d75a8·ec510100·d024abff·4c520100·fe24abff·.Q...$..LR...$.. |
| 46 | ··0x005d | 46 | ··0x005d75b8·a8520100·da25abff·08530100·8a26abff·.R...%...S...&.. |
| 47 | ··0x005d | 47 | ··0x005d75c8·64530100·dc26abff·c4530100·2c27abff·dS...&...S..,'.. |
| 48 | ··0x005d | 48 | ··0x005d75d8·2c540100·f828abff·c0540100·eb2eabff·,T...(...T...... |
| 49 | ··0x005d | 49 | ··0x005d75e8·18fb0000·212fabff·44290100·a82fabff·....!/..D).../.. |
| 50 | ··0x005d | 50 | ··0x005d75f8·b8290100·2f30abff·28360100·b630abff·.)../0..(6...0.. |
| 51 | ··0x005d | 51 | ··0x005d7608·1c560100·c630abff·0c5b0100·da30abff·.V...0...[...0.. |
| 52 | ··0x005d | 52 | ··0x005d7618·645b0100·ee30abff·c85e0100·0431abff·d[...0...^...1.. |
| 53 | ··0x005d | 53 | ··0x005d7628·bc640100·2e31abff·14650100·5831abff·.d...1...e..X1.. |
| 54 | ··0x005d | 54 | ··0x005d7638·9c690100·8231abff·cc6c0100·e031abff·.i...1...l...1.. |
| 55 | ··0x005d | 55 | ··0x005d7648·f06d0100·3e32abff·646e0100·3a34abff·.m..>2..dn..:4.. |
| 56 | ··0x005d65 | 56 | ··0x005d7658·646f0100·4434abff·e0700100·5c34abff·do..D4...p..\4.. |
| 57 | ··0x005d6 | 57 | ··0x005d7668·54770100·6a35abff·b4770100·ce35abff·Tw..j5...w...5.. |
| 58 | ··0x005d | 58 | ··0x005d7678·10780100·2236abff·6c780100·8636abff·.x.."6..lx...6.. |
| 59 | ··0x005d | 59 | ··0x005d7688·a87c0100·9036abff·007d0100·da36abff·.|...6...}...6.. |
| 60 | ··0x005d | 60 | ··0x005d7698·587d0100·2637abff·d87d0100·2c37abff·X}..&7...}..,7.. |
| 61 | ··0x005d | 61 | ··0x005d76a8·687e0100·4037abff·a4800100·6637abff·h~..@7......f7.. |
| 62 | ··0x005d | 62 | ··0x005d76b8·30820100·f237abff·84830100·f837abff·0....7.......7.. |
| 63 | ··0x005d | 63 | ··0x005d76c8·e8830100·1e39abff·78870100·3639abff·.....9..x...69.. |
| 64 | ··0x005d | 64 | ··0x005d76d8·50880100·5239abff·44890100·6639abff·P...R9..D...f9.. |
| 65 | ··0x005d | 65 | ··0x005d76e8·608a0100·7a39abff·448c0100·9239abff·`...z9..D....9.. |
| 66 | ··0x005d | 66 | ··0x005d76f8·cc910100·dc39abff·3c920100·f039abff·.....9..<....9.. |
| 67 | ··0x005d | 67 | ··0x005d7708·88940100·403aabff·9c950100·5a3aabff·....@:......Z:.. |
| 68 | ··0x005d | 68 | ··0x005d7718·60980100·603aabff·f0990100·6a3aabff·`...`:......j:.. |
| 69 | ··0x005d | 69 | ··0x005d7728·489a0100·e83aabff·a89a0100·123babff·H....:.......;.. |
| 70 | ··0x005d | 70 | ··0x005d7738·c49b0100·5c3babff·c09c0100·863babff·....\;.......;.. |
| 71 | ··0x005d | 71 | ··0x005d7748·1c9d0100·0a3cabff·b49e0100·843cabff·.....<.......<.. |
| 72 | ··0x005d | 72 | ··0x005d7758·2c9f0100·bc3dabff·989f0100·8c3eabff·,....=.......>.. |
| 73 | ··0x005d | 73 | ··0x005d7768·fc9f0100·5c3fabff·58a00100·9640abff·....\?..X....@.. |
| 74 | ··0x005d | 74 | ··0x005d7778·c0a00100·a641abff·24a10100·0243abff·.....A..$....C.. |
| 75 | ··0x005d | 75 | ··0x005d7788·98a10100·0c44abff·3ca20100·5044abff·.....D..<...PD.. |
| 76 | ··0x005d | 76 | ··0x005d7798·e4a20100·9044abff·8ca40100·9644abff·.....D.......D.. |
| 77 | ··0x005d | 77 | ··0x005d77a8·40a80100·9c44abff·5ca90100·a645abff·@....D..\....E.. |
| 78 | ··0x005d | 78 | ··0x005d77b8·74aa0100·9846abff·f0ab0100·5a47abff·t....F......ZG.. |
| 79 | ··0x005d | 79 | ··0x005d77c8·68ad0100·1248abff·d8ad0100·d848abff·h....H.......H.. |
| 80 | ··0x005d | 80 | ··0x005d77d8·50ae0100·c24babff·20b10100·de4babff·P....K..·....K.. |
| 81 | ··0x005d | 81 | ··0x005d77e8·5cb20100·7c4cabff·b8b20100·924cabff·\...|L.......L.. |
| 82 | ··0x005d | 82 | ··0x005d77f8·c4b30100·764dabff·28b40100·aa4dabff·....vM..(....M.. |
| 83 | ··0x005d | 83 | ··0x005d7808·ecb40100·564eabff·60b50100·3a4fabff·....VN..`...:O.. |
| 84 | ··0x005d | 84 | ··0x005d7818·c4b70100·fa4fabff·3cb80100·1451abff·.....O..<....Q.. |
| 85 | ··0x005d | 85 | ··0x005d7828·18ba0100·a451abff·64bb0100·ac51abff·.....Q..d....Q.. |
| 86 | ··0x005d | 86 | ··0x005d7838·14bc0100·b251abff·68bc0100·5252abff·.....Q..h...RR.. |
| 87 | ··0x005d | 87 | ··0x005d7848·60bd0100·d252abff·bcbd0100·0a54abff·`....R.......T.. |
| 88 | ··0x005d | 88 | ··0x005d7858·18be0100·4255abff·74be0100·5e57abff·....BU..t...^W.. |
| 89 | ··0x005d | 89 | ··0x005d7868·0cc20100·ca57abff·78c20100·b858abff·.....W..x....X.. |
| 90 | ··0x005d | 90 | ··0x005d7878·f8c60100·c058abff·9cc80100·f858abff·.....X.......X.. |
| 91 | ··0x005d | 91 | ··0x005d7888·e8cd0100·e659abff·00cf0100·ec59abff·.....Y.......Y.. |
| 92 | ··0x005d | 92 | ··0x005d7898·74d10100·1e5aabff·54d30100·3c5babff·t....Z..T...<[.. |
| 93 | ··0x005d | 93 | ··0x005d78a8·c8d30100·9a5cabff·48d40100·cc5eabff·.....\..H....^.. |
| 94 | ··0x005d | 94 | ··0x005d78b8·7cd50100·f25eabff·f0d50100·0060abff·|....^.......`.. |
| 95 | ··0x005d | 95 | ··0x005d78c8·54d90100·4260abff·f8d90100·7c60abff·T...B`......|`.. |
| 96 | ··0x005d | 96 | ··0x005d78d8·f4da0100·8260abff·54de0100·0861abff·.....`..T....a.. |
| 97 | ··0x005d | 97 | ··0x005d78e8·3ce00100·2a61abff·e0e10100·8861abff·<...*a.......a.. |
| 98 | ··0x005d | 98 | ··0x005d78f8·64e20100·c461abff·f8e20100·bc63abff·d....a.......c.. |
| 99 | ··0x005d | 99 | ··0x005d7908·f8e50100·0c65abff·1ce70100·7c65abff·.....e......|e.. |
| 100 | ··0x005d | 100 | ··0x005d7918·f0e70100·de65abff·5ce80100·f867abff·.....e..\....g.. |
| 101 | ··0x005d | 101 | ··0x005d7928·fce80100·6e6dabff·38ea0100·a475abff·....nm..8....u.. |
| 102 | ··0x005d | 102 | ··0x005d7938·eceb0100·3276abff·44ec0100·9876abff·....2v..D....v.. |
| 103 | ··0x005d | 103 | ··0x005d7948·9cec0100·ca76abff·f8ec0100·fe76abff·.....v.......v.. |
| 104 | ··0x005d | 104 | ··0x005d7958·54ed0100·5c77abff·bced0100·d877abff·T...\w.......w.. |
| 105 | ··0x005d | 105 | ··0x005d7968·18ee0100·4078abff·b8ee0100·4678abff·....@x......Fx.. |
| 106 | ··0x005d | 106 | ··0x005d7978·c4f40100·6878abff·94f80100·c678abff·....hx.......x.. |
| 107 | ··0x005d | 107 | ··0x005d7988·94f90100·9279abff·08fa0100·6e7aabff·.....y......nz.. |
| 108 | ··0x005d | 108 | ··0x005d7998·b4fb0100·7e7aabff·1cfc0100·aa7aabff·....~z.......z.. |
| 109 | ··0x005d | 109 | ··0x005d79a8·00fd0100·b07aabff·8cff0100·b67aabff·.....z.......z.. |
| 110 | ··0x005d | 110 | ··0x005d79b8·10020200·bc7aabff·84030200·c27aabff·.....z.......z.. |
| 111 | ··0x005d | 111 | ··0x005d79c8·04050200·de7aabff·2c060200·547babff·.....z..,...T{.. |
| 112 | ··0x005d | 112 | ··0x005d79d8·a0060200·947babff·f8060200·e07babff·.....{.......{.. |
| 113 | ··0x005d | 113 | ··0x005d79e8·c4070200·2e7cabff·24080200·9a7cabff·.....|..$....|.. |
| 114 | ··0x005d | 114 | ··0x005d79f8·7c080200·c47cabff·fc0a0200·dc7cabff·|....|.......|.. |
| 115 | ··0x005d | 115 | ··0x005d7a08·540c0200·f67cabff·a80c0200·0a7dabff·T....|.......}.. |
| 116 | ··0x005d | 116 | ··0x005d7a18·240e0200·087eabff·f80e0200·b87eabff·$....~.......~.. |
| 117 | ··0x005d | 117 | ··0x005d7a28·640f0200·5080abff·bc0f0200·ac80abff·d...P........... |
| 118 | ··0x005d | 118 | ··0x005d7a38·1c100200·5682abff·d0100200·8a85abff·....V........... |
| 119 | ··0x005d | 119 | ··0x005d7a48·10120200·9386abff·68120200·de86abff·........h....... |
| 120 | ··0x005d | 120 | ··0x005d7a58·a4130200·268aabff·10140200·c48babff·....&........... |
| 121 | ··0x005d | 121 | ··0x005d7a68·84140200·588dabff·e8140200·968eabff·....X........... |
| 122 | ··0x005d | 122 | ··0x005d7a78·50170200·e08eabff·98170200·148fabff·P............... |
| 123 | ··0x005d | 123 | ··0x005d7a88·f0170200·568fabff·4c180200·1c90abff·....V...L....... |
| 124 | ··0x005d | 124 | ··0x005d7a98·44190200·ec90abff·e01a0200·1691abff·D............... |
| 125 | ··0x005d | 125 | ··0x005d7aa8·3c1b0200·4091abff·941b0200·6a91abff·<...@.......j... |
| Max diff block lines reached; 0/476158 bytes (0.00%) of diff not shown. | |||
| Offset 1, 36751 lines modified | Offset 1, 36750 lines modified | ||
| Diff chunk too large, falling back to line-by-line diff (36747 lines added, 36748 lines removed) | |||
| 1 | Hex·dump·of·section·'.eh_frame': | 1 | Hex·dump·of·section·'.eh_frame': |
| 2 | ··0x005e | 2 | ··0x005e5104·14000000·00000000·017a5200·017c0801·.........zR..|.. |
| 3 | ··0x005e | 3 | ··0x005e5114·1b0c0404·88010708·10000000·1c000000·................ |
| 4 | ··0x005e | 4 | ··0x005e5124·0c2db0ff·2c000000·00000000·14000000·.-..,........... |
| 5 | ··0x005e | 5 | ··0x005e5134·00000000·017a5200·017c0801·1b0c0404·.....zR..|...... |
| 6 | ··0x005e | 6 | ··0x005e5144·88010000·20000000·1c000000·d0aea9ff·....·........... |
| 7 | ··0x005e | 7 | ··0x005e5154·40120000·000e0846·0e0c4a0f·0b740478·@......F..J..t.x |
| 8 | ··0x005e | 8 | ··0x005e5164·003f1a3b·2a322422·10000000·40000000·.?.;*2$"....@... |
| 9 | ··0x005e | 9 | ··0x005e5174·ecc0a9ff·18000000·00000000·10000000·................ |
| 10 | ··0x005e | 10 | ··0x005e5184·54000000·d831b0ff·06000000·00000000·T....1.......... |
| 11 | ··0x005e | 11 | ··0x005e5194·1c000000·00000000·017a504c·5200017c·.........zPLR..| |
| 12 | ··0x005e | 12 | ··0x005e51a4·08079b61·5e0b001b·1b0c0404·88010000·...a^........... |
| 13 | ··0x005e | 13 | ··0x005e51b4·38000000·24000000·a42db0ff·f7030000·8...$....-...... |
| 14 | ··0x005e | 14 | ··0x005e51c4·04eff708·00410e08·8502420d·05488703·.....A....B..H.. |
| 15 | ··0x005e | 15 | ··0x005e51d4·86045283·0502592e·20712e10·0328020a·..R...Y.·q...(.. |
| 16 | ··0x005e | 16 | ··0x005e51e4·c341c641·c741c50c·0404460b·1c000000·.A.A.A....F..... |
| 17 | ··0x005e | 17 | ··0x005e51f4·60000000·88c0a9ff·b6000000·04c9f708·`............... |
| 18 | ··0x005e | 18 | ··0x005e5204·000c0508·83058502·86048703·10000000·................ |
| 19 | ··0x005e | 19 | ··0x005e5214·e4000000·4e31b0ff·04000000·00000000·....N1.......... |
| 20 | ··0x005e | 20 | ··0x005e5224·10000000·f8000000·64afb3ff·03000000·........d....... |
| 21 | ··0x005e | 21 | ··0x005e5234·00000000·10000000·0c010000·60afb3ff·............`... |
| 22 | ··0x005e | 22 | ··0x005e5244·0b000000·00000000·10000000·20010000·............·... |
| 23 | ··0x005e | 23 | ··0x005e5254·5cafb3ff·01000000·00000000·10000000·\............... |
| 24 | ··0x005e | 24 | ··0x005e5264·34010000·58afb3ff·01000000·00000000·4...X........... |
| 25 | ··0x005e | 25 | ··0x005e5274·10000000·48010000·54afb3ff·01000000·....H...T....... |
| 26 | ··0x005e | 26 | ··0x005e5284·00000000·10000000·5c010000·50afb3ff·........\...P... |
| 27 | ··0x005e | 27 | ··0x005e5294·01000000·00000000·3c000000·70010000·........<...p... |
| 28 | ··0x005e | 28 | ··0x005e52a4·dc30b0ff·d6000000·00410e08·8502410e·.0.......A....A. |
| 29 | ··0x005e | 29 | ··0x005e52b4·0c870341·0e108604·410e1483·05430e30·...A....A....C.0 |
| 30 | ··0x005e | 30 | ··0x005e52c4·02bf0a0e·1441c30e·1041c60e·0c41c70e·.....A...A...A.. |
| 31 | ··0x005e | 31 | ··0x005e52d4·0841c50e·04460b00·18000000·b0010000·.A...F.......... |
| 32 | ··0x005e | 32 | ··0x005e52e4·7c31b0ff·32000000·00410e08·830270c3·|1..2....A....p. |
| 33 | ··0x005e | 33 | ··0x005e52f4·0e040000·80000000·cc010000·f0aeb3ff·................ |
| 34 | ··0x005e | 34 | ··0x005e5304·ab000000·00410e08·8602410e·0c83034e·.....A....A....N |
| 35 | ··0x005e | 35 | ··0x005e5314·0e1c470e·20460e1c·470e1841·0e1c410e·..G.·F..G..A..A. |
| 36 | ··0x005e | 36 | ··0x005e5324·20460e1c·410e1844·0e1c410e·20460e1c··F..A..D..A.·F.. |
| 37 | ··0x005e | 37 | ··0x005e5334·410e1847·0e1c410e·20460e1c·410e1844·A..G..A.·F..A..D |
| 38 | ··0x005e | 38 | ··0x005e5344·0e1c410e·20460e1c·470e1841·0e1c410e·..A.·F..G..A..A. |
| 39 | ··0x005e | 39 | ··0x005e5354·20480e14·440e1844·0e1c410e·20460e1c··H..D..D..A.·F.. |
| 40 | ··0x005e | 40 | ··0x005e5364·410e1847·0e1c410e·204e0e1c·410e1846·A..G..A.·N..A..F |
| 41 | ··0x005e | 41 | ··0x005e5374·0e1c410e·20000000·20000000·50020000·..A.·...·...P... |
| 42 | ··0x005e | 42 | ··0x005e5384·1cafb3ff·26000000·00410e08·83024e0e·....&....A....N. |
| 43 | ··0x005e | 43 | ··0x005e5394·1c4d0e20·480e0841·c30e0400·28000000·.M.·H..A....(... |
| 44 | ··0x005e | 44 | ··0x005e53a4·74020000·28afb3ff·30000000·00410e08·t...(...0....A.. |
| 45 | ··0x005e | 45 | ··0x005e53b4·8602410e·0c83034e·0e1c4d0e·20500e0c·..A....N..M.·P.. |
| 46 | ··0x005e | 46 | ··0x005e53c4·41c30e08·41c60e04·2c000000·a0020000·A...A...,....... |
| 47 | ··0x005e | 47 | ··0x005e53d4·2cafb3ff·67000000·00410e08·8602410e·,...g....A....A. |
| 48 | ··0x005e | 48 | ··0x005e53e4·0c83034e·0e18720e·1c410e20·610e0c41·...N..r..A.·a..A |
| 49 | ··0x005e | 49 | ··0x005e53f4·c30e0841·c60e0400·20000000·d0020000·...A....·....... |
| 50 | ··0x005e | 50 | ··0x005e5404·4cb0b3ff·26000000·00410e08·83024e0e·L...&....A....N. |
| 51 | ··0x005e | 51 | ··0x005e5414·1c4d0e20·480e0841·c30e0400·28000000·.M.·H..A....(... |
| 52 | ··0x005e4 | 52 | ··0x005e5424·f4020000·58b0b3ff·30000000·00410e08·....X...0....A.. |
| 53 | ··0x005e43 | 53 | ··0x005e5434·8602410e·0c83034e·0e1c4d0e·20500e0c·..A....N..M.·P.. |
| 54 | ··0x005e | 54 | ··0x005e5444·41c30e08·41c60e04·20000000·20030000·A...A...·...·... |
| 55 | ··0x005e | 55 | ··0x005e5454·5cb0b3ff·26000000·00410e08·83024e0e·\...&....A....N. |
| 56 | ··0x005e | 56 | ··0x005e5464·1c4d0e20·480e0841·c30e0400·28000000·.M.·H..A....(... |
| 57 | ··0x005e | 57 | ··0x005e5474·44030000·68b0b3ff·30000000·00410e08·D...h...0....A.. |
| 58 | ··0x005e | 58 | ··0x005e5484·8602410e·0c83034e·0e1c4d0e·20500e0c·..A....N..M.·P.. |
| 59 | ··0x005e | 59 | ··0x005e5494·41c30e08·41c60e04·74000000·70030000·A...A...t...p... |
| 60 | ··0x005e | 60 | ··0x005e54a4·fc2fb0ff·a7010000·00410e08·8702410e·./.......A....A. |
| 61 | ··0x005e | 61 | ··0x005e54b4·0c860345·0e108304·024d0e18·4a0e1c41·...E.....M..J..A |
| 62 | ··0x005e | 62 | ··0x005e54c4·0e20480e·10520ac3·0e0c43c6·0e0841c7·.·H..R....C...A. |
| 63 | ··0x005e | 63 | ··0x005e54d4·0e04430b·530ac30e·0c44c60e·0841c70e·..C.S....D...A.. |
| 64 | ··0x005e | 64 | ··0x005e54e4·04480b5b·0e184a0e·1c410e20·480e1054·.H.[..J..A.·H..T |
| 65 | ··0x005e | 65 | ··0x005e54f4·0ac30e0c·41c60e08·41c70e04·4c0b460a·....A...A...L.F. |
| 66 | ··0x005e | 66 | ··0x005e5504·c30e0c41·c60e0843·c70e0446·0b000000·...A...C...F.... |
| 67 | ··0x005e | 67 | ··0x005e5514·20000000·e8030000·3431b0ff·38000000··.......41..8... |
| 68 | ··0x005e | 68 | ··0x005e5524·00410e08·8302630a·c30e044c·0b47c30e·.A....c....L.G.. |
| 69 | ··0x005e | 69 | ··0x005e5534·04000000·24000000·0c040000·5031b0ff·....$.......P1.. |
| 70 | ··0x005e | 70 | ··0x005e5544·2e000000·00410e08·83024e0e·10470e14·.....A....N..G.. |
| 71 | ··0x005e | 71 | ··0x005e5554·4b0e1841·0e1c470e·20000000·24000000·K..A..G.·...$... |
| 72 | ··0x005e | 72 | ··0x005e5564·34040000·5831b0ff·2e000000·00410e08·4...X1.......A.. |
| 73 | ··0x005e | 73 | ··0x005e5574·83024e0e·10470e14·4b0e1841·0e1c470e·..N..G..K..A..G. |
| 74 | ··0x005e | 74 | ··0x005e5584·20000000·24000000·5c040000·6031b0ff··...$...\...`1.. |
| 75 | ··0x005e | 75 | ··0x005e5594·2e000000·00410e08·83024e0e·10470e14·.....A....N..G.. |
| 76 | ··0x005e | 76 | ··0x005e55a4·4b0e1841·0e1c470e·20000000·24000000·K..A..G.·...$... |
| 77 | ··0x005e | 77 | ··0x005e55b4·84040000·6831b0ff·2e000000·00410e08·....h1.......A.. |
| 78 | ··0x005e | 78 | ··0x005e55c4·83024e0e·10470e14·4b0e1841·0e1c470e·..N..G..K..A..G. |
| 79 | ··0x005e | 79 | ··0x005e55d4·20000000·24000000·ac040000·7031b0ff··...$.......p1.. |
| 80 | ··0x005e | 80 | ··0x005e55e4·2e000000·00410e08·83024e0e·10470e14·.....A....N..G.. |
| 81 | ··0x005e | 81 | ··0x005e55f4·4b0e1841·0e1c470e·20000000·60000000·K..A..G.·...`... |
| 82 | ··0x005e | 82 | ··0x005e5604·d4040000·38afb3ff·34020000·00410e08·....8...4....A.. |
| 83 | ··0x005e | 83 | ··0x005e5614·8502410e·0c870341·0e108604·410e1483·..A....A....A... |
| 84 | ··0x005e | 84 | ··0x005e5624·054e0e60·03a9010a·0e1441c3·0e1041c6·.N.`......A...A. |
| 85 | ··0x005e | 85 | ··0x005e5634·0e0c41c7·0e0841c5·0e04410b·02500a0e·..A...A...A..P.. |
| 86 | ··0x005e | 86 | ··0x005e5644·1441c30e·1041c60e·0c41c70e·0841c50e·.A...A...A...A.. |
| 87 | ··0x005e | 87 | ··0x005e5654·04410b47·0e644b0e·68410e6c·470e7000·.A.G.dK.hA.lG.p. |
| 88 | ··0x005e | 88 | ··0x005e5664·58000000·38050000·14b1b3ff·b3080000·X...8........... |
| 89 | ··0x005e | 89 | ··0x005e5674·00410e08·8502410e·0c870341·0e108604·.A....A....A.... |
| 90 | ··0x005e | 90 | ··0x005e5684·4c0e1483·05460ee0·0103ca04·0a0e1441·L....F.........A |
| 91 | ··0x005e | 91 | ··0x005e5694·c30e1041·c60e0c41·c70e0841·c50e0445·...A...A...A...E |
| 92 | ··0x005e | 92 | ··0x005e56a4·0b038a03·0a0e1441·c30e1041·c60e0c41·.......A...A...A |
| 93 | ··0x005e | 93 | ··0x005e56b4·c70e0841·c50e0441·0b000000·60000000·...A...A....`... |
| 94 | ··0x005e | 94 | ··0x005e56c4·94050000·b830b0ff·6b010000·00410e08·.....0..k....A.. |
| 95 | ··0x005e | 95 | ··0x005e56d4·8502410e·0c870341·0e108604·4c0e1483·..A....A....L... |
| 96 | ··0x005e | 96 | ··0x005e56e4·05430e30·02b70a0e·1441c30e·1041c60e·.C.0.....A...A.. |
| 97 | ··0x005e | 97 | ··0x005e56f4·0c41c70e·0841c50e·04430b02·6e0a0e14·.A...A...C..n... |
| 98 | ··0x005e | 98 | ··0x005e5704·41c30e10·41c60e0c·41c70e08·41c50e04·A...A...A...A... |
| 99 | ··0x005e | 99 | ··0x005e5714·410b500e·344b0e38·410e3c47·0e400000·A.P.4K.8A.<G.@.. |
| 100 | ··0x005e | 100 | ··0x005e5724·4c000000·f8050000·c431b0ff·8c020000·L........1...... |
| 101 | ··0x005e | 101 | ··0x005e5734·00410e08·8502410e·0c870341·0e108604·.A....A....A.... |
| 102 | ··0x005e | 102 | ··0x005e5744·410e1483·054e0e70·03e5010a·0e1441c3·A....N.p......A. |
| 103 | ··0x005e | 103 | ··0x005e5754·0e1041c6·0e0c41c7·0e0841c5·0e04450b·..A...A...A...E. |
| 104 | ··0x005e | 104 | ··0x005e5764·02740e74·4b0e7841·0e7c470e·80010000·.t.tK.xA.|G..... |
| 105 | ··0x005e | 105 | ··0x005e5774·2c000000·48060000·0434b0ff·ca050000·,...H....4...... |
| 106 | ··0x005e | 106 | ··0x005e5784·00410e08·8302510e·e803035d·040a0e08·.A....Q....].... |
| 107 | ··0x005e | 107 | ··0x005e5794·41c30e04·500b033e·010e0841·c30e0400·A...P..>...A.... |
| 108 | ··0x005e | 108 | ··0x005e57a4·5c000000·78060000·a439b0ff·a7000000·\...x....9...... |
| 109 | ··0x005e | 109 | ··0x005e57b4·00410e08·8502430e·0c870343·0e108604·.A....C....C.... |
| 110 | ··0x005e | 110 | ··0x005e57c4·430e1483·054e0e30·02400a0e·1441c30e·C....N.0.@...A.. |
| 111 | ··0x005e | 111 | ··0x005e57d4·1041c60e·0c41c70e·0841c50e·04440b53·.A...A...A...D.S |
| 112 | ··0x005e | 112 | ··0x005e57e4·0e34420e·38450e3c·410e404c·0e30480e·.4B.8E.<A.@L.0H. |
| 113 | ··0x005e | 113 | ··0x005e57f4·34410e38·410e3c41·0e404e0e·30000000·4A.8A.<A.@N.0... |
| 114 | ··0x005e | 114 | ··0x005e5804·50000000·d8060000·f439b0ff·9a000000·P........9...... |
| 115 | ··0x005e | 115 | ··0x005e5814·00410e08·8702410e·0c860341·0e108304·.A....A....A.... |
| 116 | ··0x005e | 116 | ··0x005e5824·02400e18·420e1c41·0e204c0e·10540ac3·.@..B..A.·L..T.. |
| 117 | ··0x005e | 117 | ··0x005e5834·0e0c41c6·0e0841c7·0e04480b·430e1c41·..A...A...H.C..A |
| 118 | ··0x005e | 118 | ··0x005e5844·0e20450e·10470e14·480e1841·0e1c470e·.·E..G..H..A..G. |
| 119 | ··0x005e | 119 | ··0x005e5854·20480e10·40000000·2c070000·403ab0ff··H..@...,...@:.. |
| 120 | ··0x005e | 120 | ··0x005e5864·83090000·00410e08·8502410e·0c870341·.....A....A....A |
| 121 | ··0x005e | 121 | ··0x005e5874·0e108604·410e1483·05480ec0·03030609·....A....H...... |
| 122 | ··0x005e | 122 | ··0x005e5884·0a0e1441·c30e1041·c60e0c41·c70e0841·...A...A...A...A |
| 123 | ··0x005e | 123 | ··0x005e5894·c50e044a·0b000000·78000000·70070000·...J....x...p... |
| 124 | ··0x005e | 124 | ··0x005e58a4·8c43b0ff·44040000·00410e08·8502410e·.C..D....A....A. |
| 125 | ··0x005e | 125 | ··0x005e58b4·0c870341·0e108604·4c0e1483·05430e88·...A....L....C.. |
| Max diff block lines reached; 0/4924215 bytes (0.00%) of diff not shown. | |||
| Offset 1, 7763 lines modified | Offset 1, 7763 lines modified | ||
| Diff chunk too large, falling back to line-by-line diff (7760 lines added, 7760 lines removed) | |||
| 1 | Hex·dump·of·section·'.gcc_except_table': | 1 | Hex·dump·of·section·'.gcc_except_table': |
| 2 | ··0x0067 | 2 | ··0x006749b4·ffff0112·7605e007·00a7010d·f00700cb·....v........... |
| 3 | ··0x0067 | 3 | ··0x006749c4·01ff05eb·0700ffff·01110c16·2c006905·............,.i. |
| 4 | ··0x0067 | 4 | ··0x006749d4·00007a05·2c00a201·050000ff·ff0110bd·..z.,........... |
| 5 | ··0x0067 | 5 | ··0x006749e4·01050000·c80103d0·0100ec01·050000ff·................ |
| 6 | ··0x0067 | 6 | ··0x006749f4·ff0110bd·01050000·c80103d0·0100ec01·................ |
| 7 | ··0x0067 | 7 | ··0x00674a04·050000ff·ff0110bd·01050000·c80103d0·................ |
| 8 | ··0x0067 | 8 | ··0x00674a14·0100f201·050000ff·ff0110bd·01050000·................ |
| 9 | ··0x0067 | 9 | ··0x00674a24·c80103d0·0100f201·050000ff·ff0100ff·................ |
| 10 | ··0x0067 | 10 | ··0x00674a34·ff0100ff·ff0100ff·ff0100ff·ff0100ff·................ |
| 11 | ··0x0067 | 11 | ··0x00674a44·ff0100ff·ff0100ff·ff0100ff·ff0100ff·................ |
| 12 | ··0x0067 | 12 | ··0x00674a54·ff0100ff·ff0100ff·ff0100ff·ff0100ff·................ |
| 13 | ··0x0067 | 13 | ··0x00674a64·ff0100ff·ff0100ff·ff0100ff·ff0100ff·................ |
| 14 | ··0x0067 | 14 | ··0x00674a74·ff0100ff·ff0100ff·ff0100ff·ff0100ff·................ |
| 15 | ··0x0067 | 15 | ··0x00674a84·ff0100ff·ff0100ff·ff010000·ff9b1501·................ |
| 16 | ··0x0067 | 16 | ··0x00674a94·0dda01e2·010000f9·03c201bb·05010100·................ |
| 17 | ··0x0067 | 17 | ··0x00674aa4·00000000·ff9b1101·0818051d·002b0500·.............+.. |
| 18 | ··0x0067 | 18 | ··0x00674ab4·00010000·00000000·ffff010a·3e5ea901·............>^.. |
| 19 | ··0x0067 | 19 | ··0x00674ac4·00bb0105·00000000·ff9b0d01·05670589·.............g.. |
| 20 | ··0x0067 | 20 | ··0x00674ad4·02010100·00000000·ff9b0d01·05670591·.............g.. |
| 21 | ··0x0067 | 21 | ··0x00674ae4·02010100·00000000·ff9b2901·1c8d01a5·..........)..... |
| 22 | ··0x0067 | 22 | ··0x00674af4·010000fe·0205e704·01ad0305·0000de03·................ |
| 23 | ··0x0067 | 23 | ··0x00674b04·05e20401·dd040500·00010000·7d000000·............}... |
| 24 | ··0x0067 | 24 | ··0x00674b14·00000000·ff9b2501·18540559·03780584·......%..T.Y.x.. |
| 25 | ··0x0067 | 25 | ··0x00674b24·01007f05·96010091·01050000·a3010500·................ |
| 26 | ··0x0067 | 26 | ··0x00674b34·00010000·7d000000·00000000·ff9b1101·....}........... |
| 27 | ··0x0067 | 27 | ··0x00674b44·09310500·005405c0·07010100·00000000·.1...T.......... |
| 28 | ··0x0067 | 28 | ··0x00674b54·ff9b1101·08290533·00530500·00010000·.....).3.S...... |
| 29 | ··0x0067 | 29 | ··0x00674b64·00000000·ffff0121·5c200000·ae03539b·.......!\·....S. |
| 30 | ··0x0067 | 30 | ··0x00674b74·0800a704·05960800·8805058c·0800c905·................ |
| 31 | ··0x0067 | 31 | ··0x00674b84·05850800·80080500·00ffff01·13460500·.............F.. |
| 32 | ··0x0067 | 32 | ··0x00674b94·0068056d·00a10105·4b00bf01·17d60100·.h.m....K....... |
| 33 | ··0x0067 | 33 | ··0x00674ba4·ffff011d·83010500·00e40156·ff0500dc·...........V.... |
| 34 | ··0x0067 | 34 | ··0x00674bb4·02058b06·00af0305·84060097·04e30100·................ |
| 35 | ··0x0067 | 35 | ··0x00674bc4·00ffff01·1219055a·00440500·008a0105·.......Z.D...... |
| 36 | ··0x0067 | 36 | ··0x00674bd4·1e009c01·055a00ff·ff013081·02d60200·.....Z....0..... |
| 37 | ··0x0067 | 37 | ··0x00674be4·00f00405·c01600a3·0505bb16·00b40605·................ |
| 38 | ··0x0067 | 38 | ··0x00674bf4·b41600c0·0705af16·00970905·aa16008d·................ |
| 39 | ··0x0067 | 39 | ··0x00674c04·0a05c716·00d10c05·aa1600ff·ff011420·...............· |
| 40 | ··0x0067 | 40 | ··0x00674c14·05950200·4e058101·007c0591·02008c02·....N....|...... |
| 41 | ··0x0067 | 41 | ··0x00674c24·050000ff·ff0125a0·01b302ed·0e00ac04·......%......... |
| 42 | ··0x0067 | 42 | ··0x00674c34·05fb0e00·d60505ed·0e00eb05·05f40e00·................ |
| 43 | ··0x0067 | 43 | ··0x00674c44·fc0640ed·0e00f808·05fb0e00·ffff0108·..@............. |
| 44 | ··0x0067 | 44 | ··0x00674c54·3f050000·7b050100·ffff0135·49180000·?...{......5I... |
| 45 | ··0x0067 | 45 | ··0x00674c64·fa0117fa·0a00b502·05f50a00·840352fa·..............R. |
| 46 | ··0x0067 | 46 | ··0x00674c74·0a00fa03·05f00a00·e904ae03·fa0a00d4·................ |
| 47 | ··0x0067 | 47 | ··0x00674c84·0850e30a·00a90905·e80a00e6·096dfa0a·.P...........m.. |
| 48 | ··0x0067 | 48 | ··0x00674c94·00ffff01·2c162040·00840105·0000a101·....,.·@........ |
| 49 | ··0x0067 | 49 | ··0x00674ca4·05e30100·bc0105fa·0100d401·05000092·................ |
| 50 | ··0x0067 | 50 | ··0x00674cb4·0216fa01·00ca0205·f60200e7·0205fa01·................ |
| 51 | ··0x0067 | 51 | ··0x00674cc4·00000000·ff9b1901·11bd011f·0000e602·................ |
| 52 | ··0x0067 | 52 | ··0x00674cd4·05f30501·8f03e402·00000100·cc6a0200·.............j.. |
| 53 | ··0x0067 | 53 | ··0x00674ce4·ff9b1501·0c1f053c·00271500·00490500·.......<.'...I.. |
| 54 | ··0x0067 | 54 | ··0x00674cf4·00010000·b46a0200·ff9b3101·24800305·.....j....1.$... |
| 55 | ··0x0067 | 55 | ··0x00674d04·c30801d8·0372e508·03870505·c30801df·.....r.......... |
| 56 | ··0x0067 | 56 | ··0x00674d14·0572db08·03f80605·c30801d0·076ed108·.r...........n.. |
| 57 | ··0x0067 | 57 | ··0x00674d24·037f0000·7d000000·806a0200·01000000·....}....j...... |
| 58 | ··0x0067 | 58 | ··0x00674d34·ff9b2901·1d19051e·034b0500·006e051e·..)......K...n.. |
| 59 | ··0x0067 | 59 | ··0x00674d44·03860105·0000b301·23e00103·fe0123ab·........#.....#. |
| 60 | ··0x0067 | 60 | ··0x00674d54·02037f00·007d0000·506a0200·0100ffff·.....}..Pj...... |
| 61 | ··0x0067 | 61 | ··0x00674d64·01127add·020000e6·03ab01d2·0500c105·..z............. |
| 62 | ··0x0067 | 62 | ··0x00674d74·05cb0500·ffff0135·1f059405·00350590·.......5.....5.. |
| 63 | ··0x0067 | 63 | ··0x00674d84·05004705·98050075·05a40400·cc012d00·..G....u......-. |
| 64 | ··0x0067 | 64 | ··0x00674d94·00900205·f70200a7·0205b303·00ed0246·...............F |
| 65 | ··0x0067 | 65 | ··0x00674da4·0000e803·05ed0300·9a047100·00ffff01·..........q..... |
| 66 | ··0x0067 | 66 | ··0x00674db4·2ab50105·c8060095·0305d606·00f20405·*............... |
| 67 | ··0x0067 | 67 | ··0x00674dc4·cf0600aa·0605d606·00b90605·cf0600be·................ |
| 68 | ··0x0067 | 68 | ··0x00674dd4·0605d606·00c30605·cf0600ff·ff01058f·................ |
| 69 | ··0x0067 | 69 | ··0x00674de4·01050000·ffff0134·93060586·07009806·.......4........ |
| 70 | ··0x0067 | 70 | ··0x00674df4·0500009d·0605a706·00a20605·ab0600e8·................ |
| 71 | ··0x0067 | 71 | ··0x00674e04·06050000·ed0605ab·0600f206·05860700·................ |
| 72 | ··0x0067 | 72 | ··0x00674e14·f7060a8a·07008107·05a70600·ff9b3901·..............9. |
| 73 | ··0x0067 | 73 | ··0x00674e24·26ac0105·ea0d03e0·0105d40d·03ee0105·&............... |
| 74 | ··0x0067 | 74 | ··0x00674e34·fc0d0386·02a307e0·0d03c909·05db0d05·................ |
| 75 | ··0x0067 | 75 | ··0x00674e44·e20ae502·e00d0301·00007d02·00000000·..........}..... |
| 76 | ··0x0067 | 76 | ··0x00674e54·00000000·58690200·ff9b2901·1918335a·....Xi....)...3Z |
| 77 | ··0x0067 | 77 | ··0x00674e64·03df0105·e503008f·02055a03·a203225a·..........Z..."Z |
| 78 | ··0x0067 | 78 | ··0x00674e74·03d6033e·00000100·007d0200·00000000·...>.....}...... |
| 79 | ··0x0067 | 79 | ··0x00674e84·2c690200·ff9b3501·24b00105·ba0503dc·,i....5.$....... |
| 80 | ··0x0067 | 80 | ··0x00674e94·01059f05·03ea0105·8e050387·0264ad05·.............d.. |
| 81 | ··0x0067 | 81 | ··0x00674ea4·03b10305·a80505c3·0436ad05·03010000·.........6...... |
| 82 | ··0x0067 | 82 | ··0x00674eb4·7d020000·00000000·f4680200·ff9b1d01·}........h...... |
| 83 | ··0x0067 | 83 | ··0x00674ec4·0bcd0105·b70200b2·02340000·0100007d·.........4.....} |
| 84 | ··0x0067 | 84 | ··0x00674ed4·02000000·00000000·d4680200·ff9b3901·.........h....9. |
| 85 | ··0x0067 | 85 | ··0x00674ee4·26c20105·bb0803ee·0105b208·03fc0105·&............... |
| 86 | ··0x0067 | 86 | ··0x00674ef4·a1080399·02c602c8·08039705·059c0805·................ |
| 87 | ··0x0067 | 87 | ··0x00674f04·ac06e301·c8080301·00007d02·00000000·..........}..... |
| 88 | ··0x0067 | 88 | ··0x00674f14·00000000·98680200·ff9b2101·11e50105·.....h....!..... |
| 89 | ··0x0067 | 89 | ··0x00674f24·dc020091·02059b02·03d20239·00000100·...........9.... |
| 90 | ··0x0067 | 90 | ··0x00674f34·007d0200·00000000·74680200·ffff0115·.}......th...... |
| 91 | ··0x0067 | 91 | ··0x00674f44·3a03ec01·004d03e8·01008a01·16e10100·:....M.......... |
| 92 | ··0x0067 | 92 | ··0x00674f54·85020500·00ffff01·15320500·00810103·.........2...... |
| 93 | ··0x0067 | 93 | ··0x00674f64·d50100c3·0105d701·00ff0118·0000ffff·................ |
| 94 | ··0x0067 | 94 | ··0x00674f74·01153205·00008101·03d50100·c30105d7·..2............. |
| 95 | ··0x0067 | 95 | ··0x00674f84·0100ff01·180000ff·ff011532·05000081·...........2.... |
| 96 | ··0x0067 | 96 | ··0x00674f94·0103d501·00c30105·d70100f9·01180000·................ |
| 97 | ··0x0067 | 97 | ··0x00674fa4·ffff0115·32050000·810103d5·0100c301·....2........... |
| 98 | ··0x0067 | 98 | ··0x00674fb4·05d70100·f9011800·00ffff01·13e603f0·................ |
| 99 | ··0x0067 | 99 | ··0x00674fc4·03ad0900·fc0705a6·0900f608·30ad0900·............0... |
| 100 | ··0x0067 | 100 | ··0x00674fd4·ffff0108·0f054e00·44050000·ffff011e·......N.D....... |
| 101 | ··0x0067 | 101 | ··0x00674fe4·91010599·0900c201·05940900·950305a0·................ |
| 102 | ··0x0067 | 102 | ··0x00674ff4·0900c204·05ac0900·820732a7·0900ffff·..........2..... |
| 103 | ··0x0067 | 103 | ··0x00675004·010e3405·00005105·0a008201·05870100·..4...Q......... |
| 104 | ··0x0067 | 104 | ··0x00675014·ffff0124·c10205e5·0a00fc03·05d40a00·...$............ |
| 105 | ··0x0067 | 105 | ··0x00675024·b20635e0·0a00d708·05c60a00·860905db·..5............. |
| 106 | ··0x0067 | 106 | ··0x00675034·0a00810a·45cd0a00·ffff010f·20053700·....E.......·.7. |
| 107 | ··0x0067 | 107 | ··0x00675044·94010500·00b10105·c3010000·ff9b6901·..............i. |
| 108 | ··0x0067 | 108 | ··0x00675054·50a70272·0000e704·059b1405·990505a8·P..r............ |
| 109 | ··0x0067 | 109 | ··0x00675064·1405ac05·05af1405·c905aa04·c01405b4·................ |
| 110 | ··0x0067 | 110 | ··0x00675074·0a059614·07d30c05·0000860d·3ac01405·............:... |
| 111 | ··0x0067 | 111 | ··0x00675084·ad104a00·00901105·c01405c3·11050000·..J............. |
| 112 | ··0x0067 | 112 | ··0x00675094·ad12058f·1400ab13·05c01405·f0130500·................ |
| 113 | ··0x0067 | 113 | ··0x006750a4·00020001·7d007d03·00000000·00000000·....}.}......... |
| 114 | ··0x0067 | 114 | ··0x006750b4·00670200·f8660200·ff9b3d01·271c9a01·.g...f....=.'... |
| 115 | ··0x0067 | 115 | ··0x006750c4·00008b03·050000a2·0405d304·00860505·................ |
| 116 | ··0x0067 | 116 | ··0x006750d4·00009f05·05c80500·ef050500·008b06cd·................ |
| 117 | ··0x0067 | 117 | ··0x006750e4·01900305·0200017d·007d0300·00000000·.......}.}...... |
| 118 | ··0x0067 | 118 | ··0x006750f4·c0660200·b8660200·ffff0119·56059507·.f...f......V... |
| 119 | ··0x0067 | 119 | ··0x00675104·00910185·039c0700·a40405a6·0700fd04·................ |
| 120 | ··0x0067 | 120 | ··0x00675114·85029c07·00ffff01·0c0f054e·00440500·...........N.D.. |
| 121 | ··0x0067 | 121 | ··0x00675124·0070194e·00ffff01·194d05b7·05009f01·.p.N.....M...... |
| 122 | ··0x0067 | 122 | ··0x00675134·c701b205·00f40205·ab0500c9·03cd01b2·................ |
| 123 | ··0x0067 | 123 | ··0x00675144·0500ffff·010c0f05·59004f05·00007b19·........Y.O...{. |
| 124 | ··0x0067 | 124 | ··0x00675154·5900ffff·01195605·ba0f0089·01e806b5·Y.....V......... |
| 125 | ··0x0067 | 125 | ··0x00675164·0f00fd07·05c10f00·b608f506·b50f00ff·................ |
| Max diff block lines reached; 0/1039886 bytes (0.00%) of diff not shown. | |||
| Offset 1, 6 lines modified | Offset 1, 6 lines modified | ||
| 1 | Hex·dump·of·section·'.init_array': | 1 | Hex·dump·of·section·'.init_array': |
| 2 | ··0x0069 | 2 | ··0x0069316c·507f0e00·40400e00·d0410e00·a0670e00·P...@@...A...g.. |
| 3 | ··0x0069 | 3 | ··0x0069317c·c0690e00·e06b0e00·b06e0e00·d0700e00·.i...k...n...p.. |
| 4 | ··0x0069 | 4 | ··0x0069318c·a0730e00·10770e00·d0780e00·107d0e00·.s...w...x...}.. |
| Offset 1, 4 lines modified | Offset 1, 4 lines modified | ||
| 1 | Hex·dump·of·section·'.fini_array': | 1 | Hex·dump·of·section·'.fini_array': |
| 2 | ··0x0069 | 2 | ··0x0069319c·007f0e00····························.... |
| Offset 1, 1917 lines modified | Offset 1, 1917 lines modified | ||
| Diff chunk too large, falling back to line-by-line diff (915 lines added, 1171 lines removed) | |||
| 1 | Hex·dump·of·section·'.data.rel.ro': | 1 | Hex·dump·of·section·'.data.rel.ro': |
| 2 | ··0x0069 | 2 | ··0x006931a0·00000000·183b6900·a0021200·d0021200·.....;i......... |
| 3 | ··0x0069 | 3 | ··0x006931b0·e0011200·dc316900·7c3c6900·903c6900·.....1i.|<i..<i. |
| 4 | ··0x0069 | 4 | ··0x006931c0·543c6900·683c6900·04326900·f0316900·T<i.h<i..2i..1i. |
| 5 | ··0x0069 | 5 | ··0x006931d0·64010000·00000000·243b6900·00031200·d.......$;i..... |
| 6 | ··0x0069 | 6 | ··0x006931e0·60101200·08000000·a4feffff·243b6900·`...........$;i. |
| 7 | ··0x0069 | 7 | ··0x006931f0·e0031200·e0101200·9cfeffff·9cfeffff·................ |
| 8 | ··0x0069 | 8 | ··0x00693200·243b6900·70031200·50111200·00000000·$;i.p...P....... |
| 9 | ··0x0069 | 9 | ··0x00693210·703e6900·00fc1200·40fc1200·5c326900·p>i.....@...\2i. |
| 10 | ··0x0069 | 10 | ··0x00693220·603f6900·243f6900·fc3e6900·103f6900·`?i.$?i..>i..?i. |
| 11 | ··0x0069 | 11 | ··0x00693230·d43e6900·e83e6900·4c3f6900·383f6900·.>i..>i.L?i.8?i. |
| 12 | ··0x0069 | 12 | ··0x00693240·883f6900·743f6900·84326900·70326900·.?i.t?i..2i.p2i. |
| 13 | ··0x0069 | 13 | ··0x00693250·48000000·00000000·883e6900·a01c1500·H........>i..... |
| 14 | ··0x0069 | 14 | ··0x00693260·001e1500·40000000·f8ffffff·883e6900·....@........>i. |
| 15 | ··0x0069 | 15 | ··0x00693270·f01b1500·b01e1500·b8ffffff·b8ffffff·................ |
| 16 | ··0x0069 | 16 | ··0x00693280·883e6900·501d1500·601f1500·00000000·.>i.P...`....... |
| 17 | ··0x0069 | 17 | ··0x00693290·d0466900·d0ae1a00·709a1a00·e09a1a00·.Fi.....p....... |
| 18 | ··0x0069 | 18 | ··0x006932a0·009a1a00·009d1a00·109c1a00·109a1a00·................ |
| 19 | ··0x0069 | 19 | ··0x006932b0·e09b1a00·209a1a00·609b1a00·00000000·....·...`....... |
| 20 | ··0x0069 | 20 | ··0x006932c0·d8466900·a0a11900·d05e1a00·10711900·.Fi......^...q.. |
| 21 | ··0x0069 | 21 | ··0x006932d0·10721900·50481900·a0481900·70471900·.r..PH...H..pG.. |
| 22 | ··0x0069 | 22 | ··0x006932e0·30561900·c0521900·d0b51900·10db1900·0V...R.......... |
| 23 | ··0x0069 | 23 | ··0x006932f0·e04a1a00·10d71900·80451900·70191500·.J.......E..p... |
| 24 | ··0x0069 | 24 | ··0x00693300·10461900·40ca1900·80191500·80941900·.F..@........... |
| 25 | ··0x0069 | 25 | ··0x00693310·00000000·00476900·c0b31a00·50b41a00·.....Gi.....P... |
| 26 | ··0x0069 | 26 | ··0x00693320·50451b00·00000000·18476900·f0511b00·PE.......Gi..Q.. |
| 27 | ··0x0069 | 27 | ··0x00693330·60521b00·60511b00·a04f1b00·404f1b00·`R..`Q...O..@O.. |
| 28 | ··0x0069 | 28 | ··0x00693340·00000000·20476900·40691b00·20691b00·....·Gi.@i..·i.. |
| 29 | ··0x0069 | 29 | ··0x00693350·e0681b00·009a1a00·009d1a00·109c1a00·.h.............. |
| 30 | ··0x0069 | 30 | ··0x00693360·109a1a00·e09b1a00·209a1a00·609b1a00·........·...`... |
| 31 | ··0x0069 | 31 | ··0x00693370·00000000·bc496900·00c71c00·a0be1c00·.....Ii......... |
| 32 | ··0x0069 | 32 | ··0x00693380·f0be1c00·009a1a00·009d1a00·109c1a00·................ |
| 33 | ··0x0069 | 33 | ··0x00693390·109a1a00·e09b1a00·209a1a00·609b1a00·........·...`... |
| 34 | ··0x0069 | 34 | ··0x006933a0·00000000·9c4e6900·f0d71d00·50d71d00·.....Ni.....P... |
| 35 | ··0x0069 | 35 | ··0x006933b0·a0d71d00·70da1d00·10d91d00·60d91d00·....p.......`... |
| 36 | ··0x0069 | 36 | ··0x006933c0·00da1d00·20d91d00·30d91d00·d0da1d00·....·...0....... |
| 37 | ··0x0069 | 37 | ··0x006933d0·00000000·e44e6900·307f1e00·a07f1e00·.....Ni.0....... |
| 38 | ··0x0069 | 38 | ··0x006933e0·90801e00·c07f1e00·507f1e00·00000000·........P....... |
| 39 | ··0x0069 | 39 | ··0x006933f0·f04e6900·207f1e00·607f1e00·e07f1e00·.Ni.·...`....... |
| 40 | ··0x0069 | 40 | ··0x00693400·807f1e00·407f1e00·ac5c5100·b65c5100·....@....\Q..\Q. |
| 41 | ··0x0069 | 41 | ··0x00693410·00dd5100·bd5c5100·635c5100·c55c5100·..Q..\Q.c\Q..\Q. |
| 42 | ··0x0069 | 42 | ··0x00693420·00000000·e4516900·e0ad2200·10ae2200·.....Qi..."...". |
| 43 | ··0x0069 | 43 | ··0x00693430·00000000·90536900·40622d00·00632d00·.....Si.@b-..c-. |
| 44 | ··0x0069 | 44 | ··0x00693440·40632d00·20632d00·70622d00·00000000·@c-.·c-.pb-..... |
| 45 | ··0x0069 | 45 | ··0x00693450·9c536900·30622d00·c0622d00·f0632d00·.Si.0b-..b-..c-. |
| 46 | ··0x0069 | 46 | ··0x00693460·e0622d00·60622d00·00000000·a8536900·.b-.`b-......Si. |
| 47 | ··0x0069 | 47 | ··0x00693470·20622d00·80622d00·a0642d00·a0622d00··b-..b-..d-..b-. |
| 48 | ··0x0069 | 48 | ··0x00693480·50622d00·00000000·bc536900·e0192f00·Pb-......Si.../. |
| 49 | ··0x0069 | 49 | ··0x00693490·b01a2f00·e0172f00·f0172f00·80352f00·../.../.../..5/. |
| 50 | ··0x0069 | 50 | ··0x006934a0·c0302f00·50362f00·90312f00·002d2f00·.0/.P6/..1/..-/. |
| 51 | ··0x0069 | 51 | ··0x006934b0·80332f00·102d2f00·50fa2e00·00000000·.3/..-/.P....... |
| 52 | ··0x0069 | 52 | ··0x006934c0·b4546900·b06b3200·306c3200·00000000·.Ti..k2.0l2..... |
| 53 | ··0x0069 | 53 | ··0x006934d0·28566900·f0633400·40643400·00000000·(Vi..c4.@d4..... |
| 54 | ··0x0069 | 54 | ··0x006934e0·04000000·04000000·02000000·04000000·................ |
| 55 | ··0x0069 | 55 | ··0x006934f0·04000000·01000000·02000000·08000000·................ |
| 56 | ··0x0069 | 56 | ··0x00693500·02000000·02000000·00000000·00000000·................ |
| 57 | ··0x0069 | 57 | ··0x00693510·03000000·8c185d00·02000000·00000000·......]......... |
| 58 | ··0x0069 | 58 | ··0x00693520·00145d00·10000000·10000000·04000000·..]............. |
| 59 | ··0x0069 | 59 | ··0x00693530·10000000·10000000·06000000·04000000·................ |
| 60 | ··0x0069 | 60 | ··0x00693540·40000000·06000000·04000000·00000000·@............... |
| 61 | ··0x0069 | 61 | ··0x00693550·00000000·0f000000·7c185d00·04000000·........|.]..... |
| 62 | ··0x0069 | 62 | ··0x00693560·00000000·00145d00·90010000·90010000·......]......... |
| 63 | ··0x0069 | 63 | ··0x00693570·14000000·90010000·90010000·be000000·................ |
| 64 | ··0x0069 | 64 | ··0x00693580·14000000·cc010000·be000000·14000000·................ |
| 65 | ··0x0069 | 65 | ··0x00693590·00000000·00000000·16000000·64185d00·............d.]. |
| 66 | ··0x0069 | 66 | ··0x006935a0·14000000·01000000·a0135d00·00010000·..........]..... |
| 67 | ··0x0069 | 67 | ··0x006935b0·00010000·10000000·00010000·00010000·................ |
| 68 | ··0x0069 | 68 | ··0x006935c0·78000000·10000000·00100000·78000000·x...........x... |
| 69 | ··0x0069 | 69 | ··0x006935d0·10000000·00000000·00000000·ff000000·................ |
| 70 | ··0x0069 | 70 | ··0x006935e0·00000000·10000000·01000000·a00f5d00·..............]. |
| 71 | ··0x0069 | 71 | ··0x006935f0·24000000·24000000·06000000·24000000·$...$.......$... |
| 72 | ··0x0069 | 72 | ··0x00693600·24000000·0f000000·06000000·80010000·$............... |
| 73 | ··0x0069 | 73 | ··0x00693610·0f000000·06000000·00000000·00000000·................ |
| 74 | ··0x0069 | 74 | ··0x00693620·3f000000·00000000·06000000·01000000·?............... |
| 75 | ··0x0069 | 75 | ··0x00693630·00145d00·31000000·31000000·07000000·..].1...1....... |
| 76 | ··0x0069 | 76 | ··0x00693640·31000000·31000000·15000000·07000000·1...1........... |
| 77 | ··0x0069 | 77 | ··0x00693650·80030000·15000000·07000000·00000000·................ |
| 78 | ··0x0069 | 78 | ··0x00693660·00000000·7f000000·00000000·07000000·................ |
| 79 | ··0x0069 | 79 | ··0x00693670·01000000·00145d00·00040000·00040000·......]......... |
| 80 | ··0x0069 | 80 | ··0x00693680·20000000·00040000·00040000·f0010000··............... |
| 81 | ··0x0069 | 81 | ··0x00693690·20000000·20040000·f0010000·20000000··...·.......·... |
| 82 | ··0x0069 | 82 | ··0x006936a0·00000000·00000000·20000000·40185d00·........·...@.]. |
| 83 | ··0x0069 | 83 | ··0x006936b0·20000000·01000000·000f5d00·00100000··.........]..... |
| 84 | ··0x0069 | 84 | ··0x006936c0·00100000·40000000·00100000·00100000·....@........... |
| 85 | ··0x0069 | 85 | ··0x006936d0·e0070000·40000000·40100000·40000000·....@...@...@... |
| 86 | ··0x0069 | 86 | ··0x006936e0·e0070000·00000000·00000000·40000000·............@... |
| 87 | ··0x0069 | 87 | ··0x006936f0·00000000·40000000·01000000·00000000·....@........... |
| 88 | ··0x0069 | 88 | ··0x00693700·a85f6900·f0606900·c0616900·68666900·._i..`i..ai.hfi. |
| 89 | ··0x0069 | 89 | ··0x00693710·48646900·70656900·40666900·08626900·Hdi.pei.@fi..bi. |
| 90 | ··0x0069 | 90 | ··0x00693720·50636900·20646900·24686900·f4686900·Pci.·di.$hi..hi. |
| 91 | ··0x0069 | 91 | ··0x00693730·dc666900·486a6900·706b6900·406c6900·.fi.Hji.pki.@li. |
| 92 | ··0x0069 | 92 | ··0x00693740·bc6e6900·c46f6900·94706900·08736900·.ni..oi..pi..si. |
| 93 | ··0x0069 | 93 | ··0x00693750·c8706900·10726900·e0726900·5c746900·.pi..ri..ri.\ti. |
| 94 | ··0x0069 | 94 | ··0x00693760·2c756900·207c6900·007a6900·287b6900·,ui.·|i..zi.({i. |
| 95 | ··0x0069 | 95 | ··0x00693770·f87b6900·b4776900·74756900·bc766900·.{i..wi.tui..vi. |
| 96 | ··0x0069 | 96 | ··0x00693780·8c776900·08796900·d8796900·d87d6900·.wi..yi..yi..}i. |
| 97 | ··0x0069 | 97 | ··0x00693790·a87e6900·847c6900·e87e6900·0c806900·.~i..|i..~i...i. |
| 98 | ··0x0069 | 98 | ··0x006937a0·dc806900·60856900·40836900·68846900·..i.`.i.@.i.h.i. |
| 99 | ··0x0069 | 99 | ··0x006937b0·38856900·24816900·48826900·18836900·8.i.$.i.H.i...i. |
| 100 | ··0x0069 | 100 | ··0x006937c0·e8866900·b8876900·c4856900·00886900·..i...i...i...i. |
| 101 | ··0x0069 | 101 | ··0x006937d0·b8896900·ec8a6900·108b6900·388b6900·..i...i...i.8.i. |
| 102 | ··0x0069 | 102 | ··0x006937e0·d48c6900·088e6900·2c8e6900·80946900·..i...i.,.i...i. |
| 103 | ··0x0069 | 103 | ··0x006937f0·7c916900·18936900·4c946900·70946900·|.i...i.L.i.p.i. |
| 104 | ··0x0069 | 104 | ··0x00693800·5c8e6900·14906900·48916900·6c916900·\.i...i.H.i.l.i. |
| 105 | ··0x0069 | 105 | ··0x00693810·b0966900·e4976900·08986900·f8946900·..i...i...i...i. |
| 106 | ··0x0069 | 106 | ··0x00693820·40c06900·34c06900·28c06900·1cc06900·@.i.4.i.(.i...i. |
| 107 | ··0x0069 | 107 | ··0x00693830·10c06900·04c06900·f8bf6900·ecbf6900·..i...i...i...i. |
| 108 | ··0x0069 | 108 | ··0x00693840·e0bf6900·00000000·00000000·00000000·..i............. |
| 109 | ··0x0069 | 109 | ··0x00693850·00000000·00000000·00000000·00000000·................ |
| 110 | ··0x0069 | 110 | ··0x00693860·b4635d00·ac635d00·a0635d00·94635d00·.c]..c]..c]..c]. |
| 111 | ··0x0069 | 111 | ··0x00693870·88635d00·7c635d00·6c635d00·5c635d00·.c].|c].lc].\c]. |
| 112 | ··0x0069 | 112 | ··0x00693880·4c635d00·3c635d00·28635d00·14635d00·Lc].<c].(c]..c]. |
| 113 | ··0x0069 | 113 | ··0x00693890·00635d00·ec625d00·d8625d00·c4625d00·.c]..b]..b]..b]. |
| 114 | ··0x0069 | 114 | ··0x006938a0·b0625d00·9c625d00·88625d00·70625d00·.b]..b]..b].pb]. |
| 115 | ··0x0069 | 115 | ··0x006938b0·58625d00·40625d00·28625d00·10625d00·Xb].@b].(b]..b]. |
| 116 | ··0x0069 | 116 | ··0x006938c0·f8615d00·e0615d00·c0615d00·a0615d00·.a]..a]..a]..a]. |
| 117 | ··0x0069 | 117 | ··0x006938d0·80615d00·60615d00·40615d00·20615d00·.a].`a].@a].·a]. |
| 118 | ··0x0069 | 118 | ··0x006938e0·e0605d00·a0605d00·60605d00·20605d00·.`]..`].``].·`]. |
| 119 | ··0x0069 | 119 | ··0x006938f0·e05f5d00·70625d00·00000000·00000000·._].pb]......... |
| 120 | ··0x0069 | 120 | ··0x00693900·c0695d00·60695d00·00695d00·a0685d00·.i].`i]..i]..h]. |
| 121 | ··0x0069 | 121 | ··0x00693910·40685d00·e0645d00·80645d00·20645d00·@h]..d]..d].·d]. |
| 122 | ··0x0069 | 122 | ··0x00693920·c0635d00·e0675d00·20675d00·00665d00·.c]..g].·g]..f]. |
| 123 | ··0x0069 | 123 | ··0x00693930·00000000·c8a26900·c0cd4700·50396900·......i...G.P9i. |
| 124 | ··0x0069 | 124 | ··0x00693940·64396900·5c010000·00000000·dca26900·d9i.\.........i. |
| 125 | ··0x0069 | 125 | ··0x00693950·202e4800·502f4800·a4feffff·a4feffff··.H.P/H......... |
| Max diff block lines reached; 116440/256330 bytes (45.43%) of diff not shown. | |||
| Offset 1, 92 lines modified | Offset 1, 92 lines modified | ||
| 1 | Hex·dump·of·section·'.got': | 1 | Hex·dump·of·section·'.got': |
| 2 | ·NOTE:·This·section·has·relocations·against·it,·but·these·have·NOT·been·applied·to·this·dump. | 2 | ·NOTE:·This·section·has·relocations·against·it,·but·these·have·NOT·been·applied·to·this·dump. |
| 3 | ··0x0069 | 3 | ··0x0069aa64·3ca96900·00000000·00000000·36000800·<.i.........6... |
| 4 | ··0x0069 | 4 | ··0x0069aa74·46000800·56000800·66000800·76000800·F...V...f...v... |
| 5 | ··0x0069 | 5 | ··0x0069aa84·86000800·96000800·a6000800·b6000800·................ |
| 6 | ··0x0069 | 6 | ··0x0069aa94·c6000800·d6000800·e6000800·f6000800·................ |
| 7 | ··0x0069 | 7 | ··0x0069aaa4·06010800·16010800·26010800·36010800·........&...6... |
| 8 | ··0x0069 | 8 | ··0x0069aab4·46010800·56010800·66010800·76010800·F...V...f...v... |
| 9 | ··0x0069 | 9 | ··0x0069aac4·86010800·96010800·a6010800·b6010800·................ |
| 10 | ··0x0069 | 10 | ··0x0069aad4·c6010800·d6010800·e6010800·f6010800·................ |
| 11 | ··0x0069 | 11 | ··0x0069aae4·06020800·16020800·26020800·36020800·........&...6... |
| 12 | ··0x0069 | 12 | ··0x0069aaf4·46020800·56020800·66020800·76020800·F...V...f...v... |
| 13 | ··0x0069 | 13 | ··0x0069ab04·86020800·96020800·a6020800·b6020800·................ |
| 14 | ··0x0069 | 14 | ··0x0069ab14·c6020800·d6020800·e6020800·f6020800·................ |
| 15 | ··0x0069 | 15 | ··0x0069ab24·06030800·16030800·26030800·36030800·........&...6... |
| 16 | ··0x0069 | 16 | ··0x0069ab34·46030800·56030800·66030800·76030800·F...V...f...v... |
| 17 | ··0x0069 | 17 | ··0x0069ab44·86030800·96030800·a6030800·b6030800·................ |
| 18 | ··0x0069 | 18 | ··0x0069ab54·c6030800·d6030800·e6030800·f6030800·................ |
| 19 | ··0x0069 | 19 | ··0x0069ab64·06040800·16040800·26040800·36040800·........&...6... |
| 20 | ··0x0069 | 20 | ··0x0069ab74·46040800·56040800·66040800·76040800·F...V...f...v... |
| 21 | ··0x0069 | 21 | ··0x0069ab84·86040800·96040800·a6040800·b6040800·................ |
| 22 | ··0x0069 | 22 | ··0x0069ab94·c6040800·d6040800·e6040800·f6040800·................ |
| 23 | ··0x0069 | 23 | ··0x0069aba4·06050800·16050800·26050800·36050800·........&...6... |
| 24 | ··0x0069 | 24 | ··0x0069abb4·46050800·56050800·66050800·76050800·F...V...f...v... |
| 25 | ··0x0069 | 25 | ··0x0069abc4·86050800·96050800·a6050800·b6050800·................ |
| 26 | ··0x0069 | 26 | ··0x0069abd4·c6050800·d6050800·e6050800·f6050800·................ |
| 27 | ··0x0069 | 27 | ··0x0069abe4·06060800·16060800·26060800·36060800·........&...6... |
| 28 | ··0x0069 | 28 | ··0x0069abf4·46060800·56060800·66060800·76060800·F...V...f...v... |
| 29 | ··0x0069 | 29 | ··0x0069ac04·86060800·96060800·a6060800·b6060800·................ |
| 30 | ··0x0069 | 30 | ··0x0069ac14·c6060800·d6060800·e6060800·f6060800·................ |
| 31 | ··0x0069 | 31 | ··0x0069ac24·06070800·16070800·26070800·36070800·........&...6... |
| 32 | ··0x0069 | 32 | ··0x0069ac34·46070800·56070800·66070800·76070800·F...V...f...v... |
| 33 | ··0x0069 | 33 | ··0x0069ac44·86070800·96070800·a6070800·b6070800·................ |
| 34 | ··0x0069 | 34 | ··0x0069ac54·c6070800·d6070800·e6070800·f6070800·................ |
| 35 | ··0x0069 | 35 | ··0x0069ac64·06080800·16080800·26080800·36080800·........&...6... |
| 36 | ··0x0069 | 36 | ··0x0069ac74·46080800·56080800·66080800·76080800·F...V...f...v... |
| 37 | ··0x0069 | 37 | ··0x0069ac84·86080800·96080800·a6080800·b6080800·................ |
| 38 | ··0x0069 | 38 | ··0x0069ac94·c6080800·d6080800·e6080800·f6080800·................ |
| 39 | ··0x0069 | 39 | ··0x0069aca4·06090800·16090800·26090800·36090800·........&...6... |
| 40 | ··0x0069 | 40 | ··0x0069acb4·46090800·56090800·66090800·76090800·F...V...f...v... |
| 41 | ··0x0069 | 41 | ··0x0069acc4·86090800·96090800·a6090800·b6090800·................ |
| 42 | ··0x0069 | 42 | ··0x0069acd4·c6090800·d6090800·e6090800·f6090800·................ |
| 43 | ··0x0069 | 43 | ··0x0069ace4·060a0800·160a0800·260a0800·360a0800·........&...6... |
| 44 | ··0x0069 | 44 | ··0x0069acf4·460a0800·560a0800·660a0800·760a0800·F...V...f...v... |
| 45 | ··0x0069 | 45 | ··0x0069ad04·860a0800·960a0800·a60a0800·b60a0800·................ |
| 46 | ··0x0069 | 46 | ··0x0069ad14·c60a0800·d60a0800·e60a0800·f60a0800·................ |
| 47 | ··0x0069 | 47 | ··0x0069ad24·060b0800·160b0800·260b0800·360b0800·........&...6... |
| 48 | ··0x0069 | 48 | ··0x0069ad34·460b0800·560b0800·660b0800·760b0800·F...V...f...v... |
| 49 | ··0x0069 | 49 | ··0x0069ad44·860b0800·960b0800·a60b0800·b60b0800·................ |
| 50 | ··0x0069 | 50 | ··0x0069ad54·c60b0800·d60b0800·e60b0800·f60b0800·................ |
| 51 | ··0x0069 | 51 | ··0x0069ad64·060c0800·160c0800·260c0800·360c0800·........&...6... |
| 52 | ··0x0069 | 52 | ··0x0069ad74·460c0800·560c0800·660c0800·760c0800·F...V...f...v... |
| 53 | ··0x0069 | 53 | ··0x0069ad84·860c0800·960c0800·a60c0800·b60c0800·................ |
| 54 | ··0x0069 | 54 | ··0x0069ad94·c60c0800·d60c0800·e60c0800·f60c0800·................ |
| 55 | ··0x0069 | 55 | ··0x0069ada4·060d0800·160d0800·260d0800·360d0800·........&...6... |
| 56 | ··0x0069 | 56 | ··0x0069adb4·460d0800·560d0800·660d0800·760d0800·F...V...f...v... |
| 57 | ··0x0069 | 57 | ··0x0069adc4·860d0800·960d0800·a60d0800·b60d0800·................ |
| 58 | ··0x0069 | 58 | ··0x0069add4·c60d0800·d60d0800·e60d0800·f60d0800·................ |
| 59 | ··0x0069 | 59 | ··0x0069ade4·060e0800·160e0800·260e0800·360e0800·........&...6... |
| 60 | ··0x0069 | 60 | ··0x0069adf4·460e0800·560e0800·660e0800·760e0800·F...V...f...v... |
| 61 | ··0x0069 | 61 | ··0x0069ae04·860e0800·960e0800·a60e0800·b60e0800·................ |
| 62 | ··0x0069 | 62 | ··0x0069ae14·c60e0800·d60e0800·e60e0800·f60e0800·................ |
| 63 | ··0x0069 | 63 | ··0x0069ae24·060f0800·160f0800·260f0800·360f0800·........&...6... |
| 64 | ··0x0069 | 64 | ··0x0069ae34·460f0800·560f0800·660f0800·760f0800·F...V...f...v... |
| 65 | ··0x0069 | 65 | ··0x0069ae44·860f0800·960f0800·a60f0800·b60f0800·................ |
| 66 | ··0x0069 | 66 | ··0x0069ae54·c60f0800·d60f0800·e60f0800·f60f0800·................ |
| 67 | ··0x0069 | 67 | ··0x0069ae64·06100800·16100800·26100800·36100800·........&...6... |
| 68 | ··0x0069 | 68 | ··0x0069ae74·46100800·56100800·66100800·76100800·F...V...f...v... |
| 69 | ··0x0069 | 69 | ··0x0069ae84·86100800·96100800·a6100800·b6100800·................ |
| 70 | ··0x0069 | 70 | ··0x0069ae94·c6100800·d6100800·e6100800·f6100800·................ |
| 71 | ··0x0069 | 71 | ··0x0069aea4·06110800·16110800·26110800·36110800·........&...6... |
| 72 | ··0x0069 | 72 | ··0x0069aeb4·46110800·56110800·66110800·76110800·F...V...f...v... |
| 73 | ··0x0069 | 73 | ··0x0069aec4·86110800·96110800·a6110800·b6110800·................ |
| 74 | ··0x0069 | 74 | ··0x0069aed4·c6110800·d6110800·e6110800·f6110800·................ |
| 75 | ··0x0069 | 75 | ··0x0069aee4·06120800·16120800·26120800·36120800·........&...6... |
| 76 | ··0x0069 | 76 | ··0x0069aef4·46120800·56120800·f0516900·80526900·F...V....Qi..Ri. |
| 77 | ··0x0069 | 77 | ··0x0069af04·00000000·00000000·eccc6a00·00000000·..........j..... |
| 78 | ··0x0069 | 78 | ··0x0069af14·e8cc6a00·00000000·5c526900·80562d00·..j.....\Ri..V-. |
| 79 | ··0x0069 | 79 | ··0x0069af24·e0430e00·50526900·00000000·00000000·.C..PRi......... |
| 80 | ··0x0069 | 80 | ··0x0069af34·00000000·2c526900·00000000·00000000·....,Ri......... |
| 81 | ··0x0069 | 81 | ··0x0069af44·00000000·30562d00·00000000·00000000·....0V-......... |
| 82 | ··0x0069 | 82 | ··0x0069af54·00000000·00000000·00000000·00000000·................ |
| 83 | ··0x0069 | 83 | ··0x0069af64·00000000·00000000·00000000·00000000·................ |
| 84 | ··0x0069 | 84 | ··0x0069af74·00000000·00000000·00000000·00000000·................ |
| 85 | ··0x0069 | 85 | ··0x0069af84·00000000·00000000·60cb6a00·b0532d00·........`.j..S-. |
| 86 | ··0x0069 | 86 | ··0x0069af94·00542d00·00000000·00000000·00000000·.T-............. |
| 87 | ··0x0069 | 87 | ··0x0069afa4·00000000·00000000·70572d00·00000000·........pW-..... |
| 88 | ··0x0069 | 88 | ··0x0069afb4·00000000·fc516900·40552d00·00000000·.....Qi.@U-..... |
| 89 | ··0x0069 | 89 | ··0x0069afc4·00000000·00000000·00000000·00000000·................ |
| 90 | ··0x0069 | 90 | ··0x0069afd4·00000000·00000000·00000000·00000000·................ |
| Offset 1, 4173 lines modified | Offset 1, 4173 lines modified | ||
| Diff chunk too large, falling back to line-by-line diff (4170 lines added, 4170 lines removed) | |||
| 1 | Hex·dump·of·section·'.data': | 1 | Hex·dump·of·section·'.data': |
| 2 | ··0x0069 | 2 | ··0x0069b000·00000000·04b06900·00000000·00000000·......i......... |
| 3 | ··0x0069 | 3 | ··0x0069b010·00000000·00000000·00000000·00000000·................ |
| 4 | ··0x0069 | 4 | ··0x0069b020·4b4e4b4e·54545454·52535253·49494d49·KNKNTTTTRSRSIIMI |
| 5 | ··0x0069 | 5 | ··0x0069b030·51485148·50505050·52525252·4c4c4c4c·QHQHPPPPRRRRLLLL |
| 6 | ··0x0069 | 6 | ··0x0069b040·45444544·41414141·47474747·56565656·EDEDAAAAGGGGVVVV |
| 7 | ··0x0069 | 7 | ··0x0069b050·2a592a59·53535353·47435743·4c464c46·*Y*YSSSSGCWCLFLF |
| 8 | ··0x0069 | 8 | ··0x0069b060·00000000·00000000·00000000·00000000·................ |
| 9 | ··0x0069 | 9 | ··0x0069b070·00000000·00000000·00000000·00000000·................ |
| 10 | ··0x0069 | 10 | ··0x0069b080·4b4e4b4e·54545454·53534b53·49494d49·KNKNTTTTSSKSIIMI |
| 11 | ··0x0069 | 11 | ··0x0069b090·51485148·50505050·52525252·4c4c4c4c·QHQHPPPPRRRRLLLL |
| 12 | ··0x0069 | 12 | ··0x0069b0a0·45444544·41414141·47474747·56565656·EDEDAAAAGGGGVVVV |
| 13 | ··0x0069 | 13 | ··0x0069b0b0·2a592a59·53535353·57435743·4c464c46·*Y*YSSSSWCWCLFLF |
| 14 | ··0x0069 | 14 | ··0x0069b0c0·00000000·00000000·00000000·00000000·................ |
| 15 | ··0x0069 | 15 | ··0x0069b0d0·00000000·00000000·00000000·00000000·................ |
| 16 | ··0x0069 | 16 | ··0x0069b0e0·4b4e4b4e·54545454·52535253·49494d49·KNKNTTTTRSRSIIMI |
| 17 | ··0x0069 | 17 | ··0x0069b0f0·51485148·50505050·52525252·4c4c4c4c·QHQHPPPPRRRRLLLL |
| 18 | ··0x0069 | 18 | ··0x0069b100·45444544·41414141·47474747·56565656·EDEDAAAAGGGGVVVV |
| 19 | ··0x0069 | 19 | ··0x0069b110·2a592a59·53535353·2a435743·2a464c46·*Y*YSSSS*CWC*FLF |
| 20 | ··0x0069 | 20 | ··0x0069b120·00000000·00000000·00000000·00000000·................ |
| 21 | ··0x0069 | 21 | ··0x0069b130·00000000·00000000·00000000·00000000·................ |
| 22 | ··0x0069 | 22 | ··0x0069b140·4b4e4b4e·54545454·52535253·49494d49·KNKNTTTTRSRSIIMI |
| 23 | ··0x0069 | 23 | ··0x0069b150·51485148·50505050·52525252·4c4c4c4c·QHQHPPPPRRRRLLLL |
| 24 | ··0x0069 | 24 | ··0x0069b160·45444544·41414141·47474747·56565656·EDEDAAAAGGGGVVVV |
| 25 | ··0x0069 | 25 | ··0x0069b170·2a594c59·2a535353·2a435743·4c464c46·*YLY*SSS*CWCLFLF |
| 26 | ··0x0069 | 26 | ··0x0069b180·00000000·00000000·00000000·00000000·................ |
| 27 | ··0x0069 | 27 | ··0x0069b190·00000000·00000000·00000000·00000000·................ |
| 28 | ··0x0069 | 28 | ··0x0069b1a0·4e4e4b4e·54545454·53535353·4d494d49·NNKNTTTTSSSSMIMI |
| 29 | ··0x0069 | 29 | ··0x0069b1b0·51485148·50505050·52525252·4c4c4c4c·QHQHPPPPRRRRLLLL |
| 30 | ··0x0069 | 30 | ··0x0069b1c0·45444544·41414141·47474747·56565656·EDEDAAAAGGGGVVVV |
| 31 | ··0x0069 | 31 | ··0x0069b1d0·2a592a59·53535353·57435743·4c464c46·*Y*YSSSSWCWCLFLF |
| 32 | ··0x0069 | 32 | ··0x0069b1e0·00000000·00000000·00000000·00000000·................ |
| 33 | ··0x0069 | 33 | ··0x0069b1f0·00000000·00000000·00000000·00000000·................ |
| 34 | ··0x0069 | 34 | ··0x0069b200·4b4e4b4e·54545454·52535253·49494d49·KNKNTTTTRSRSIIMI |
| 35 | ··0x0069 | 35 | ··0x0069b210·51485148·50505050·52525252·4c4c4c4c·QHQHPPPPRRRRLLLL |
| 36 | ··0x0069 | 36 | ··0x0069b220·45444544·41414141·47474747·56565656·EDEDAAAAGGGGVVVV |
| 37 | ··0x0069 | 37 | ··0x0069b230·2a594c59·53535353·2a435743·4c464c46·*YLYSSSS*CWCLFLF |
| 38 | ··0x0069 | 38 | ··0x0069b240·00000000·00000000·00000000·00000000·................ |
| 39 | ··0x0069 | 39 | ··0x0069b250·00000000·00000000·00000000·00000000·................ |
| 40 | ··0x0069 | 40 | ··0x0069b260·4b4e4b4e·54545454·52535253·49494d49·KNKNTTTTRSRSIIMI |
| 41 | ··0x0069 | 41 | ··0x0069b270·51485148·50505050·52525252·4c4c4c4c·QHQHPPPPRRRRLLLL |
| 42 | ··0x0069 | 42 | ··0x0069b280·45444544·41414141·47474747·56565656·EDEDAAAAGGGGVVVV |
| 43 | ··0x0069 | 43 | ··0x0069b290·2a595159·53535353·2a435743·4c464c46·*YQYSSSS*CWCLFLF |
| 44 | ··0x0069 | 44 | ··0x0069b2a0·00000000·00000000·00000000·00000000·................ |
| 45 | ··0x0069 | 45 | ··0x0069b2b0·00000000·00000000·00000000·00000000·................ |
| 46 | ··0x0069 | 46 | ··0x0069b2c0·4e4e4b4e·54545454·53535353·49494d49·NNKNTTTTSSSSIIMI |
| 47 | ··0x0069 | 47 | ··0x0069b2d0·51485148·50505050·52525252·4c4c4c4c·QHQHPPPPRRRRLLLL |
| 48 | ··0x0069 | 48 | ··0x0069b2e0·45444544·41414141·47474747·56565656·EDEDAAAAGGGGVVVV |
| 49 | ··0x0069 | 49 | ··0x0069b2f0·59592a59·53535353·57435743·4c464c46·YY*YSSSSWCWCLFLF |
| 50 | ··0x0069 | 50 | ··0x0069b300·00000000·00000000·00000000·00000000·................ |
| 51 | ··0x0069 | 51 | ··0x0069b310·00000000·00000000·00000000·00000000·................ |
| 52 | ··0x0069 | 52 | ··0x0069b320·4b4e4b4e·54545454·47534753·4d494d49·KNKNTTTTGSGSMIMI |
| 53 | ··0x0069 | 53 | ··0x0069b330·51485148·50505050·52525252·4c4c4c4c·QHQHPPPPRRRRLLLL |
| 54 | ··0x0069 | 54 | ··0x0069b340·45444544·41414141·47474747·56565656·EDEDAAAAGGGGVVVV |
| 55 | ··0x0069 | 55 | ··0x0069b350·2a592a59·53535353·57435743·4c464c46·*Y*YSSSSWCWCLFLF |
| 56 | ··0x0069 | 56 | ··0x0069b360·00000000·00000000·00000000·00000000·................ |
| 57 | ··0x0069 | 57 | ··0x0069b370·00000000·00000000·00000000·00000000·................ |
| 58 | ··0x0069 | 58 | ··0x0069b380·4b4e4b4e·54545454·52535253·49494d49·KNKNTTTTRSRSIIMI |
| 59 | ··0x0069 | 59 | ··0x0069b390·51485148·50505050·52525252·4c4c534c·QHQHPPPPRRRRLLSL |
| 60 | ··0x0069 | 60 | ··0x0069b3a0·45444544·41414141·47474747·56565656·EDEDAAAAGGGGVVVV |
| 61 | ··0x0069 | 61 | ··0x0069b3b0·2a592a59·53535353·2a435743·4c464c46·*Y*YSSSS*CWCLFLF |
| 62 | ··0x0069 | 62 | ··0x0069b3c0·00000000·00000000·00000000·00000000·................ |
| 63 | ··0x0069 | 63 | ··0x0069b3d0·00000000·00000000·00000000·00000000·................ |
| 64 | ··0x0069 | 64 | ··0x0069b3e0·4b4e4b4e·54545454·52535253·49494d49·KNKNTTTTRSRSIIMI |
| 65 | ··0x0069 | 65 | ··0x0069b3f0·51485148·50505050·52525252·4c4c4c4c·QHQHPPPPRRRRLLLL |
| 66 | ··0x0069 | 66 | ··0x0069b400·45444544·41414141·47474747·56565656·EDEDAAAAGGGGVVVV |
| 67 | ··0x0069 | 67 | ··0x0069b410·2a592a59·53535353·2a435743·4c464c46·*Y*YSSSS*CWCLFLF |
| 68 | ··0x0069 | 68 | ··0x0069b420·00000000·00000000·00000000·00000000·................ |
| 69 | ··0x0069 | 69 | ··0x0069b430·00000000·00000000·00000000·00000000·................ |
| 70 | ··0x0069 | 70 | ··0x0069b440·4b4e4b4e·54545454·52535253·49494d49·KNKNTTTTRSRSIIMI |
| 71 | ··0x0069 | 71 | ··0x0069b450·51485148·50505050·52525252·4c4c4c4c·QHQHPPPPRRRRLLLL |
| 72 | ··0x0069 | 72 | ··0x0069b460·45444544·41414141·47474747·56565656·EDEDAAAAGGGGVVVV |
| 73 | ··0x0069 | 73 | ··0x0069b470·2a592a59·53535353·43435743·4c464c46·*Y*YSSSSCCWCLFLF |
| 74 | ··0x0069 | 74 | ··0x0069b480·00000000·00000000·00000000·00000000·................ |
| 75 | ··0x0069 | 75 | ··0x0069b490·00000000·00000000·00000000·00000000·................ |
| 76 | ··0x0069 | 76 | ··0x0069b4a0·4e4e4b4e·54545454·53535353·49494d49·NNKNTTTTSSSSIIMI |
| 77 | ··0x0069 | 77 | ··0x0069b4b0·51485148·50505050·52525252·4c4c4c4c·QHQHPPPPRRRRLLLL |
| 78 | ··0x0069 | 78 | ··0x0069b4c0·45444544·41414141·47474747·56565656·EDEDAAAAGGGGVVVV |
| 79 | ··0x0069 | 79 | ··0x0069b4d0·2a592a59·53535353·57435743·4c464c46·*Y*YSSSSWCWCLFLF |
| 80 | ··0x0069 | 80 | ··0x0069b4e0·00000000·00000000·00000000·00000000·................ |
| 81 | ··0x0069 | 81 | ··0x0069b4f0·00000000·00000000·00000000·00000000·................ |
| 82 | ··0x0069 | 82 | ··0x0069b500·4b4e4b4e·54545454·52535253·49494d49·KNKNTTTTRSRSIIMI |
| 83 | ··0x0069 | 83 | ··0x0069b510·51485148·50505050·52525252·4c4c4c4c·QHQHPPPPRRRRLLLL |
| 84 | ··0x0069 | 84 | ··0x0069b520·45444544·41414141·47474747·56565656·EDEDAAAAGGGGVVVV |
| 85 | ··0x0069 | 85 | ··0x0069b530·51595159·53535353·2a435743·4c464c46·QYQYSSSS*CWCLFLF |
| 86 | ··0x0069 | 86 | ··0x0069b540·00000000·00000000·00000000·00000000·................ |
| 87 | ··0x0069 | 87 | ··0x0069b550·00000000·00000000·00000000·00000000·................ |
| 88 | ··0x0069 | 88 | ··0x0069b560·4b4e4b4e·54545454·53535353·4d494d49·KNKNTTTTSSSSMIMI |
| 89 | ··0x0069 | 89 | ··0x0069b570·51485148·50505050·52525252·4c4c4c4c·QHQHPPPPRRRRLLLL |
| 90 | ··0x0069 | 90 | ··0x0069b580·45444544·41414141·47474747·56565656·EDEDAAAAGGGGVVVV |
| 91 | ··0x0069 | 91 | ··0x0069b590·2a592a59·53535353·57435743·4c464c46·*Y*YSSSSWCWCLFLF |
| 92 | ··0x0069 | 92 | ··0x0069b5a0·00000000·00000000·00000000·00000000·................ |
| 93 | ··0x0069 | 93 | ··0x0069b5b0·00000000·00000000·00000000·00000000·................ |
| 94 | ··0x0069 | 94 | ··0x0069b5c0·4b4e4b4e·54545454·52535253·49494d49·KNKNTTTTRSRSIIMI |
| 95 | ··0x0069 | 95 | ··0x0069b5d0·51485148·50505050·52525252·4c4c4c4c·QHQHPPPPRRRRLLLL |
| 96 | ··0x0069 | 96 | ··0x0069b5e0·45444544·41414141·47474747·56565656·EDEDAAAAGGGGVVVV |
| 97 | ··0x0069 | 97 | ··0x0069b5f0·2a592a59·53535353·57435743·4c464c46·*Y*YSSSSWCWCLFLF |
| 98 | ··0x0069 | 98 | ··0x0069b600·00000000·00000000·00000000·00000000·................ |
| 99 | ··0x0069 | 99 | ··0x0069b610·00000000·00000000·00000000·00000000·................ |
| 100 | ··0x0069 | 100 | ··0x0069b620·4b4e4b4e·54545454·52535253·4d494d49·KNKNTTTTRSRSMIMI |
| 101 | ··0x0069 | 101 | ··0x0069b630·51485148·50505050·52525252·54545454·QHQHPPPPRRRRTTTT |
| 102 | ··0x0069 | 102 | ··0x0069b640·45444544·41414141·47474747·56565656·EDEDAAAAGGGGVVVV |
| 103 | ··0x0069 | 103 | ··0x0069b650·2a592a59·53535353·57435743·4c464c46·*Y*YSSSSWCWCLFLF |
| 104 | ··0x0069 | 104 | ··0x0069b660·00000000·00000000·00000000·00000000·................ |
| 105 | ··0x0069 | 105 | ··0x0069b670·00000000·00000000·00000000·00000000·................ |
| 106 | ··0x0069 | 106 | ··0x0069b680·4b4e4b4e·54545454·2a532a53·4d494d49·KNKNTTTT*S*SMIMI |
| 107 | ··0x0069 | 107 | ··0x0069b690·51485148·50505050·52525252·4c4c4c4c·QHQHPPPPRRRRLLLL |
| 108 | ··0x0069 | 108 | ··0x0069b6a0·45444544·41414141·47474747·56565656·EDEDAAAAGGGGVVVV |
| 109 | ··0x0069 | 109 | ··0x0069b6b0·2a592a59·53535353·57435743·4c464c46·*Y*YSSSSWCWCLFLF |
| 110 | ··0x0069 | 110 | ··0x0069b6c0·00000000·00000000·00000000·00000000·................ |
| 111 | ··0x0069 | 111 | ··0x0069b6d0·00000000·00000000·00000000·00000000·................ |
| 112 | ··0x0069 | 112 | ··0x0069b6e0·4b4e4b4e·54545454·52535253·49494d49·KNKNTTTTRSRSIIMI |
| 113 | ··0x0069 | 113 | ··0x0069b6f0·51485148·50505050·52525252·4c4c4c4c·QHQHPPPPRRRRLLLL |
| 114 | ··0x0069 | 114 | ··0x0069b700·45444544·41414141·47474747·56565656·EDEDAAAAGGGGVVVV |
| 115 | ··0x0069 | 115 | ··0x0069b710·2a592a59·53535353·2a435743·4c464c46·*Y*YSSSS*CWCLFLF |
| 116 | ··0x0069 | 116 | ··0x0069b720·00000000·00000000·00000000·00000000·................ |
| 117 | ··0x0069 | 117 | ··0x0069b730·00000000·00000000·00000000·00000000·................ |
| 118 | ··0x0069 | 118 | ··0x0069b740·30313233·34353637·38394142·43444546·0123456789ABCDEF |
| 119 | ··0x0069 | 119 | ··0x0069b750·4748494a·4b4c4d4e·4f505152·53545556·GHIJKLMNOPQRSTUV |
| 120 | ··0x0069 | 120 | ··0x0069b760·00000000·41434755·00000000·41434754·....ACGU....ACGT |
| 121 | ··0x0069 | 121 | ··0x0069b770·00000000·41524e44·43514547·48494c4b·....ARNDCQEGHILK |
| 122 | ··0x0069 | 122 | ··0x0069b780·4d465053·54575956·58000000·5c595200·MFPSTWYVX...\YR. |
| 123 | ··0x0069 | 123 | ··0x0069b790·80595200·9a395100·7c395100·a0595200·.YR..9Q.|9Q..YR. |
| 124 | ··0x0069 | 124 | ··0x0069b7a0·dc595200·50205200·ffffffff·6c3b6900·.YR.P·R.....l;i. |
| 125 | ··0x0069 | 125 | ··0x0069b7b0·00000000·00000000·00000000·00000000·................ |
| Max diff block lines reached; 0/558828 bytes (0.00%) of diff not shown. | |||
| Offset 1, 8 lines modified | Offset 1, 8 lines modified | ||
| 1 | Hex·dump·of·section·'.gnu_debugaltlink': | 1 | Hex·dump·of·section·'.gnu_debugaltlink': |
| 2 | ··0x00000000·2f757372·2f6c6962·2f646562·75672f2e·/usr/lib/debug/. | 2 | ··0x00000000·2f757372·2f6c6962·2f646562·75672f2e·/usr/lib/debug/. |
| 3 | ··0x00000010·64777a2f·69333836·2d6c696e·75782d67·dwz/i386-linux-g | 3 | ··0x00000010·64777a2f·69333836·2d6c696e·75782d67·dwz/i386-linux-g |
| 4 | ··0x00000020·6e752f69·71747265·652e6465·62756700·nu/iqtree.debug. | 4 | ··0x00000020·6e752f69·71747265·652e6465·62756700·nu/iqtree.debug. |
| 5 | ··0x00000030· | 5 | ··0x00000030·6b572d48·6c5a52d6·d5a227cc·ab12a58e·kW-HlZR...'..... |
| 6 | ··0x00000040· | 6 | ··0x00000040·b8e8e5e8····························.... |
| Offset 1, 7 lines modified | Offset 1, 7 lines modified | ||
| 1 | Hex·dump·of·section·'.gnu_debuglink': | 1 | Hex·dump·of·section·'.gnu_debuglink': |
| 2 | ··0x00000000·63393639·31626537·64353738·38663161·c9691be7d5788f1a | ||
| 3 | ··0x000000 | 2 | ··0x00000000·36613231·63383066·63363338·32376164·6a21c80fc63827ad |
| 3 | ··0x00000010·39626134·66623134·37383466·30326331·9ba4fb14784f02c1 | ||
| 4 | ··0x00000020·3 | 4 | ··0x00000020·36663636·61652e64·65627567·00000000·6f66ae.debug.... |
| 5 | ··0x00000030· | 5 | ··0x00000030·7f040c1d····························.... |
| Offset 4, 17 lines modified | Offset 4, 17 lines modified | ||
| 4 | ··Data:······························2's·complement,·little·endian | 4 | ··Data:······························2's·complement,·little·endian |
| 5 | ··Version:···························1·(current) | 5 | ··Version:···························1·(current) |
| 6 | ··OS/ABI:····························UNIX·-·GNU | 6 | ··OS/ABI:····························UNIX·-·GNU |
| 7 | ··ABI·Version:·······················0 | 7 | ··ABI·Version:·······················0 |
| 8 | ··Type:······························DYN·(Position-Independent·Executable·file) | 8 | ··Type:······························DYN·(Position-Independent·Executable·file) |
| 9 | ··Machine:···························Intel·80386 | 9 | ··Machine:···························Intel·80386 |
| 10 | ··Version:···························0x1 | 10 | ··Version:···························0x1 |
| 11 | ··Entry·point·address:···············0xe84 | 11 | ··Entry·point·address:···············0xe84e0 |
| 12 | ··Start·of·program·headers:··········52·(bytes·into·file) | 12 | ··Start·of·program·headers:··········52·(bytes·into·file) |
| 13 | ··Start·of·section·headers:··········70 | 13 | ··Start·of·section·headers:··········7013944·(bytes·into·file) |
| 14 | ··Flags:·····························0x0 | 14 | ··Flags:·····························0x0 |
| 15 | ··Size·of·this·header:···············52·(bytes) | 15 | ··Size·of·this·header:···············52·(bytes) |
| 16 | ··Size·of·program·headers:···········32·(bytes) | 16 | ··Size·of·program·headers:···········32·(bytes) |
| 17 | ··Number·of·program·headers:·········12 | 17 | ··Number·of·program·headers:·········12 |
| 18 | ··Size·of·section·headers:···········40·(bytes) | 18 | ··Size·of·section·headers:···········40·(bytes) |
| 19 | ··Number·of·section·headers:·········30 | 19 | ··Number·of·section·headers:·········30 |
| 20 | ··Section·header·string·table·index:·29 | 20 | ··Section·header·string·table·index:·29 |
| Offset 1, 27 lines modified | Offset 1, 27 lines modified | ||
| 1 | Elf·file·type·is·DYN·(Position-Independent·Executable·file) | 1 | Elf·file·type·is·DYN·(Position-Independent·Executable·file) |
| 2 | Entry·point·0xe84 | 2 | Entry·point·0xe84e0 |
| 3 | There·are·12·program·headers,·starting·at·offset·52 | 3 | There·are·12·program·headers,·starting·at·offset·52 |
| 4 | Program·Headers: | 4 | Program·Headers: |
| 5 | ··Type···········Offset···VirtAddr···PhysAddr···FileSiz·MemSiz··Flg·Align | 5 | ··Type···········Offset···VirtAddr···PhysAddr···FileSiz·MemSiz··Flg·Align |
| 6 | ··PHDR···········0x000034·0x00000034·0x00000034·0x00180·0x00180·R···0x4 | 6 | ··PHDR···········0x000034·0x00000034·0x00000034·0x00180·0x00180·R···0x4 |
| 7 | ··INTERP·········0x0001d8·0x000001d8·0x000001d8·0x00013·0x00013·R···0x1 | 7 | ··INTERP·········0x0001d8·0x000001d8·0x000001d8·0x00013·0x00013·R···0x1 |
| 8 | ······[Requesting·program·interpreter:·/lib/ld-linux.so.2] | 8 | ······[Requesting·program·interpreter:·/lib/ld-linux.so.2] |
| 9 | ··LOAD···········0x000000·0x00000000·0x00000000·0x7fff0·0x7fff0·R···0x1000 | 9 | ··LOAD···········0x000000·0x00000000·0x00000000·0x7fff0·0x7fff0·R···0x1000 |
| 10 | ··LOAD···········0x080000·0x00080000·0x00080000·0x49 | 10 | ··LOAD···········0x080000·0x00080000·0x00080000·0x4965a8·0x4965a8·R·E·0x1000 |
| 11 | ··LOAD···········0x51 | 11 | ··LOAD···········0x517000·0x00517000·0x00517000·0x180a6c·0x180a6c·R···0x1000 |
| 12 | ··LOAD···········0x69 | 12 | ··LOAD···········0x69812c·0x0069812c·0x0069812c·0x18370·0x24654·RW··0x1000 |
| 13 | ··DYNAMIC········0x69 | 13 | ··DYNAMIC········0x69f8fc·0x0069f8fc·0x0069f8fc·0x00130·0x00130·RW··0x4 |
| 14 | ··NOTE···········0x0001b4·0x000001b4·0x000001b4·0x00024·0x00024·R···0x4 | 14 | ··NOTE···········0x0001b4·0x000001b4·0x000001b4·0x00024·0x00024·R···0x4 |
| 15 | ··NOTE···········0x69 | 15 | ··NOTE···········0x697a4c·0x00697a4c·0x00697a4c·0x00020·0x00020·R···0x4 |
| 16 | ··GNU_EH_FRAME···0x5d | 16 | ··GNU_EH_FRAME···0x5db498·0x005db498·0x005db498·0x0de8c·0x0de8c·R···0x4 |
| 17 | ··GNU_STACK······0x000000·0x00000000·0x00000000·0x00000·0x00000·RW··0x10 | 17 | ··GNU_STACK······0x000000·0x00000000·0x00000000·0x00000·0x00000·RW··0x10 |
| 18 | ··GNU_RELRO······0x69 | 18 | ··GNU_RELRO······0x69812c·0x0069812c·0x0069812c·0x07ed4·0x07ed4·R···0x1 |
| 19 | ·Section·to·Segment·mapping: | 19 | ·Section·to·Segment·mapping: |
| 20 | ··Segment·Sections... | 20 | ··Segment·Sections... |
| 21 | ···00····· | 21 | ···00····· |
| 22 | ···01·····.interp· | 22 | ···01·····.interp· |
| 23 | ···02·····.note.gnu.build-id·.interp·.gnu.hash·.dynsym·.dynstr·.gnu.version·.gnu.version_r·.rel.dyn·.rel.plt· | 23 | ···02·····.note.gnu.build-id·.interp·.gnu.hash·.dynsym·.dynstr·.gnu.version·.gnu.version_r·.rel.dyn·.rel.plt· |
| 24 | ···03·····.init·.plt·.plt.got·.text·.fini· | 24 | ···03·····.init·.plt·.plt.got·.text·.fini· |
| Offset 1, 8 lines modified | Offset 1, 8 lines modified | ||
| 1 | There·are·30·section·headers,·starting·at·offset·0x6 | 1 | There·are·30·section·headers,·starting·at·offset·0x6b0638: |
| 2 | Section·Headers: | 2 | Section·Headers: |
| 3 | ··[Nr]·Name··············Type············Addr·····Off····Size···ES·Flg·Lk·Inf·Al | 3 | ··[Nr]·Name··············Type············Addr·····Off····Size···ES·Flg·Lk·Inf·Al |
| 4 | ··[·0]···················NULL············00000000·000000·000000·00······0···0··0 | 4 | ··[·0]···················NULL············00000000·000000·000000·00······0···0··0 |
| 5 | ··[·1]·.note.gnu.build-id·NOTE············000001b4·0001b4·000024·00···A··0···0··4 | 5 | ··[·1]·.note.gnu.build-id·NOTE············000001b4·0001b4·000024·00···A··0···0··4 |
| 6 | ··[·2]·.interp···········PROGBITS········000001d8·0001d8·000013·00···A··0···0··1 | 6 | ··[·2]·.interp···········PROGBITS········000001d8·0001d8·000013·00···A··0···0··1 |
| 7 | ··[·3]·.gnu.hash·········GNU_HASH········000001ec·0001ec·00abd0·04···A··4···0··4 | 7 | ··[·3]·.gnu.hash·········GNU_HASH········000001ec·0001ec·00abd0·04···A··4···0··4 |
| Offset 11, 29 lines modified | Offset 11, 29 lines modified | ||
| 11 | ··[·6]·.gnu.version······VERSYM··········00070268·070268·0030ce·02···A··4···0··2 | 11 | ··[·6]·.gnu.version······VERSYM··········00070268·070268·0030ce·02···A··4···0··2 |
| 12 | ··[·7]·.gnu.version_r····VERNEED·········00073338·073338·0002e0·00···A··5···5··4 | 12 | ··[·7]·.gnu.version_r····VERNEED·········00073338·073338·0002e0·00···A··5···5··4 |
| 13 | ··[·8]·.rel.dyn··········REL·············00073618·073618·00c048·08···A··4···0··4 | 13 | ··[·8]·.rel.dyn··········REL·············00073618·073618·00c048·08···A··4···0··4 |
| 14 | ··[·9]·.rel.plt··········REL·············0007f660·07f660·000990·08··AI··4··24··4 | 14 | ··[·9]·.rel.plt··········REL·············0007f660·07f660·000990·08··AI··4··24··4 |
| 15 | ··[10]·.init·············PROGBITS········00080000·080000·000020·00··AX··0···0··4 | 15 | ··[10]·.init·············PROGBITS········00080000·080000·000020·00··AX··0···0··4 |
| 16 | ··[11]·.plt··············PROGBITS········00080020·080020·001330·04··AX··0···0·16 | 16 | ··[11]·.plt··············PROGBITS········00080020·080020·001330·04··AX··0···0·16 |
| 17 | ··[12]·.plt.got··········PROGBITS········00081350·081350·000018·08··AX··0···0··8 | 17 | ··[12]·.plt.got··········PROGBITS········00081350·081350·000018·08··AX··0···0··8 |
| 18 | ··[13]·.text·············PROGBITS········00081380·081380·49 | 18 | ··[13]·.text·············PROGBITS········00081380·081380·495214·00··AX··0···0·64 |
| 19 | ··[14]·.fini·············PROGBITS········0051 | 19 | ··[14]·.fini·············PROGBITS········00516594·516594·000014·00··AX··0···0··4 |
| 20 | ··[15]·.rodata···········PROGBITS········0051 | 20 | ··[15]·.rodata···········PROGBITS········00517000·517000·0c4498·00···A··0···0·32 |
| 21 | ··[16]·.eh_frame_hdr·····PROGBITS········005d | 21 | ··[16]·.eh_frame_hdr·····PROGBITS········005db498·5db498·00de8c·00···A··0···0··4 |
| 22 | ··[17]·.eh_frame·········PROGBITS········005e | 22 | ··[17]·.eh_frame·········PROGBITS········005e9324·5e9324·08ffe4·00···A··0···0··4 |
| 23 | ··[18]·.gcc_except_table·PROGBITS········0067 | 23 | ··[18]·.gcc_except_table·PROGBITS········00679308·679308·01e741·00···A··0···0··4 |
| 24 | ··[19]·.note.ABI-tag·····NOTE············0069 | 24 | ··[19]·.note.ABI-tag·····NOTE············00697a4c·697a4c·000020·00···A··0···0··4 |
| 25 | ··[20]·.init_array·······INIT_ARRAY······0069 | 25 | ··[20]·.init_array·······INIT_ARRAY······0069812c·69812c·000030·04··WA··0···0··4 |
| 26 | ··[21]·.fini_array·······FINI_ARRAY······0069 | 26 | ··[21]·.fini_array·······FINI_ARRAY······0069815c·69815c·000004·04··WA··0···0··4 |
| 27 | ··[22]·.data.rel.ro······PROGBITS········0069 | 27 | ··[22]·.data.rel.ro······PROGBITS········00698160·698160·00779c·00··WA··0···0·32 |
| 28 | ··[23]·.dynamic··········DYNAMIC·········0069 | 28 | ··[23]·.dynamic··········DYNAMIC·········0069f8fc·69f8fc·000130·08··WA··5···0··4 |
| 29 | ··[24]·.got··············PROGBITS········0069 | 29 | ··[24]·.got··············PROGBITS········0069fa2c·69fa2c·0005bc·04··WA··0···0··4 |
| 30 | ··[25]·.data·············PROGBITS········006 | 30 | ··[25]·.data·············PROGBITS········006a0000·6a0000·01049c·00··WA··0···0·32 |
| 31 | ··[26]·.bss··············NOBITS··········006 | 31 | ··[26]·.bss··············NOBITS··········006b04a0·6b049c·00c2e0·00··WA··0···0·32 |
| 32 | ··[27]·.gnu_debugaltlink·PROGBITS········00000000·6 | 32 | ··[27]·.gnu_debugaltlink·PROGBITS········00000000·6b049c·000044·00······0···0··1 |
| 33 | ··[28]·.gnu_debuglink····PROGBITS········00000000·6 | 33 | ··[28]·.gnu_debuglink····PROGBITS········00000000·6b04e0·000034·00······0···0··4 |
| 34 | ··[29]·.shstrtab·········STRTAB··········00000000·6 | 34 | ··[29]·.shstrtab·········STRTAB··········00000000·6b0514·000123·00······0···0··1 |
| 35 | Key·to·Flags: | 35 | Key·to·Flags: |
| 36 | ··W·(write),·A·(alloc),·X·(execute),·M·(merge),·S·(strings),·I·(info), | 36 | ··W·(write),·A·(alloc),·X·(execute),·M·(merge),·S·(strings),·I·(info), |
| 37 | ··L·(link·order),·O·(extra·OS·processing·required),·G·(group),·T·(TLS), | 37 | ··L·(link·order),·O·(extra·OS·processing·required),·G·(group),·T·(TLS), |
| 38 | ··C·(compressed),·x·(unknown),·o·(OS·specific),·E·(exclude), | 38 | ··C·(compressed),·x·(unknown),·o·(OS·specific),·E·(exclude), |
| 39 | ··R·(retain),·D·(mbind),·p·(processor·specific) | 39 | ··R·(retain),·D·(mbind),·p·(processor·specific) |
| Offset 375, 5876 lines modified | Offset 375, 5876 lines modified | ||
| 375 | ···371:·00000000·····0·FUNC····GLOBAL·DEFAULT··UND·_ZNKSt7__cxx1112basic_stringIcSt11char_traitsIcESaIcEE16find_last_not_ofEPKcjj@GLIBCXX_3.4.21·(5) | 375 | ···371:·00000000·····0·FUNC····GLOBAL·DEFAULT··UND·_ZNKSt7__cxx1112basic_stringIcSt11char_traitsIcESaIcEE16find_last_not_ofEPKcjj@GLIBCXX_3.4.21·(5) |
| 376 | ···372:·00000000·····0·FUNC····GLOBAL·DEFAULT··UND·_ZNSt7__cxx1112basic_stringIcSt11char_traitsIcESaIcEE9_M_mutateEjjPKcj@GLIBCXX_3.4.21·(5) | 376 | ···372:·00000000·····0·FUNC····GLOBAL·DEFAULT··UND·_ZNSt7__cxx1112basic_stringIcSt11char_traitsIcESaIcEE9_M_mutateEjjPKcj@GLIBCXX_3.4.21·(5) |
| 377 | ···373:·00000000·····0·FUNC····GLOBAL·DEFAULT··UND·__isoc23_strtol@GLIBC_2.38·(14) | 377 | ···373:·00000000·····0·FUNC····GLOBAL·DEFAULT··UND·__isoc23_strtol@GLIBC_2.38·(14) |
| 378 | ···374:·00000000·····0·FUNC····GLOBAL·DEFAULT··UND·realloc@GLIBC_2.0·(4) | 378 | ···374:·00000000·····0·FUNC····GLOBAL·DEFAULT··UND·realloc@GLIBC_2.0·(4) |
| 379 | ···375:·00000000·····0·FUNC····GLOBAL·DEFAULT··UND·fopen@GLIBC_2.1·(10) | 379 | ···375:·00000000·····0·FUNC····GLOBAL·DEFAULT··UND·fopen@GLIBC_2.1·(10) |
| 380 | ···376:·00000000·····0·FUNC····GLOBAL·DEFAULT··UND·_ZNSt6localeC1Ev@GLIBCXX_3.4·(3) | 380 | ···376:·00000000·····0·FUNC····GLOBAL·DEFAULT··UND·_ZNSt6localeC1Ev@GLIBCXX_3.4·(3) |
| 381 | ···377:·00000000·····0·FUNC····GLOBAL·DEFAULT··UND·ftell@GLIBC_2.0·(4) | 381 | ···377:·00000000·····0·FUNC····GLOBAL·DEFAULT··UND·ftell@GLIBC_2.0·(4) |
| 382 | ···378:·003d44 | 382 | ···378:·003d44c0····71·FUNC····GLOBAL·DEFAULT···13·_ZN8RateFree9meanRatesEv |
| 383 | ···379:·004ac8 | 383 | ···379:·004ac8b0····37·FUNC····GLOBAL·DEFAULT···13·_ZN10Checkpoint11setFileNameENSt7__cxx1112basic_stringIcSt11char_traitsIcESaIcEEE |
| 384 | ···380:·003914 | 384 | ···380:·003914a0···792·FUNC····GLOBAL·DEFAULT···13·bitVectorInitravSpecial |
| 385 | ···381:·00184a | 385 | ···381:·00184ab0··1892·FUNC····GLOBAL·DEFAULT···13·_ZN6IQTreeD2Ev |
| 386 | ···382:·00406 | 386 | ···382:·00406c60····42·FUNC····GLOBAL·DEFAULT···13·_ZTv0_n188_N16ModelPoMoMixture9writeInfoERSo |
| 387 | ···383:·0016eb | 387 | ···383:·0016eba0··1025·FUNC····WEAK···DEFAULT···13·_ZNSt6vectorIxSaIxEE14_M_fill_insertEN9__gnu_cxx17__normal_iteratorIPxS1_EEjRKx |
| 388 | ···384:·0039a5 | 388 | ···384:·0039a590···959·FUNC····GLOBAL·DEFAULT···13·makenewzGeneric |
| 389 | ···385:·00272 | 389 | ···385:·00272b40··2196·FUNC····WEAK···DEFAULT···13·_ZN9PhyloTree38computeLikelihoodFromBufferGenericSIMDI5Vec2dLb0ELb1EEEdv |
| 390 | ···386:·00356 | 390 | ···386:·00356f40·····1·FUNC····GLOBAL·DEFAULT···13·_ZN22PhyloSuperTreeUnlinked8mapTreesEv |
| 391 | ···387:·003194 | 391 | ···387:·003194b0··5548·FUNC····GLOBAL·DEFAULT···13·_ZN9PDNetwork13findPDArea_LPER6ParamsRSt6vectorI8SplitSetSaIS3_EE |
| 392 | ···388:·004f34 | 392 | ···388:·004f34a0···172·FUNC····GLOBAL·DEFAULT···13·_ZN8NxsTokenC2ERSi |
| 393 | ···389:·00247 | 393 | ···389:·00247940··4134·FUNC····GLOBAL·DEFAULT···13·_Z18doKmeansClusteringR6ParamsP14PhyloSuperTreeiRSt6vectorIdSaIdEER15ModelCheckpointP11ModelsBlockiRS3_ISt3setIiSt4lessIiESaIiEESaISF_EERS3_INSt7__cxx1112basic_stringIcSt11char_traitsIcESaIcEEESaISO_EE |
| 394 | ···390:·003394 | 394 | ···390:·003394e0···121·FUNC····GLOBAL·DEFAULT···13·_ZN6PDTreeC1ERS_ |
| 395 | ···391:·001b62 | 395 | ···391:·001b62a0···552·FUNC····WEAK···DEFAULT···13·_ZNSt6vectorIS_IP4NodeSaIS1_EESaIS3_EE17_M_realloc_appendIJRKS3_EEEvDpOT_ |
| 396 | ···392:·006b | 396 | ···392:·006b1628·····8·OBJECT··UNIQUE·DEFAULT···26·_ZGVZN4YAML3Exp8EscBreakEvE1e |
| 397 | ···393:·00508 | 397 | ···393:·00508cf0···592·FUNC····GLOBAL·DEFAULT···13·_ZN8terraces15bad_input_errorC1ENS_20bad_input_error_typeENSt7__cxx1112basic_stringIcSt11char_traitsIcESaIcEEE |
| 398 | ···394:·003c0 | 398 | ···394:·003c0920····58·FUNC····GLOBAL·DEFAULT···13·_ZN18PartitionModelPlenC2ER6ParamsP18PhyloSuperTreePlenP11ModelsBlock |
| 399 | ···395:·0019c | 399 | ···395:·0019c830···408·FUNC····GLOBAL·DEFAULT···13·_ZN5MTreeC1ERS_ |
| 400 | ···396:·00156 | 400 | ···396:·00156610···407·FUNC····WEAK···DEFAULT···13·_ZNSt8_Rb_treeINSt7__cxx1112basic_stringIcSt11char_traitsIcESaIcEEESt4pairIKS5_dESt10_Select1stIS8_ESt4lessIS5_ESaIS8_EE16_M_insert_uniqueIS8_EES6_ISt17_Rb_tree_iteratorIS8_EbEOT_ |
| 401 | ···397:·001c6e | 401 | ···397:·001c6ef0···185·FUNC····GLOBAL·DEFAULT···13·_ZN18PhyloSuperTreePlen11linkCheckReEiP4NodeS1_P13PhyloNeighborS3_ |
| 402 | ···398:·001f2 | 402 | ···398:·001f2330···141·FUNC····GLOBAL·DEFAULT···13·_ZN12outstreambuf5closeEv |
| 403 | ···399:·002a4 | 403 | ···399:·002a4a60··1123·FUNC····WEAK···DEFAULT···13·_ZN9PhyloTree27computeLikelihoodBufferSIMDI5Vec2dLb0ELi4ELb0ELb1EEEvP13PhyloNeighborP9PhyloNodejji |
| 404 | ···400:·004fa6 | 404 | ···400:·004fa6c0···734·FUNC····GLOBAL·DEFAULT···13·_ZN8terraces31maximum_comprehensive_columnsetERKNS_9bitmatrixE |
| 405 | ···401:·00343 | 405 | ···401:·00343d60····59·FUNC····GLOBAL·DEFAULT···13·_ZN12MSplitsBlock5ResetEv |
| 406 | ···402:·0069 | 406 | ···402:·00698ca8···120·OBJECT··WEAK···DEFAULT···22·_ZTV9Alignment |
| 407 | ···403:·004d6f | 407 | ···403:·004d6fe0···154·FUNC····GLOBAL·DEFAULT···13·_ZN19NxsAssumptionsBlockD2Ev |
| 408 | ···404:·0051 | 408 | ···404:·00512ab0···681·FUNC····GLOBAL·DEFAULT···13·_ZN8terraces14print_tree_dotERKSt6vectorINS_4nodeESaIS1_EERKS0_INSt7__cxx1112basic_stringIcSt11char_traitsIcESaIcEEESaISB_EERSob |
| 409 | ···405:·0045d3 | 409 | ···405:·0045d3c0····98·FUNC····GLOBAL·DEFAULT···13·_ZN11ModelUnrest9setBoundsEPdS0_Pb |
| 410 | ···406:·00154d | 410 | ···406:·00154d80···394·FUNC····WEAK···DEFAULT···13·_Z9quicksortIdiEvPT_iiPT0_ |
| 411 | ···407:·0034a8 | 411 | ···407:·0034a8e0···848·FUNC····GLOBAL·DEFAULT···13·FixDistance |
| 412 | ···408:·0019e8 | 412 | ···408:·0019e8d0···463·FUNC····GLOBAL·DEFAULT···13·_ZN5MTree19getPreOrderBranchesERSt6vectorIP4NodeSaIS2_EES5_S2_S2_ |
| 413 | ···409:·001776 | 413 | ···409:·00177680····82·FUNC····GLOBAL·DEFAULT···13·_ZN6IQTree12getBestTreesB5cxx11Ei |
| 414 | ···410:·004565 | 414 | ···410:·004565c0···119·FUNC····WEAK···DEFAULT···13·_ZN8ModelDNAD1Ev |
| 415 | ···411:·0047ca | 415 | ···411:·0047cab0···269·FUNC····WEAK···DEFAULT···13·_ZN5Eigen8internal21dense_assignment_loopINS0_31generic_dense_assignment_kernelINS0_9evaluatorINS_6MatrixISt7complexIdELi4ELi4ELi0ELi4ELi4EEEEENS3_INS_7ProductINS9_INS_3MapIS7_Li16ENS_6StrideILi0ELi0EEEEENS4_IdLi4ELi4ELi0ELi4ELi4EEELi0EEESD_Li1EEEEENS0_9assign_opIS6_S6_EELi0EEELi2ELi0EE3runERSK_ |
| 416 | ···412:·0038c7 | 416 | ···412:·0038c7b0····72·FUNC····GLOBAL·DEFAULT···13·getUndetermined |
| 417 | ···413:·004d6 | 417 | ···413:·004d6330··1363·FUNC····WEAK···DEFAULT···13·_ZNSt6vectorI7PatternSaIS0_EE14_M_fill_insertEN9__gnu_cxx17__normal_iteratorIPS0_S2_EEjRKS0_ |
| 418 | ···414:·003c22 | 418 | ···414:·003c2280···115·FUNC····GLOBAL·DEFAULT···13·_ZN9RateGamma9setBoundsEPdS0_Pb |
| 419 | ···415:·005c | 419 | ···415:·005c6e30····10·OBJECT··WEAK···DEFAULT···15·_ZTS8MyReader |
| 420 | ···416:·005d | 420 | ···416:·005d2068····11·OBJECT··WEAK···DEFAULT···15·_ZTS9SuperNode |
| 421 | ···417:·003003 | 421 | ···417:·00300380···370·FUNC····GLOBAL·DEFAULT···13·sample_from_counts |
| 422 | ···418:·00152 | 422 | ···418:·00152120····20·FUNC····WEAK···DEFAULT···13·_ZN9PhyloTree14getAlnNPatternEv |
| 423 | ···419:·004b2 | 423 | ···419:·004b2810····25·FUNC····GLOBAL·DEFAULT···13·_ZN9MPIHelper8finalizeEv | Diff chunk too large, falling back to line-by-line diff (605 lines added, 605 lines removed) |
| 424 | ···420:·0008a3a0···135·FUNC····WEAK···DEFAULT···13·_ZN5boost15throw_exceptionISt14overflow_errorEEvRKT_ | 424 | ···420:·0008a3a0···135·FUNC····WEAK···DEFAULT···13·_ZN5boost15throw_exceptionISt14overflow_errorEEvRKT_ |
| 425 | ···421:·001b7d | 425 | ···421:·001b7d80···642·FUNC····GLOBAL·DEFAULT···13·_ZN13PhyloNeighbor21clearForwardPartialLhEP4Node |
| 426 | ···422:·0041b | 426 | ···422:·0041bf20··6713·FUNC····GLOBAL·DEFAULT···13·_ZN11ModelMarkov25decomposeRateMatrixNonrevEv |
| 427 | ···423:·00386 | 427 | ···423:·00386e30···526·FUNC····GLOBAL·DEFAULT···13·testInsertRestoreBIG |
| 428 | ···424:·00315 | 428 | ···424:·00315340···248·FUNC····GLOBAL·DEFAULT···13·_ZN9PDNetwork12readRootNodeEPKc |
| 429 | ···425:·0069 | 429 | ···425:·0069a590·····8·OBJECT··WEAK···DEFAULT···22·_ZTINSt3tr18__detail12_Rehash_baseINS0_20_Prime_rehash_policyENS_10_HashtableINSt7__cxx1112basic_stringIcSt11char_traitsIcESaIcEEESt4pairIKS9_8NxsModelESaISD_ESt10_Select1stISD_ESt8equal_toIS9_ENS_4hashIS9_EENS0_18_Mod_range_hashingENS0_20_Default_ranged_hashES2_Lb0ELb0ELb1EEEEE |
| 430 | ···426:·003b7b | 430 | ···426:·003b7bb0····64·FUNC····WEAK···DEFAULT···13·_ZN12ModelProteinD1Ev |
| 431 | ···427:·0017a | 431 | ···427:·0017a820··1963·FUNC····GLOBAL·DEFAULT···13·_ZN6IQTree15saveCurrentTreeEd |
| 432 | ···428:·006b | 432 | ···428:·006b1e50·····4·OBJECT··GLOBAL·DEFAULT···26·seqData |
| 433 | ···429:·00456 | 433 | ···429:·00456e30····71·FUNC····GLOBAL·DEFAULT···13·_ZN10ModelCodon8initGY94Eb15CodonKappaStyle |
| 434 | ···430:·0023bf | 434 | ···430:·0023bf80···429·FUNC····GLOBAL·DEFAULT···13·_ZN14CandidateModel21evaluateConcatenationB5cxx11ER6ParamsP14SuperAlignmentR15ModelCheckpointP11ModelsBlocki |
| 435 | ···431:·00121 | 435 | ···431:·00121a10····91·FUNC····WEAK···DEFAULT···13·_ZThn4_N5boost10wrapexceptISt14overflow_errorED1Ev |
| 436 | ···432:·00130a | 436 | ···432:·00130ac0····99·FUNC····GLOBAL·DEFAULT···13·_ZN9PhyloTree27computeLikelihoodZeroBranchEP13PhyloNeighborP9PhyloNode |
| 437 | ···433:·001220 | 437 | ···433:·001220f0···103·FUNC····WEAK···DEFAULT···13·_ZThn12_N5boost10wrapexceptISt12domain_errorED0Ev |
| 438 | ···434:·004c1 | 438 | ···434:·004c1100···916·FUNC····GLOBAL·DEFAULT···13·_ZN17AlignmentPairwiseC2EP9PhyloTreeii |
| 439 | ···435:·0033ba | 439 | ···435:·0033bac0··1028·FUNC····GLOBAL·DEFAULT···13·_ZN6PDTree21calcPDComplementarityERSt6vectorI9PDTaxaSetSaIS1_EEPcRS0_IdSaIdEE |
| 440 | ···436:·0069 | 440 | ···436:·00698a1c····52·OBJECT··WEAK···DEFAULT···22·_ZTV9NxsReader |
| 441 | ···437:·0069 | 441 | ···437:·00698e18····24·OBJECT··WEAK···DEFAULT···22·_ZTISt6vectorIjSaIjEE |
| 442 | ···438:·005d | 442 | ···438:·005d2714····25·OBJECT··WEAK···DEFAULT···15·_ZTSN4YAML15ParserExceptionE |
| 443 | ···439:·0038ca | 443 | ···439:·0038cac0····85·FUNC····GLOBAL·DEFAULT···13·hookup |
| 444 | ···440:·0013c | 444 | ···440:·0013c440··1269·FUNC····GLOBAL·DEFAULT···13·_Z27Statistics_To_Probabilitiesd |
| 445 | ···441:·0069 | 445 | ···441:·0069a5e8·····8·OBJECT··WEAK···DEFAULT···22·_ZTI8NxsModel |
| 446 | ···442:·0045e5 | 446 | ···442:·0045e5d0···199·FUNC····GLOBAL·DEFAULT···13·_ZN14ModelLieMarkov12setVariablesEPd |
| 447 | ···443:·0013a | 447 | ···443:·0013a470···237·FUNC····GLOBAL·DEFAULT···13·_ZN9PhyloTree14computeObsDistEPd |
| 448 | ···444:·003d4 | 448 | ···444:·003d4a00···386·FUNC····GLOBAL·DEFAULT···13·_ZN8RateFree9setBoundsEPdS0_Pb |
| 449 | ···445:·004be | 449 | ···445:·004bed60···121·FUNC····GLOBAL·DEFAULT···13·free_rng |
| 450 | ···446:·003ca9 | 450 | ···446:·003ca9d0····21·FUNC····GLOBAL·DEFAULT···13·_ZTvn4_n56_N9RateInvar14saveCheckpointEv |
| 451 | ···447:·0069 | 451 | ···447:·0069f8c0····20·OBJECT··WEAK···DEFAULT···22·_ZTVN8terraces15bad_input_errorE |
| 452 | ···448:·0047cb | 452 | ···448:·0047cbc0····67·FUNC····WEAK···DEFAULT···13·_ZN5Eigen8internal19gemm_blocking_spaceILi0EddLin1ELi4ELin1ELi4ELb0EED1Ev |
| 453 | ···449:·004296 | 453 | ···449:·004296e0···851·FUNC····WEAK···DEFAULT···13·_ZN5Eigen15PlainObjectBaseINS_6MatrixIdLin1ELin1ELi0ELin1ELin1EEEEC2INS_13CwiseBinaryOpINS_8internal13scalar_sum_opIddEEKS2_S9_EEEERKNS_9DenseBaseIT_EE |
| 454 | ···450:·004c9 | 454 | ···450:·004c9e00··1901·FUNC····GLOBAL·DEFAULT···13·_ZN14SuperAlignment16removePartitionsERSt3setIiSt4lessIiESaIiEE |
| 455 | ···451:·003d5 | 455 | ···451:·003d5220···126·FUNC····GLOBAL·DEFAULT···13·_ZN8RateFree12getVariablesEPd |
| 456 | ···452:·003da | 456 | ···452:·003daf50···679·FUNC····GLOBAL·DEFAULT···13·_ZN15RateHeterotachy9writeInfoERSo |
| 457 | ···453:·001a05 | 457 | ···453:·001a05e0···993·FUNC····GLOBAL·DEFAULT···13·_ZN5MTree9printTaxaEPKc |
| 458 | ···454:·00197 | 458 | ···454:·00197430···137·FUNC····GLOBAL·DEFAULT···13·_ZN5MTree17countZeroBranchesEP4NodeS1_d |
| 459 | ···455:·00445 | 459 | ···455:·00445e20···406·FUNC····WEAK···DEFAULT···13·_ZN5Eigen8internal20generic_product_implINS_3RefINS_6MatrixIdLin1ELin1ELi0ELin1ELin1EEELi0ENS_11OuterStrideILin1EEEEEKNS_5BlockIKS7_Lin1ELi1ELb1EEENS_10DenseShapeESC_Li7EE13scaleAndAddToINS8_IS7_Lin1ELi1ELb1EEEEEvRT_RS9_RSB_RKd |
| 460 | ···456:·004d | 460 | ···456:·004d6010···146·FUNC····GLOBAL·DEFAULT···13·_ZN22SuperAlignmentUnlinked12computeConstER7Pattern |
| 461 | ···457:·00189 | 461 | ···457:·00189420···777·FUNC····GLOBAL·DEFAULT···13·_ZN6IQTree11doNNISearchEb |
| 462 | ···458:·0069 | 462 | ···458:·00699478····12·OBJECT··WEAK···DEFAULT···22·_ZTI6IQTree |
| 463 | ···459:·00386 | 463 | ···459:·00386310···867·FUNC····GLOBAL·DEFAULT···13·testInsertBIG |
| 464 | ···460:·003c6 | 464 | ···460:·003c6820····18·FUNC····GLOBAL·DEFAULT···13·_ZTv0_n80_N14RateGammaInvar12setNCategoryEi |
| 465 | ···461:·004d3e | 465 | ···461:·004d3e90····57·FUNC····WEAK···DEFAULT···13·_ZNSt3tr110_HashtableINSt7__cxx1112basic_stringIcSt11char_traitsIcESaIcEEES6_SaIS6_ESt9_IdentityIS6_ESt8equal_toIS6_ENS_4hashIS6_EENS_8__detail18_Mod_range_hashingENSE_20_Default_ranged_hashENSE_20_Prime_rehash_policyELb0ELb1ELb1EED2Ev |
| 466 | ···462:·003b7b | 466 | ···462:·003b7bf0····67·FUNC····WEAK···DEFAULT···13·_ZThn4_N12ModelProteinD1Ev |
| 467 | ···463:·004d4 | 467 | ···463:·004d4b60····47·FUNC····GLOBAL·DEFAULT···13·_ZN26SuperAlignmentPairwisePlenD1Ev |
| 468 | ···464:·003d9f | 468 | ···464:·003d9fe0····21·FUNC····WEAK···DEFAULT···13·_ZTv0_n92_N13RateFreeInvar7getRateEi |
| 469 | ···465:·004d5 | 469 | ···465:·004d5d30····79·FUNC····GLOBAL·DEFAULT···13·_ZN22SuperAlignmentUnlinkedC1ER6Params |
| 470 | ···466:·003c8d | 470 | ···466:·003c8df0···185·FUNC····WEAK···DEFAULT···13·_ZTv0_n48_N14RateGammaInvarD0Ev |
| 471 | ···467:·004884 | 471 | ···467:·004884c0··2236·FUNC····GLOBAL·DEFAULT···13·_ZN12Optimization6lbfgsbEiiPdS0_S0_PiS0_S1_ddS1_S1_iPcii |
| 472 | ···468:·002ad | 472 | ···468:·002ada40··1630·FUNC····WEAK···DEFAULT···13·_ZN9PhyloTree27computeLikelihoodBufferSIMDI5Vec2dLb0ELi4ELb0ELb0EEEvP13PhyloNeighborP9PhyloNodejji |
| 473 | ···469:·000f41 | 473 | ···469:·000f41d0···861·FUNC····GLOBAL·DEFAULT···13·_ZN9AlignmentC1Ev |
| 474 | ···470:·00 | 474 | ···470:·00300020····53·FUNC····GLOBAL·DEFAULT···13·unif |
| 475 | ···471:·000f8 | 475 | ···471:·000f8f20···143·FUNC····GLOBAL·DEFAULT···13·_ZN9Alignment14getPatternFreqERSt6vectorIiSaIiEE |
| 476 | ···472:·0044aa | 476 | ···472:·0044aac0··3602·FUNC····WEAK···DEFAULT···13·_ZNK5Eigen19HouseholderSequenceINS_6MatrixIdLin1ELin1ELi0ELin1ELin1EEENS1_IdLin1ELi1ELi0ELin1ELi1EEELi1EE6evalToIS2_S3_EEvRT_RT0_ |
| 477 | ···473:·0014fa | 477 | ···473:·0014faa0···890·FUNC····GLOBAL·DEFAULT···13·_ZN9PhyloTreeC1Ev |
| 478 | ···474:·004d71 | 478 | ···474:·004d71e0··3768·FUNC····GLOBAL·DEFAULT···13·_ZN19NxsAssumptionsBlock6ReportERSo |
| 479 | ···475:·002d9d | 479 | ···475:·002d9d80··1079·FUNC····GLOBAL·DEFAULT···13·_ZN4YAML4LoadERKNSt7__cxx1112basic_stringIcSt11char_traitsIcESaIcEEE |
| 480 | ···476:·001220 | 480 | ···476:·00122080···101·FUNC····WEAK···DEFAULT···13·_ZThn4_N5boost10wrapexceptISt12domain_errorED0Ev |
| 481 | ···477:·004442 | 481 | ···477:·004442e0··2599·FUNC····WEAK···DEFAULT···13·_ZN5Eigen8internal40make_block_householder_triangular_factorINS_6MatrixIdLin1ELin1ELi1ELin1ELin1EEENS_5BlockINS2_IdLin1ELin1ELi0ELin1ELin1EEELin1ELin1ELb0EEENS4_IKNS2_IdLin1ELi1ELi0ELin1ELi1EEELin1ELi1ELb0EEEEEvRT_RKT0_RKT1_ |
| 482 | ···478:·0018f | 482 | ···478:·0018f200···101·FUNC····WEAK···DEFAULT···13·_ZSteqIcSt11char_traitsIcESaIcEEbRKNSt7__cxx1112basic_stringIT_T0_T1_EEPKS5_ |
| 483 | ···479:·002c5 | 483 | ···479:·002c5540··4598·FUNC····WEAK···DEFAULT···13·_ZN9PhyloTree25computeLikelihoodDervSIMDI5Vec2dLb1ELi20ELb0ELb1EEEvP13PhyloNeighborP9PhyloNodePdS6_ |
| 484 | ···480:·004ec | 484 | ···480:·004ec310·····1·FUNC····GLOBAL·DEFAULT···13·_ZN9NxsReader13OutputCommentERK9NxsString |
| 485 | ···481:·0013e | 485 | ···481:·0013eb10··3256·FUNC····GLOBAL·DEFAULT···13·_ZN9PhyloTree20computeTraversalInfoEP13PhyloNeighborP9PhyloNodeRPd |
| 486 | ···482:·003b8 | 486 | ···482:·003b8850····41·FUNC····GLOBAL·DEFAULT···13·_ZN8ModelSet16computeTransDervEdPdS0_S0_i |
| 487 | ···483:·00378 | 487 | ···483:·00378850··1460·FUNC····GLOBAL·DEFAULT···13·newviewAncestralIterative |
| 488 | ···484:·003e9 | 488 | ···484:·003e9160····18·FUNC····GLOBAL·DEFAULT···13·_ZTv0_n288_N9ModelPoMo9setBoundsEPdS0_Pb |
| 489 | ···485:·00404a | 489 | ···485:·00404ac0···910·FUNC····WEAK···DEFAULT···13·_ZN5Eigen8internal20generic_product_implINS_6MatrixIdLin1ELin1ELi1ELin1ELin1EEES3_NS_10DenseShapeES4_Li8EE13scaleAndAddToINS2_IdLin1ELin1ELi0ELin1ELin1EEEEEvRT_RKS3_SB_RKd |
| 490 | ···486:·003dd7 | 490 | ···486:·003dd7a0·····3·FUNC····GLOBAL·DEFAULT···13·_ZTv0_n92_N20RateHeterotachyInvar7getRateEi |
| 491 | ···487:·0038c | 491 | ···487:·0038ca20····30·FUNC····GLOBAL·DEFAULT···13·isTip |
| 492 | ···488:·00508 | 492 | ···488:·00508cf0···592·FUNC····GLOBAL·DEFAULT···13·_ZN8terraces15bad_input_errorC2ENS_20bad_input_error_typeENSt7__cxx1112basic_stringIcSt11char_traitsIcESaIcEEE |
| 493 | ···489:·001602 | 493 | ···489:·001602b0··1136·FUNC····GLOBAL·DEFAULT···13·_ZN9PhyloTree29computeMarginalAncestralStateEP13PhyloNeighborP9PhyloNodePdPi |
| 494 | ···490:·0014ed | 494 | ···490:·0014edb0···264·FUNC····GLOBAL·DEFAULT···13·_ZN9PhyloTree19optimizeSPRBranchesEv |
| 495 | ···491:·004cf5 | 495 | ···491:·004cf5e0··1834·FUNC····GLOBAL·DEFAULT···13·_ZN14SuperAlignment16readPartitionDirENSt7__cxx1112basic_stringIcSt11char_traitsIcESaIcEEEPcR9InputTypeS5_b |
| 496 | ···492:·001c6 | 496 | ···492:·001c6230····10·FUNC····GLOBAL·DEFAULT···13·_ZThn128_N18PhyloSuperTreePlen15computeFunctionEd |
| 497 | ···493:·002620 | 497 | ···493:·002620e0·····6·FUNC····WEAK···DEFAULT···13·_ZN10ModelSubst12isReversibleEv |
| 498 | ···494:·005d | 498 | ···494:·005d1788····11·OBJECT··WEAK···DEFAULT···15·_ZTS9CkpStream |
| 499 | ···495:·004937 | 499 | ···495:·004937b0··1351·FUNC····GLOBAL·DEFAULT···13·_Z15detectInputFilePKc |
| 500 | ···496:·004e2 | 500 | ···496:·004e2870···282·FUNC····GLOBAL·DEFAULT···13·_ZN18NxsCharactersBlockD1Ev |
| Max diff block lines reached; 1081006/1218541 bytes (88.71%) of diff not shown. | |||
| Offset 1, 680 lines modified | Offset 1, 13 lines modified | ||
| 1 | Relocation·section·'.rel.dyn'·at·offset·0x73618·contains·6153·entries: | 1 | Relocation·section·'.rel.dyn'·at·offset·0x73618·contains·6153·entries: |
| 2 | ·Offset·····Info····Type················Sym.·Value··Symbol's·Name | 2 | ·Offset·····Info····Type················Sym.·Value··Symbol's·Name |
| 3 | 0069712c··00000008·R_386_RELATIVE········ | ||
| 4 | 00697130··00000008·R_386_RELATIVE········ | ||
| 5 | 00697134··00000008·R_386_RELATIVE········ | ||
| 6 | 00697138··00000008·R_386_RELATIVE········ | ||
| 7 | 0069713c··00000008·R_386_RELATIVE········ | ||
| 8 | 00697140··00000008·R_386_RELATIVE········ | ||
| 9 | 00697144··00000008·R_386_RELATIVE········ | ||
| 10 | 00697148··00000008·R_386_RELATIVE········ | ||
| 11 | 0069714c··00000008·R_386_RELATIVE········ | ||
| 12 | 00697150··00000008·R_386_RELATIVE········ | ||
| 13 | 00697154··00000008·R_386_RELATIVE········ | ||
| 14 | 00697158··00000008·R_386_RELATIVE········ | ||
| 15 | 0069715c··00000008·R_386_RELATIVE········ | ||
| 16 | 00697164··00000008·R_386_RELATIVE········ | ||
| 17 | 00697168··00000008·R_386_RELATIVE········ | ||
| 18 | 0069716c··00000008·R_386_RELATIVE········ | ||
| 19 | 00697170··00000008·R_386_RELATIVE········ | ||
| 20 | 00697174··00000008·R_386_RELATIVE········ | ||
| 21 | 00697178··00000008·R_386_RELATIVE········ | ||
| 22 | 0069717c··00000008·R_386_RELATIVE········ | ||
| 23 | 00697180··00000008·R_386_RELATIVE········ | ||
| 24 | 00697184··00000008·R_386_RELATIVE········ | ||
| 25 | 00697188··00000008·R_386_RELATIVE········ | ||
| 26 | 0069718c··00000008·R_386_RELATIVE········ | ||
| 27 | 00697198··00000008·R_386_RELATIVE········ | ||
| 28 | 0069719c··00000008·R_386_RELATIVE········ | ||
| 29 | 006971a0··00000008·R_386_RELATIVE········ | ||
| 30 | 006971ac··00000008·R_386_RELATIVE········ | ||
| 31 | 006971b0··00000008·R_386_RELATIVE········ | ||
| 32 | 006971b4··00000008·R_386_RELATIVE········ | ||
| 33 | 006971c0··00000008·R_386_RELATIVE········ | ||
| 34 | 006971c4··00000008·R_386_RELATIVE········ | ||
| 35 | 006971c8··00000008·R_386_RELATIVE········ | ||
| 36 | 006971d0··00000008·R_386_RELATIVE········ | ||
| 37 | 006971d4··00000008·R_386_RELATIVE········ | ||
| 38 | 006971d8··00000008·R_386_RELATIVE········ | ||
| 39 | 006971dc··00000008·R_386_RELATIVE········ | ||
| 40 | 006971e0··00000008·R_386_RELATIVE········ | ||
| 41 | 006971e4··00000008·R_386_RELATIVE········ | ||
| 42 | 006971e8··00000008·R_386_RELATIVE········ | ||
| 43 | 006971ec··00000008·R_386_RELATIVE········ | ||
| 44 | 006971f0··00000008·R_386_RELATIVE········ | ||
| 45 | 006971f4··00000008·R_386_RELATIVE········ | ||
| 46 | 006971f8··00000008·R_386_RELATIVE········ | ||
| 47 | 006971fc··00000008·R_386_RELATIVE········ | ||
| 48 | 00697200··00000008·R_386_RELATIVE········ | ||
| 49 | 00697204··00000008·R_386_RELATIVE········ | ||
| 50 | 00697208··00000008·R_386_RELATIVE········ | ||
| 51 | 0069720c··00000008·R_386_RELATIVE········ | ||
| 52 | 00697218··00000008·R_386_RELATIVE········ | ||
| 53 | 0069721c··00000008·R_386_RELATIVE········ | ||
| 54 | 00697220··00000008·R_386_RELATIVE········ | ||
| 55 | 0069722c··00000008·R_386_RELATIVE········ | ||
| 56 | 00697230··00000008·R_386_RELATIVE········ | ||
| 57 | 00697234··00000008·R_386_RELATIVE········ | ||
| 58 | 00697240··00000008·R_386_RELATIVE········ | ||
| 59 | 00697244··00000008·R_386_RELATIVE········ | ||
| 60 | 00697248··00000008·R_386_RELATIVE········ | ||
| 61 | 00697250··00000008·R_386_RELATIVE········ | ||
| 62 | 00697254··00000008·R_386_RELATIVE········ | ||
| 63 | 00697258··00000008·R_386_RELATIVE········ | ||
| 64 | 0069725c··00000008·R_386_RELATIVE········ | ||
| 65 | 00697260··00000008·R_386_RELATIVE········ | ||
| 66 | 00697264··00000008·R_386_RELATIVE········ | ||
| 67 | 00697268··00000008·R_386_RELATIVE········ | ||
| 68 | 0069726c··00000008·R_386_RELATIVE········ | ||
| 69 | 00697270··00000008·R_386_RELATIVE········ | ||
| 70 | 00697274··00000008·R_386_RELATIVE········ | ||
| 71 | 00697278··00000008·R_386_RELATIVE········ | ||
| 72 | 00697280··00000008·R_386_RELATIVE········ | ||
| 73 | 00697284··00000008·R_386_RELATIVE········ | ||
| 74 | 00697288··00000008·R_386_RELATIVE········ | ||
| 75 | 0069728c··00000008·R_386_RELATIVE········ | ||
| 76 | 00697290··00000008·R_386_RELATIVE········ | ||
| 77 | 00697294··00000008·R_386_RELATIVE········ | ||
| 78 | 00697298··00000008·R_386_RELATIVE········ | ||
| 79 | 0069729c··00000008·R_386_RELATIVE········ | ||
| 80 | 006972a0··00000008·R_386_RELATIVE········ | ||
| 81 | 006972a4··00000008·R_386_RELATIVE········ | ||
| 82 | 006972a8··00000008·R_386_RELATIVE········ | ||
| 83 | 006972ac··00000008·R_386_RELATIVE········ | ||
| 84 | 006972b0··00000008·R_386_RELATIVE········ | ||
| 85 | 006972b4··00000008·R_386_RELATIVE········ | ||
| 86 | 006972b8··00000008·R_386_RELATIVE········ | ||
| 87 | 006972bc··00000008·R_386_RELATIVE········ | ||
| 88 | 006972c0··00000008·R_386_RELATIVE········ | ||
| 89 | 006972c4··00000008·R_386_RELATIVE········ | ||
| 90 | 006972c8··00000008·R_386_RELATIVE········ | ||
| 91 | 006972cc··00000008·R_386_RELATIVE········ | ||
| 92 | 006972d4··00000008·R_386_RELATIVE········ | ||
| 93 | 006972d8··00000008·R_386_RELATIVE········ | ||
| 94 | 006972dc··00000008·R_386_RELATIVE········ | ||
| 95 | 006972e0··00000008·R_386_RELATIVE········ | ||
| 96 | 006972e8··00000008·R_386_RELATIVE········ | ||
| 97 | 006972ec··00000008·R_386_RELATIVE········ | ||
| 98 | 006972f0··00000008·R_386_RELATIVE········ | ||
| 99 | 006972f4··00000008·R_386_RELATIVE········ | ||
| 100 | 006972f8··00000008·R_386_RELATIVE········ | ||
| 101 | 006972fc··00000008·R_386_RELATIVE········ | ||
| 102 | 00697304··00000008·R_386_RELATIVE········ | ||
| 103 | 00697308··00000008·R_386_RELATIVE········ | ||
| 104 | 0069730c··00000008·R_386_RELATIVE········ | ||
| 105 | 00697310··00000008·R_386_RELATIVE········ | ||
| 106 | 00697314··00000008·R_386_RELATIVE········ | ||
| 107 | 00697318··00000008·R_386_RELATIVE········ | ||
| 108 | 0069731c··00000008·R_386_RELATIVE········ | ||
| 109 | 00697320··00000008·R_386_RELATIVE········ | ||
| 110 | 00697324··00000008·R_386_RELATIVE········ | ||
| 111 | 00697328··00000008·R_386_RELATIVE········ | ||
| 112 | 0069732c··00000008·R_386_RELATIVE········ | ||
| 113 | 00697334··00000008·R_386_RELATIVE········ | ||
| 114 | 00697338··00000008·R_386_RELATIVE········ | ||
| 115 | 0069733c··00000008·R_386_RELATIVE········ | ||
| 116 | 00697340··00000008·R_386_RELATIVE········ | ||
| 117 | 00697344··00000008·R_386_RELATIVE········ | ||
| 118 | 00697348··00000008·R_386_RELATIVE········ | ||
| 119 | 0069734c··00000008·R_386_RELATIVE········ | ||
| 120 | 00697350··00000008·R_386_RELATIVE········ | ||
| 121 | 00697354··00000008·R_386_RELATIVE········ | ||
| 122 | 00697358··00000008·R_386_RELATIVE········ | ||
| 123 | 0069735c··00000008·R_386_RELATIVE········ | ||
| 124 | 00697364··00000008·R_386_RELATIVE········ | ||
| 125 | 00697368··00000008·R_386_RELATIVE········ | ||
| 126 | 0069736c··00000008·R_386_RELATIVE········ | ||
| Max diff block lines reached; 410349/439276 bytes (93.41%) of diff not shown. | |||
| Offset 1, 30 lines modified | Offset 1, 30 lines modified | ||
| 1 | Dynamic·section·at·offset·0x69 | 1 | Dynamic·section·at·offset·0x69f8fc·contains·33·entries: |
| 2 | ··Tag········Type·························Name/Value | 2 | ··Tag········Type·························Name/Value |
| 3 | ·0x00000001·(NEEDED)·····················Shared·library:·[libmpich.so.12] | 3 | ·0x00000001·(NEEDED)·····················Shared·library:·[libmpich.so.12] |
| 4 | ·0x00000001·(NEEDED)·····················Shared·library:·[libz.so.1] | 4 | ·0x00000001·(NEEDED)·····················Shared·library:·[libz.so.1] |
| 5 | ·0x00000001·(NEEDED)·····················Shared·library:·[libstdc++.so.6] | 5 | ·0x00000001·(NEEDED)·····················Shared·library:·[libstdc++.so.6] |
| 6 | ·0x00000001·(NEEDED)·····················Shared·library:·[libm.so.6] | 6 | ·0x00000001·(NEEDED)·····················Shared·library:·[libm.so.6] |
| 7 | ·0x00000001·(NEEDED)·····················Shared·library:·[libgomp.so.1] | 7 | ·0x00000001·(NEEDED)·····················Shared·library:·[libgomp.so.1] |
| 8 | ·0x00000001·(NEEDED)·····················Shared·library:·[libgcc_s.so.1] | 8 | ·0x00000001·(NEEDED)·····················Shared·library:·[libgcc_s.so.1] |
| 9 | ·0x00000001·(NEEDED)·····················Shared·library:·[libc.so.6] | 9 | ·0x00000001·(NEEDED)·····················Shared·library:·[libc.so.6] |
| 10 | ·0x0000000c·(INIT)·······················0x80000 | 10 | ·0x0000000c·(INIT)·······················0x80000 |
| 11 | ·0x0000000d·(FINI)·······················0x51 | 11 | ·0x0000000d·(FINI)·······················0x516594 |
| 12 | ·0x00000019·(INIT_ARRAY)·················0x69 | 12 | ·0x00000019·(INIT_ARRAY)·················0x69812c |
| 13 | ·0x0000001b·(INIT_ARRAYSZ)···············48·(bytes) | 13 | ·0x0000001b·(INIT_ARRAYSZ)···············48·(bytes) |
| 14 | ·0x0000001a·(FINI_ARRAY)·················0x69 | 14 | ·0x0000001a·(FINI_ARRAY)·················0x69815c |
| 15 | ·0x0000001c·(FINI_ARRAYSZ)···············4·(bytes) | 15 | ·0x0000001c·(FINI_ARRAYSZ)···············4·(bytes) |
| 16 | ·0x6ffffef5·(GNU_HASH)···················0x1ec | 16 | ·0x6ffffef5·(GNU_HASH)···················0x1ec |
| 17 | ·0x00000005·(STRTAB)·····················0x2342c | 17 | ·0x00000005·(STRTAB)·····················0x2342c |
| 18 | ·0x00000006·(SYMTAB)·····················0xadbc | 18 | ·0x00000006·(SYMTAB)·····················0xadbc |
| 19 | ·0x0000000a·(STRSZ)······················314939·(bytes) | 19 | ·0x0000000a·(STRSZ)······················314939·(bytes) |
| 20 | ·0x0000000b·(SYMENT)·····················16·(bytes) | 20 | ·0x0000000b·(SYMENT)·····················16·(bytes) |
| 21 | ·0x00000015·(DEBUG)······················0x0 | 21 | ·0x00000015·(DEBUG)······················0x0 |
| 22 | ·0x00000003·(PLTGOT)·····················0x69 | 22 | ·0x00000003·(PLTGOT)·····················0x69fa2c |
| 23 | ·0x00000002·(PLTRELSZ)···················2448·(bytes) | 23 | ·0x00000002·(PLTRELSZ)···················2448·(bytes) |
| 24 | ·0x00000014·(PLTREL)·····················REL | 24 | ·0x00000014·(PLTREL)·····················REL |
| 25 | ·0x00000017·(JMPREL)·····················0x7f660 | 25 | ·0x00000017·(JMPREL)·····················0x7f660 |
| 26 | ·0x00000011·(REL)························0x73618 | 26 | ·0x00000011·(REL)························0x73618 |
| 27 | ·0x00000012·(RELSZ)······················49224·(bytes) | 27 | ·0x00000012·(RELSZ)······················49224·(bytes) |
| 28 | ·0x00000013·(RELENT)·····················8·(bytes) | 28 | ·0x00000013·(RELENT)·····················8·(bytes) |
| 29 | ·0x0000001e·(FLAGS)······················BIND_NOW | 29 | ·0x0000001e·(FLAGS)······················BIND_NOW |
| Offset 1, 8 lines modified | Offset 1, 8 lines modified | ||
| 1 | Displaying·notes·found·in:·.note.gnu.build-id | 1 | Displaying·notes·found·in:·.note.gnu.build-id |
| 2 | ··Owner················Data·size·» Description | 2 | ··Owner················Data·size·» Description |
| 3 | ··GNU··················0x00000014» NT_GNU_BUILD_ID·(unique·build·ID·bitstring)» ····Build·ID:· | 3 | ··GNU··················0x00000014» NT_GNU_BUILD_ID·(unique·build·ID·bitstring)» ····Build·ID:·235fee460a3080e8cc20829326b4b50a3516b56b |
| 4 | Displaying·notes·found·in:·.note.ABI-tag | 4 | Displaying·notes·found·in:·.note.ABI-tag |
| 5 | ··Owner················Data·size·» Description | 5 | ··Owner················Data·size·» Description |
| 6 | ··GNU··················0x00000010» NT_GNU_ABI_TAG·(ABI·version·tag)» ····OS:·Linux,·ABI:·3.2.0 | 6 | ··GNU··················0x00000010» NT_GNU_ABI_TAG·(ABI·version·tag)» ····OS:·Linux,·ABI:·3.2.0 |
| Offset 1, 7135 lines modified | Offset 1, 7135 lines modified | ||
| 1 | Contents·of·the·.eh_frame_hdr·section: | 1 | Contents·of·the·.eh_frame_hdr·section: |
| 2 | ··Version:·················1 | 2 | ··Version:·················1 |
| 3 | ··Pointer·Encoding·Format:·0x1b·(sdata4,·pcrel) | 3 | ··Pointer·Encoding·Format:·0x1b·(sdata4,·pcrel) |
| 4 | ··Count·Encoding·Format:···0x3·(udata4,·absolute) | 4 | ··Count·Encoding·Format:···0x3·(udata4,·absolute) |
| 5 | ··Table·Encoding·Format:···0x3b·(sdata4,·datarel) | 5 | ··Table·Encoding·Format:···0x3b·(sdata4,·datarel) |
| 6 | ··Start·of·frame·section:··0xde88·(offset:·0x5e | 6 | ··Start·of·frame·section:··0xde88·(offset:·0x5e9324) | Diff chunk too large, falling back to line-by-line diff (7120 lines added, 7120 lines removed) |
| 7 | ··Entries·in·search·table:·0x1bd0 | 7 | ··Entries·in·search·table:·0x1bd0 |
| 8 | ··0xffffffffffaa | 8 | ··0xffffffffffaa4b88·(offset:·0x80020)·->·0xded0·fde=[····44] |
| 9 | ··0xffffffffffaa | 9 | ··0xffffffffffaa5eb8·(offset:·0x81350)·->·0xdef4·fde=[····68] |
| 10 | ··0xffffffffffaa | 10 | ··0xffffffffffaa5ee8·(offset:·0x81380)·->·0xdf78·fde=[····ec] |
| 11 | ··0xffffffffffaa | 11 | ··0xffffffffffaa5f9e·(offset:·0x81436)·->·0xe764·fde=[···8d8] |
| 12 | ··0xffffffffffaa | 12 | ··0xffffffffffaa6090·(offset:·0x81528)·->·0xe790·fde=[···904] |
| 13 | ··0xffffffffffaa | 13 | ··0xffffffffffaa6182·(offset:·0x8161a)·->·0xe7bc·fde=[···930] |
| 14 | ··0xffffffffffaa | 14 | ··0xffffffffffaa627a·(offset:·0x81712)·->·0xe7e8·fde=[···95c] |
| 15 | ··0xffffffffffaa | 15 | ··0xffffffffffaa6372·(offset:·0x8180a)·->·0xf060·fde=[··11d4] |
| 16 | ··0xffffffffffaa | 16 | ··0xffffffffffaa6394·(offset:·0x8182c)·->·0xf0d0·fde=[··1244] |
| 17 | ··0xffffffffffaa | 17 | ··0xffffffffffaa63c4·(offset:·0x8185c)·->·0xf0f0·fde=[··1264] |
| 18 | ··0xffffffffffaa | 18 | ··0xffffffffffaa6484·(offset:·0x8191c)·->·0xf228·fde=[··139c] |
| 19 | ··0xffffffffffaa | 19 | ··0xffffffffffaa6506·(offset:·0x8199e)·->·0xf300·fde=[··1474] |
| 20 | ··0xffffffffffaa | 20 | ··0xffffffffffaa65ae·(offset:·0x81a46)·->·0xf820·fde=[··1994] |
| 21 | ··0xffffffffffaa | 21 | ··0xffffffffffaa660c·(offset:·0x81aa4)·->·0xfa5c·fde=[··1bd0] |
| 22 | ··0xffffffffffaa | 22 | ··0xffffffffffaa6612·(offset:·0x81aaa)·->·0xfab0·fde=[··1c24] |
| 23 | ··0xffffffffffaa | 23 | ··0xffffffffffaa66f0·(offset:·0x81b88)·->·0xfb6c·fde=[··1ce0] |
| 24 | ··0xffffffffffaa | 24 | ··0xffffffffffaa670c·(offset:·0x81ba4)·->·0xfed0·fde=[··2044] |
| 25 | ··0xffffffffffaa | 25 | ··0xffffffffffaa67ad·(offset:·0x81c45)·->·0xffa8·fde=[··211c] |
| 26 | ··0xffffffffffaa | 26 | ··0xffffffffffaa68f0·(offset:·0x81d88)·->·0x1021c·fde=[··2390] |
| 27 | ··0xffffffffffaa | 27 | ··0xffffffffffaa68f6·(offset:·0x81d8e)·->·0x10440·fde=[··25b4] |
| 28 | ··0xffffffffffaa | 28 | ··0xffffffffffaa697c·(offset:·0x81e14)·->·0x104b0·fde=[··2624] |
| 29 | ··0xffffffffffaa | 29 | ··0xffffffffffaa6af8·(offset:·0x81f90)·->·0x10514·fde=[··2688] |
| 30 | ··0xffffffffffaa | 30 | ··0xffffffffffaa6b46·(offset:·0x81fde)·->·0x107a4·fde=[··2918] |
| 31 | ··0xffffffffffaa | 31 | ··0xffffffffffaa6b66·(offset:·0x81ffe)·->·0x10808·fde=[··297c] |
| 32 | ··0xffffffffffaa | 32 | ··0xffffffffffaa6c96·(offset:·0x8212e)·->·0x109a8·fde=[··2b1c] |
| 33 | ··0xffffffffffaa | 33 | ··0xffffffffffaa6c9c·(offset:·0x82134)·->·0x10ac8·fde=[··2c3c] |
| 34 | ··0xffffffffffaa | 34 | ··0xffffffffffaa6cb0·(offset:·0x82148)·->·0x10c18·fde=[··2d8c] |
| 35 | ··0xffffffffffaa | 35 | ··0xffffffffffaa6ccc·(offset:·0x82164)·->·0x10f30·fde=[··30a4] |
| 36 | ··0xffffffffffaa | 36 | ··0xffffffffffaa6cd6·(offset:·0x8216e)·->·0x11004·fde=[··3178] |
| 37 | ··0xffffffffffaa | 37 | ··0xffffffffffaa6ce0·(offset:·0x82178)·->·0x11190·fde=[··3304] |
| 38 | ··0xffffffffffaa | 38 | ··0xffffffffffaa6d20·(offset:·0x821b8)·->·0x11254·fde=[··33c8] |
| 39 | ··0xffffffffffaa | 39 | ··0xffffffffffaa6d48·(offset:·0x821e0)·->·0x112ec·fde=[··3460] |
| 40 | ··0xffffffffffaa | 40 | ··0xffffffffffaa6d59·(offset:·0x821f1)·->·0x1139c·fde=[··3510] |
| 41 | ··0xffffffffffaa | 41 | ··0xffffffffffaa6ffe·(offset:·0x82496)·->·0x11564·fde=[··36d8] |
| 42 | ··0xffffffffffaa | 42 | ··0xffffffffffaa70e2·(offset:·0x8257a)·->·0x11a00·fde=[··3b74] |
| 43 | ··0xffffffffffaa | 43 | ··0xffffffffffaa72fc·(offset:·0x82794)·->·0x11a6c·fde=[··3be0] |
| 44 | ··0xffffffffffaa | 44 | ··0xffffffffffaa746c·(offset:·0x82904)·->·0x11ad0·fde=[··3c44] |
| 45 | ··0xffffffffffaa | 45 | ··0xffffffffffaa75fc·(offset:·0x82a94)·->·0x11d80·fde=[··3ef4] |
| 46 | ··0xffffffffffaa | 46 | ··0xffffffffffaa7614·(offset:·0x82aac)·->·0x11dd4·fde=[··3f48] |
| 47 | ··0xffffffffffaa | 47 | ··0xffffffffffaa7668·(offset:·0x82b00)·->·0x11e30·fde=[··3fa4] |
| 48 | ··0xffffffffffaa | 48 | ··0xffffffffffaa772e·(offset:·0x82bc6)·->·0x11e90·fde=[··4004] |
| 49 | ··0xffffffffffaa | 49 | ··0xffffffffffaa77f6·(offset:·0x82c8e)·->·0x11ef0·fde=[··4064] |
| 50 | ··0xffffffffffaa | 50 | ··0xffffffffffaa7be2·(offset:·0x8307a)·->·0x11f5c·fde=[··40d0] |
| 51 | ··0xffffffffffaa | 51 | ··0xffffffffffaa7c8c·(offset:·0x83124)·->·0x11fc0·fde=[··4134] |
| 52 | ··0xffffffffffaa | 52 | ··0xffffffffffaa7d36·(offset:·0x831ce)·->·0x12024·fde=[··4198] |
| 53 | ··0xffffffffffaa | 53 | ··0xffffffffffaa7e76·(offset:·0x8330e)·->·0x121d0·fde=[··4344] |
| 54 | ··0xffffffffffaa | 54 | ··0xffffffffffaa81e0·(offset:·0x83678)·->·0x1224c·fde=[··43c0] |
| 55 | ··0xffffffffffaa | 55 | ··0xffffffffffaa8378·(offset:·0x83810)·->·0x1272c·fde=[··48a0] |
| 56 | ··0xffffffffffaa | 56 | ··0xffffffffffaa86e0·(offset:·0x83b78)·->·0x12790·fde=[··4904] |
| 57 | ··0xffffffffffaa | 57 | ··0xffffffffffaa89d8·(offset:·0x83e70)·->·0x12d30·fde=[··4ea4] |
| 58 | ··0xffffffffffaa | 58 | ··0xffffffffffaa8a46·(offset:·0x83ede)·->·0x12dcc·fde=[··4f40] |
| 59 | ··0xffffffffffaa | 59 | ··0xffffffffffaa8c5a·(offset:·0x840f2)·->·0x12f9c·fde=[··5110] |
| 60 | ··0xffffffffffaa | 60 | ··0xffffffffffaa8c92·(offset:·0x8412a)·->·0x13de4·fde=[··5f58] |
| 61 | ··0xffffffffffaa | 61 | ··0xffffffffffaa8cfc·(offset:·0x84194)·->·0x13fa0·fde=[··6114] |
| 62 | ··0xffffffffffaa | 62 | ··0xffffffffffaa8d5c·(offset:·0x841f4)·->·0x14074·fde=[··61e8] |
| 63 | ··0xffffffffffaa | 63 | ··0xffffffffffaa8d72·(offset:·0x8420a)·->·0x14458·fde=[··65cc] |
| 64 | ··0xffffffffffaa | 64 | ··0xffffffffffaa8e90·(offset:·0x84328)·->·0x14624·fde=[··6798] |
| 65 | ··0xffffffffffaa | 65 | ··0xffffffffffaa8fc4·(offset:·0x8445c)·->·0x14698·fde=[··680c] |
| 66 | ··0xffffffffffaa | 66 | ··0xffffffffffaa90d6·(offset:·0x8456e)·->·0x146f4·fde=[··6868] |
| 67 | ··0xffffffffffaa | 67 | ··0xffffffffffaa92ba·(offset:·0x84752)·->·0x14750·fde=[··68c4] |
| 68 | ··0xffffffffffaa | 68 | ··0xffffffffffaa9320·(offset:·0x847b8)·->·0x147ac·fde=[··6920] |
| 69 | ··0xffffffffffaa | 69 | ··0xffffffffffaa93f2·(offset:·0x8488a)·->·0x14808·fde=[··697c] |
| 70 | ··0xffffffffffaa | 70 | ··0xffffffffffaa9436·(offset:·0x848ce)·->·0x14864·fde=[··69d8] |
| 71 | ··0xffffffffffaa | 71 | ··0xffffffffffaa94fe·(offset:·0x84996)·->·0x148bc·fde=[··6a30] |
| 72 | ··0xffffffffffaa | 72 | ··0xffffffffffaa959a·(offset:·0x84a32)·->·0x1491c·fde=[··6a90] |
| 73 | ··0xffffffffffaa | 73 | ··0xffffffffffaa964e·(offset:·0x84ae6)·->·0x14978·fde=[··6aec] |
| 74 | ··0xffffffffffaa | 74 | ··0xffffffffffaa9bca·(offset:·0x85062)·->·0x14a10·fde=[··6b84] |
| 75 | ··0xffffffffffaa | 75 | ··0xffffffffffaaa154·(offset:·0x855ec)·->·0x14ab4·fde=[··6c28] |
| 76 | ··0xffffffffffaa | 76 | ··0xffffffffffaaa570·(offset:·0x85a08)·->·0x14b34·fde=[··6ca8] |
| 77 | ··0xffffffffffaa | 77 | ··0xffffffffffaaacb4·(offset:·0x8614c)·->·0x14bc8·fde=[··6d3c] |
| 78 | ··0xffffffffffaa | 78 | ··0xffffffffffaab0f8·(offset:·0x86590)·->·0x14c54·fde=[··6dc8] |
| 79 | ··0xffffffffffaa | 79 | ··0xffffffffffaab714·(offset:·0x86bac)·->·0x14ce4·fde=[··6e58] |
| 80 | ··0xffffffffffaa | 80 | ··0xffffffffffaac648·(offset:·0x87ae0)·->·0x14d60·fde=[··6ed4] |
| 81 | ··0xffffffffffaa | 81 | ··0xffffffffffaad744·(offset:·0x88bdc)·->·0x14e38·fde=[··6fac] |
| 82 | ··0xffffffffffaa | 82 | ··0xffffffffffaada60·(offset:·0x88ef8)·->·0x14ea0·fde=[··7014] |
| 83 | ··0xffffffffffaa | 83 | ··0xffffffffffaadaac·(offset:·0x88f44)·->·0x14f00·fde=[··7074] |
| 84 | ··0xffffffffffaa | 84 | ··0xffffffffffaadb02·(offset:·0x88f9a)·->·0x14f74·fde=[··70e8] |
| 85 | ··0xffffffffffaa | 85 | ··0xffffffffffaadbae·(offset:·0x89046)·->·0x14fd0·fde=[··7144] |
| 86 | ··0xffffffffffaa | 86 | ··0xffffffffffaadc38·(offset:·0x890d0)·->·0x1502c·fde=[··71a0] |
| 87 | ··0xffffffffffaa | 87 | ··0xffffffffffaadc84·(offset:·0x8911c)·->·0x15084·fde=[··71f8] |
| 88 | ··0xffffffffffaa | 88 | ··0xffffffffffaadcfa·(offset:·0x89192)·->·0x150dc·fde=[··7250] |
| 89 | ··0xffffffffffaa | 89 | ··0xffffffffffaadd2e·(offset:·0x891c6)·->·0x15148·fde=[··72bc] |
| 90 | ··0xffffffffffaa | 90 | ··0xffffffffffaadf74·(offset:·0x8940c)·->·0x151ac·fde=[··7320] |
| 91 | ··0xffffffffffaa | 91 | ··0xffffffffffaae00e·(offset:·0x894a6)·->·0x15208·fde=[··737c] |
| 92 | ··0xffffffffffaa | 92 | ··0xffffffffffaae12e·(offset:·0x895c6)·->·0x1526c·fde=[··73e0] |
| 93 | ··0xffffffffffaa | 93 | ··0xffffffffffaae430·(offset:·0x898c8)·->·0x152cc·fde=[··7440] |
| 94 | ··0xffffffffffaa | 94 | ··0xffffffffffaae45e·(offset:·0x898f6)·->·0x15328·fde=[··749c] |
| 95 | ··0xffffffffffaa | 95 | ··0xffffffffffaae53a·(offset:·0x899d2)·->·0x15388·fde=[··74fc] |
| 96 | ··0xffffffffffaa | 96 | ··0xffffffffffaae5ea·(offset:·0x89a82)·->·0x153e4·fde=[··7558] |
| 97 | ··0xffffffffffaa | 97 | ··0xffffffffffaae63c·(offset:·0x89ad4)·->·0x15444·fde=[··75b8] |
| 98 | ··0xffffffffffaa | 98 | ··0xffffffffffaae68c·(offset:·0x89b24)·->·0x154ac·fde=[··7620] |
| 99 | ··0xffffffffffaa | 99 | ··0xffffffffffaae858·(offset:·0x89cf0)·->·0x15540·fde=[··76b4] |
| 100 | ··0xffffffffffaa | 100 | ··0xffffffffffaaee4b·(offset:·0x8a2e3)·->·0xfb98·fde=[··1d0c] |
| 101 | ··0xffffffffffaa | 101 | ··0xffffffffffaaee81·(offset:·0x8a319)·->·0x129c4·fde=[··4b38] |
| 102 | ··0xffffffffffaa | 102 | ··0xffffffffffaaef08·(offset:·0x8a3a0)·->·0x12a38·fde=[··4bac] |
| 103 | ··0xffffffffffa | 103 | ··0xffffffffffaaef8f·(offset:·0x8a427)·->·0x136a8·fde=[··581c] |
| 104 | ··0xffffffffffa | 104 | ··0xffffffffffaaf016·(offset:·0x8a4ae)·->·0x1569c·fde=[··7810] |
| 105 | ··0xffffffffffa | 105 | ··0xffffffffffaaf026·(offset:·0x8a4be)·->·0x15b8c·fde=[··7d00] |
| 106 | ··0xffffffffffa | 106 | ··0xffffffffffaaf03a·(offset:·0x8a4d2)·->·0x15be4·fde=[··7d58] |
| 107 | ··0xffffffffffa | 107 | ··0xffffffffffaaf04e·(offset:·0x8a4e6)·->·0x15f48·fde=[··80bc] |
| 108 | ··0xffffffffffa | 108 | ··0xffffffffffaaf064·(offset:·0x8a4fc)·->·0x1653c·fde=[··86b0] |
| 109 | ··0xffffffffffa | 109 | ··0xffffffffffaaf08e·(offset:·0x8a526)·->·0x16594·fde=[··8708] |
| 110 | ··0xffffffffffa | 110 | ··0xffffffffffaaf0b8·(offset:·0x8a550)·->·0x16a1c·fde=[··8b90] |
| 111 | ··0xffffffffffa | 111 | ··0xffffffffffaaf0e2·(offset:·0x8a57a)·->·0x16d4c·fde=[··8ec0] |
| 112 | ··0xffffffffffa | 112 | ··0xffffffffffaaf140·(offset:·0x8a5d8)·->·0x16e70·fde=[··8fe4] |
| 113 | ··0xffffffffffa | 113 | ··0xffffffffffaaf19e·(offset:·0x8a636)·->·0x16ee4·fde=[··9058] |
| 114 | ··0xffffffffffa | 114 | ··0xffffffffffaaf39a·(offset:·0x8a832)·->·0x16fe4·fde=[··9158] |
| 115 | ··0xffffffffffa | 115 | ··0xffffffffffaaf3a4·(offset:·0x8a83c)·->·0x17160·fde=[··92d4] |
| 116 | ··0xffffffffffa | 116 | ··0xffffffffffaaf3bc·(offset:·0x8a854)·->·0x177d4·fde=[··9948] |
| 117 | ··0xffffffffffa | 117 | ··0xffffffffffaaf4ca·(offset:·0x8a962)·->·0x17834·fde=[··99a8] |
| 118 | ··0xffffffffffa | 118 | ··0xffffffffffaaf52e·(offset:·0x8a9c6)·->·0x17890·fde=[··9a04] |
| 119 | ··0xffffffffffa | 119 | ··0xffffffffffaaf582·(offset:·0x8aa1a)·->·0x178ec·fde=[··9a60] |
| 120 | ··0xffffffffffa | 120 | ··0xffffffffffaaf5e6·(offset:·0x8aa7e)·->·0x17d28·fde=[··9e9c] |
| 121 | ··0xffffffffffa | 121 | ··0xffffffffffaaf5f0·(offset:·0x8aa88)·->·0x17d80·fde=[··9ef4] |
| 122 | ··0xffffffffffa | 122 | ··0xffffffffffaaf63a·(offset:·0x8aad2)·->·0x17dd8·fde=[··9f4c] |
| 123 | ··0xffffffffffa | 123 | ··0xffffffffffaaf686·(offset:·0x8ab1e)·->·0x17e58·fde=[··9fcc] |
| 124 | ··0xffffffffffa | 124 | ··0xffffffffffaaf68c·(offset:·0x8ab24)·->·0x17ee8·fde=[··a05c] |
| 125 | ··0xffffffffffa | 125 | ··0xffffffffffaaf6a0·(offset:·0x8ab38)·->·0x18124·fde=[··a298] |
| Max diff block lines reached; 14710345/15632819 bytes (94.10%) of diff not shown. | |||
| Offset 1, 8 lines modified | Offset 1, 8 lines modified | ||
| 1 | 1 | k/lib/ld-linux.so.2 | |
| 2 | $"A3*<BB | 2 | $"A3*<BB |
| 3 | :*N&kHX&7 | 3 | :*N&kHX&7 |
| 4 | ^I·#I@Sn | 4 | ^I·#I@Sn |
| 5 | \z+Iv`T?Wu | 5 | \z+Iv`T?Wu |
| 6 | J2`A~=91 | 6 | J2`A~=91 |
| 7 | ZZK&)OC} | 7 | ZZK&)OC} |
| 8 | _&:=$\» \ | 8 | _&:=$\» \ |
| Offset 6162, 15 lines modified | Offset 6162, 15 lines modified | ||
| 6162 | |$49|$$t | 6162 | |$49|$$t |
| 6163 | D$,9D$P~ | 6163 | D$,9D$P~ |
| 6164 | D$(9D$`~4 | 6164 | D$(9D$`~4 |
| 6165 | |$89T$<t| | 6165 | |$89T$<t| |
| 6166 | t$H+t$D) | 6166 | t$H+t$D) |
| 6167 | D$H9D$$uh | 6167 | D$H9D$$uh |
| 6168 | y<-t]<.u( | 6168 | y<-t]<.u( |
| 6169 | t | 6169 | tT9t$4sV |
| 6170 | l"Htotal·length:· | 6170 | l"Htotal·length:· |
| 6171 | mean·length:· | 6171 | mean·length:· |
| 6172 | Parsimony·score·is:· | 6172 | Parsimony·score·is:· |
| 6173 | Error·found·at·line· | 6173 | Error·found·at·line· |
| 6174 | ,·column· | 6174 | ,·column· |
| 6175 | ·(file·position· | 6175 | ·(file·position· |
| 6176 | shuffleAlignment | 6176 | shuffleAlignment |
| Offset 13876, 18 lines modified | Offset 13876, 14 lines modified | ||
| 13876 | i·<=·basic_bitvector<Alloc>::m_size | 13876 | i·<=·basic_bitvector<Alloc>::m_size |
| 13877 | bool·terraces::bitmatrix::get(terraces::index,·terraces::index)·const | 13877 | bool·terraces::bitmatrix::get(terraces::index,·terraces::index)·const |
| 13878 | ./terraphast/lib/bitmatrix.cpp | 13878 | ./terraphast/lib/bitmatrix.cpp |
| 13879 | void·terraces::bitmatrix::set(terraces::index,·terraces::index,·bool) | 13879 | void·terraces::bitmatrix::set(terraces::index,·terraces::index,·bool) |
| 13880 | terraces::bitmatrix·terraces::bitmatrix::get_cols(const·std::vector<unsigned·int>&)·const | 13880 | terraces::bitmatrix·terraces::bitmatrix::get_cols(const·std::vector<unsigned·int>&)·const |
| 13881 | bool·terraces::is_leaf(const·node&) | 13881 | bool·terraces::is_leaf(const·node&) |
| 13882 | (n.lchild()·==·n.rchild())·==·(n.lchild()·==·none) | 13882 | (n.lchild()·==·n.rchild())·==·(n.lchild()·==·none) |
| 13883 | Mismatching·parentheses·in·nwk·tree | ||
| 13884 | Only·bifurcating·trees·are·supported | ||
| 13885 | Mismatching·number·of·rows/columns·between·bitmatrix·header·and·content | ||
| 13886 | Mismatching·size·between·tree·and·bitmatrix | ||
| 13887 | std::ostream&·terraces::print_multitree_node(std::ostream&,·const·multitree_node*,·const·name_map&) | 13883 | std::ostream&·terraces::print_multitree_node(std::ostream&,·const·multitree_node*,·const·name_map&) |
| 13888 | ./terraphast/lib/multitree.cpp | 13884 | ./terraphast/lib/multitree.cpp |
| 13889 | static·terraces::small_bipartition·terraces::small_bipartition::full_set(terraces::index) | 13885 | static·terraces::small_bipartition·terraces::small_bipartition::full_set(terraces::index) |
| 13890 | ./terraphast/lib/small_bipartition.hpp | 13886 | ./terraphast/lib/small_bipartition.hpp |
| 13891 | void·terraces::multitree_iterator::init_subtree(terraces::index) | 13887 | void·terraces::multitree_iterator::init_subtree(terraces::index) |
| 13892 | ./terraphast/lib/multitree_iterator.cpp | 13888 | ./terraphast/lib/multitree_iterator.cpp |
| 13893 | false·&&·"Malformed·multitree:·Nested·alternative_arrays" | 13889 | false·&&·"Malformed·multitree:·Nested·alternative_arrays" |
| Offset 14020, 14 lines modified | Offset 14016, 15 lines modified | ||
| 14020 | ERROR:·FTOL·.LT.ERROR:·GTOL·.LT.ERROR:·XTOL·.LT.ERROR:·STPMIN·.LERROR:·STPMAX·.LMAX·.LT.·STPMIN | 14016 | ERROR:·FTOL·.LT.ERROR:·GTOL·.LT.ERROR:·XTOL·.LT.ERROR:·STPMIN·.LERROR:·STPMAX·.LMAX·.LT.·STPMIN |
| 14021 | WARNING:·ROUNDING·ERRORS·PREVENTREVENT·PROGRESS | 14017 | WARNING:·ROUNDING·ERRORS·PREVENTREVENT·PROGRESS |
| 14022 | WARNING:·XTOL·TE·TEST·SATISFIED | 14018 | WARNING:·XTOL·TE·TEST·SATISFIED |
| 14023 | WARNING:·STP·=·SCONVERGENCE:·NORM·OF·PROJECTED·GRADIENT·<=·PGTOLWARNING:·ABNORMAL_TERMINATION_INRESTART_FROM_LNSCONVERGENCE:·REL_REDUCTION_OF_F·<=·FACTR*EPSMCH | 14019 | WARNING:·STP·=·SCONVERGENCE:·NORM·OF·PROJECTED·GRADIENT·<=·PGTOLWARNING:·ABNORMAL_TERMINATION_INRESTART_FROM_LNSCONVERGENCE:·REL_REDUCTION_OF_F·<=·FACTR*EPSMCH |
| 14024 | PAACDEFGHIKLMNPQRS·among·stored·chcharacter·labels)·is·invalid;·must·be·greater·th0123456789ABCDEF()[]{}/\,;:=*'"`·block·contains··command,·but·fo]·is·not·a·valid·command·comment | 14020 | PAACDEFGHIKLMNPQRS·among·stored·chcharacter·labels)·is·invalid;·must·be·greater·th0123456789ABCDEF()[]{}/\,;:=*'"`·block·contains··command,·but·fo]·is·not·a·valid·command·comment |
| 14025 | The·number·of·TRANSLATE·entries·should·equal·the·number·of·taxa | 14021 | The·number·of·TRANSLATE·entries·should·equal·the·number·of·taxa |
| 14026 | Perhaps·there·were·fewer·taxa·in·the·tree·file·than·previously· | 14022 | Perhaps·there·were·fewer·taxa·in·the·tree·file·than·previously· |
| 14023 | Mismatching·quototes·in·nwk·treeUnknown·taxon·inaxon·in·nwk·treeDuplicate·taxon·Malformed·nwk·trLess·than·4·taxataxa·in·nwk·treeon·in·bitmatrix·Empty·taxon·nameame·in·bitmatrixMalformed·bitmatee·and·bitmatrixUnnamed·leaf·fouaf·found·in·treeUUU | ||
| 14027 | f?=UUUUU | 14024 | f?=UUUUU |
| 14028 | ?St12_Vector_baseIjSaIjEE | 14025 | ?St12_Vector_baseIjSaIjEE |
| 14029 | St6vectorIjSaIjEE | 14026 | St6vectorIjSaIjEE |
| 14030 | 7Pattern | 14027 | 7Pattern |
| 14031 | __root__ | 14028 | __root__ |
| 14032 | Number·of·taxa·must·be·greater·than·2. | 14029 | Number·of·taxa·must·be·greater·than·2. |
| 14033 | 9CkpStream | 14030 | 9CkpStream |
| Offset 14393, 14 lines modified | Offset 14390, 15 lines modified | ||
| 14393 | 12NxsTaxaBlock | 14390 | 12NxsTaxaBlock |
| 14394 | 8NxsToken | 14391 | 8NxsToken |
| 14395 | 13NxsTreesBlock | 14392 | 13NxsTreesBlock |
| 14396 | 16NxsDiscreteDatum | 14393 | 16NxsDiscreteDatum |
| 14397 | N8terraces15bad_input_errorE | 14394 | N8terraces15bad_input_errorE |
| 14398 | N8terraces20no_usable_root_errorE | 14395 | N8terraces20no_usable_root_errorE |
| 14399 | N8terraces25tree_count_overflow_errorE | 14396 | N8terraces25tree_count_overflow_errorE |
| 14397 | Mismatching·parentheses·in·nwk·tOnly·bifurcating·trees·are·suppoMismatching·number·of·rows/columns·between·bitmatrix·header·and·Mismatching·size·between·tree·ant | ||
| 14400 | o.0z.·\. | 14398 | o.0z.·\. |
| 14401 | KNKNTTTTRSRSIIMIQHQHPPPPRRRRLLLLEDEDAAAAGGGGVVVV*Y*YSSSSGCWCLFLF | 14399 | KNKNTTTTRSRSIIMIQHQHPPPPRRRRLLLLEDEDAAAAGGGGVVVV*Y*YSSSSGCWCLFLF |
| 14402 | KNKNTTTTSSKSIIMIQHQHPPPPRRRRLLLLEDEDAAAAGGGGVVVV*Y*YSSSSWCWCLFLF | 14400 | KNKNTTTTSSKSIIMIQHQHPPPPRRRRLLLLEDEDAAAAGGGGVVVV*Y*YSSSSWCWCLFLF |
| 14403 | KNKNTTTTRSRSIIMIQHQHPPPPRRRRLLLLEDEDAAAAGGGGVVVV*Y*YSSSS*CWC*FLF | 14401 | KNKNTTTTRSRSIIMIQHQHPPPPRRRRLLLLEDEDAAAAGGGGVVVV*Y*YSSSS*CWC*FLF |
| 14404 | KNKNTTTTRSRSIIMIQHQHPPPPRRRRLLLLEDEDAAAAGGGGVVVV*YLY*SSS*CWCLFLF | 14402 | KNKNTTTTRSRSIIMIQHQHPPPPRRRRLLLLEDEDAAAAGGGGVVVV*YLY*SSS*CWCLFLF |
| 14405 | NNKNTTTTSSSSMIMIQHQHPPPPRRRRLLLLEDEDAAAAGGGGVVVV*Y*YSSSSWCWCLFLF | 14403 | NNKNTTTTSSSSMIMIQHQHPPPPRRRRLLLLEDEDAAAAGGGGVVVV*Y*YSSSSWCWCLFLF |
| 14406 | KNKNTTTTRSRSIIMIQHQHPPPPRRRRLLLLEDEDAAAAGGGGVVVV*YLYSSSS*CWCLFLF | 14404 | KNKNTTTTRSRSIIMIQHQHPPPPRRRRLLLLEDEDAAAAGGGGVVVV*YLYSSSS*CWCLFLF |
| Offset 3, 16 lines modified | Offset 3, 16 lines modified | ||
| 3 | Disassembly·of·section·.init: | 3 | Disassembly·of·section·.init: |
| 4 | 00080000·<.init>: | 4 | 00080000·<.init>: |
| 5 | _init(): | 5 | _init(): |
| 6 | » push···%ebx | 6 | » push···%ebx |
| 7 | » sub····$0x8,%esp | 7 | » sub····$0x8,%esp |
| 8 | » call···e8 | 8 | » call···e8510·<_start@@Base+0x30> |
| 9 | » add····$0x61 | 9 | » add····$0x61fa23,%ebx |
| 10 | » mov····0x5a8(%ebx),%eax | 10 | » mov····0x5a8(%ebx),%eax |
| 11 | » test···%eax,%eax | 11 | » test···%eax,%eax |
| 12 | » je·····8001b·<__printf_chk@plt-0x15> | 12 | » je·····8001b·<__printf_chk@plt-0x15> |
| 13 | » call···*%eax | 13 | » call···*%eax |
| 14 | » add····$0x8,%esp | 14 | » add····$0x8,%esp |
| 15 | » pop····%ebx | 15 | » pop····%ebx |
| 16 | » ret | 16 | » ret |
| Offset 10, 28 lines modified | Offset 10, 28 lines modified | ||
| 10 | » sub····%gs:0x14,%eax | 10 | » sub····%gs:0x14,%eax |
| 11 | » jne····813a2·<free@plt+0x42> | 11 | » jne····813a2·<free@plt+0x42> |
| 12 | » call···80bf0·<std::__throw_bad_cast()@plt> | 12 | » call···80bf0·<std::__throw_bad_cast()@plt> |
| 13 | » mov····-0x1c(%ebp),%eax | 13 | » mov····-0x1c(%ebp),%eax |
| 14 | » sub····%gs:0x14,%eax | 14 | » sub····%gs:0x14,%eax |
| 15 | » jne····813a7·<free@plt+0x47> | 15 | » jne····813a7·<free@plt+0x47> |
| 16 | » call···80bf0·<std::__throw_bad_cast()@plt> | 16 | » call···80bf0·<std::__throw_bad_cast()@plt> |
| 17 | » call···51 | 17 | » call···516580·<terraces::basic_bitvector<std::allocator<unsigned·int>·>*·std::__do_uninit_fill_n<terraces::basic_bitvector<std::allocator<unsigned·int>·>*,·unsigned·int,·terraces::basic_bitvector<std::allocator<unsigned·int>·>·>(terraces::basic_bitvector<std::allocator<unsigned·int>·>*,·unsigned·int,·terraces::basic_bitvector<std::allocator<unsigned·int>·>·const&)@@Base+0x180> |
| 18 | » call···51 | 18 | » call···516580·<terraces::basic_bitvector<std::allocator<unsigned·int>·>*·std::__do_uninit_fill_n<terraces::basic_bitvector<std::allocator<unsigned·int>·>*,·unsigned·int,·terraces::basic_bitvector<std::allocator<unsigned·int>·>·>(terraces::basic_bitvector<std::allocator<unsigned·int>·>*,·unsigned·int,·terraces::basic_bitvector<std::allocator<unsigned·int>·>·const&)@@Base+0x180> |
| 19 | ./build.mpi/./obsolete/parsmultistate.cpp:48 | 19 | ./build.mpi/./obsolete/parsmultistate.cpp:48 |
| 20 | » sub····$0xc,%esp | 20 | » sub····$0xc,%esp |
| 21 | » mov····%eax,-0xf9c(%ebp) | 21 | » mov····%eax,-0xf9c(%ebp) |
| 22 | » mov····%esi,%ebx | 22 | » mov····%esi,%ebx |
| 23 | » push···%edi | 23 | » push···%edi |
| 24 | » call···1622 | 24 | » call···1622c0·<ParsTree::~ParsTree()@@Base> |
| 25 | » mov····-0xf9c(%ebp),%edi | 25 | » mov····-0xf9c(%ebp),%edi |
| 26 | » add····$0x10,%esp | 26 | » add····$0x10,%esp |
| 27 | » sub····$0xc,%esp | 27 | » sub····$0xc,%esp |
| 28 | » push···-0xfa0(%ebp) | 28 | » push···-0xfa0(%ebp) |
| 29 | » mov····%esi,%ebx | 29 | » mov····%esi,%ebx |
| 30 | » call···f4 | 30 | » call···f4530·<Alignment::~Alignment()@@Base> |
| 31 | » add····$0x10,%esp | 31 | » add····$0x10,%esp |
| 32 | » mov····-0x1c(%ebp),%eax | 32 | » mov····-0x1c(%ebp),%eax |
| 33 | » sub····%gs:0x14,%eax | 33 | » sub····%gs:0x14,%eax |
| 34 | » jne····81431·<free@plt+0xd1> | 34 | » jne····81431·<free@plt+0xd1> |
| 35 | » sub····$0xc,%esp | 35 | » sub····$0xc,%esp |
| 36 | » push···%edi | 36 | » push···%edi |
| 37 | » call···810a0·<_Unwind_Resume@plt> | 37 | » call···810a0·<_Unwind_Resume@plt> |
| Offset 50, 27 lines modified | Offset 50, 27 lines modified | ||
| 50 | » mov····-0x1c(%ebp),%eax | 50 | » mov····-0x1c(%ebp),%eax |
| 51 | » sub····%gs:0x14,%eax | 51 | » sub····%gs:0x14,%eax |
| 52 | » jne····8142c·<free@plt+0xcc> | 52 | » jne····8142c·<free@plt+0xcc> |
| 53 | » sub····$0xc,%esp | 53 | » sub····$0xc,%esp |
| 54 | » push···-0xf9c(%ebp) | 54 | » push···-0xf9c(%ebp) |
| 55 | » call···810a0·<_Unwind_Resume@plt> | 55 | » call···810a0·<_Unwind_Resume@plt> |
| 56 | /usr/include/c++/14/bits/basic_ios.h:50 | 56 | /usr/include/c++/14/bits/basic_ios.h:50 |
| 57 | » call···51 | 57 | » call···516580·<terraces::basic_bitvector<std::allocator<unsigned·int>·>*·std::__do_uninit_fill_n<terraces::basic_bitvector<std::allocator<unsigned·int>·>*,·unsigned·int,·terraces::basic_bitvector<std::allocator<unsigned·int>·>·>(terraces::basic_bitvector<std::allocator<unsigned·int>·>*,·unsigned·int,·terraces::basic_bitvector<std::allocator<unsigned·int>·>·const&)@@Base+0x180> |
| 58 | » call···51 | 58 | » call···516580·<terraces::basic_bitvector<std::allocator<unsigned·int>·>*·std::__do_uninit_fill_n<terraces::basic_bitvector<std::allocator<unsigned·int>·>*,·unsigned·int,·terraces::basic_bitvector<std::allocator<unsigned·int>·>·>(terraces::basic_bitvector<std::allocator<unsigned·int>·>*,·unsigned·int,·terraces::basic_bitvector<std::allocator<unsigned·int>·>·const&)@@Base+0x180> |
| 59 | » call···51 | 59 | » call···516580·<terraces::basic_bitvector<std::allocator<unsigned·int>·>*·std::__do_uninit_fill_n<terraces::basic_bitvector<std::allocator<unsigned·int>·>*,·unsigned·int,·terraces::basic_bitvector<std::allocator<unsigned·int>·>·>(terraces::basic_bitvector<std::allocator<unsigned·int>·>*,·unsigned·int,·terraces::basic_bitvector<std::allocator<unsigned·int>·>·const&)@@Base+0x180> |
| 60 | 00081436·<boost::wrapexcept<std::overflow_error>::rethrow()·const@@Base>: | 60 | 00081436·<boost::wrapexcept<std::overflow_error>::rethrow()·const@@Base>: |
| 61 | boost::wrapexcept<std::overflow_error>::rethrow()·const: | 61 | boost::wrapexcept<std::overflow_error>::rethrow()·const: |
| 62 | /usr/include/boost/throw_exception.hpp:123 | 62 | /usr/include/boost/throw_exception.hpp:123 |
| 63 | » push···%ebp | 63 | » push···%ebp |
| 64 | » mov····%esp,%ebp | 64 | » mov····%esp,%ebp |
| 65 | » push···%edi | 65 | » push···%edi |
| 66 | » push···%esi | 66 | » push···%esi |
| 67 | » call···e8 | 67 | » call···e8a16·<std::ctype<char>::do_widen(char)·const@@Base+0x6> |
| 68 | » add····$0x61 | 68 | » add····$0x61e5ec,%esi |
| 69 | » push···%ebx | 69 | » push···%ebx |
| 70 | » sub····$0x28,%esp | 70 | » sub····$0x28,%esp |
| 71 | /usr/include/boost/throw_exception.hpp:131 | 71 | /usr/include/boost/throw_exception.hpp:131 |
| 72 | » push···$0x24 | 72 | » push···$0x24 |
| 73 | » lea····-0x6cb0(%esi),%eax | 73 | » lea····-0x6cb0(%esi),%eax |
| 74 | » mov····%esi,%ebx | 74 | » mov····%esi,%ebx |
| 75 | » lea····-0x18(%eax),%edx | 75 | » lea····-0x18(%eax),%edx |
| Offset 124, 15 lines modified | Offset 124, 15 lines modified | ||
| 124 | /usr/include/boost/throw_exception.hpp:71·(discriminator·2) | 124 | /usr/include/boost/throw_exception.hpp:71·(discriminator·2) |
| 125 | » lea····-0x6c9c(%esi),%eax | 125 | » lea····-0x6c9c(%esi),%eax |
| 126 | /usr/include/boost/throw_exception.hpp:131·(discriminator·2) | 126 | /usr/include/boost/throw_exception.hpp:131·(discriminator·2) |
| 127 | » push···%edx | 127 | » push···%edx |
| 128 | /usr/include/boost/throw_exception.hpp:71·(discriminator·2) | 128 | /usr/include/boost/throw_exception.hpp:71·(discriminator·2) |
| 129 | » mov····%eax,0xc(%edi) | 129 | » mov····%eax,0xc(%edi) |
| 130 | /usr/include/boost/throw_exception.hpp:131·(discriminator·2) | 130 | /usr/include/boost/throw_exception.hpp:131·(discriminator·2) |
| 131 | » lea····-0x57 | 131 | » lea····-0x57e07c(%esi),%eax |
| 132 | » push···%eax | 132 | » push···%eax |
| 133 | » lea····-0x6ed0(%esi),%eax | 133 | » lea····-0x6ed0(%esi),%eax |
| 134 | » push···%eax | 134 | » push···%eax |
| 135 | » push···%edi | 135 | » push···%edi |
| 136 | /usr/include/boost/exception/exception.hpp:250·(discriminator·1) | 136 | /usr/include/boost/exception/exception.hpp:250·(discriminator·1) |
| 137 | » movq···%xmm2,-0x20(%ebp) | 137 | » movq···%xmm2,-0x20(%ebp) |
| 138 | » movq···%xmm2,0x14(%edi) | 138 | » movq···%xmm2,0x14(%edi) |
| Offset 165, 16 lines modified | Offset 165, 16 lines modified | ||
| 165 | 00081528·<boost::wrapexcept<std::domain_error>::rethrow()·const@@Base>: | 165 | 00081528·<boost::wrapexcept<std::domain_error>::rethrow()·const@@Base>: |
| 166 | boost::wrapexcept<std::domain_error>::rethrow()·const: | 166 | boost::wrapexcept<std::domain_error>::rethrow()·const: |
| 167 | /usr/include/boost/throw_exception.hpp:123 | 167 | /usr/include/boost/throw_exception.hpp:123 |
| 168 | » push···%ebp | 168 | » push···%ebp |
| 169 | » mov····%esp,%ebp | 169 | » mov····%esp,%ebp |
| 170 | » push···%edi | 170 | » push···%edi |
| 171 | » push···%esi | 171 | » push···%esi |
| 172 | » call···e8 | 172 | » call···e8a16·<std::ctype<char>::do_widen(char)·const@@Base+0x6> |
| 173 | » add····$0x61 | 173 | » add····$0x61e4fa,%esi |
| 174 | » push···%ebx | 174 | » push···%ebx |
| 175 | » sub····$0x28,%esp | 175 | » sub····$0x28,%esp |
| 176 | /usr/include/boost/throw_exception.hpp:131 | 176 | /usr/include/boost/throw_exception.hpp:131 |
| 177 | » push···$0x24 | 177 | » push···$0x24 |
| 178 | » lea····-0x6cec(%esi),%eax | 178 | » lea····-0x6cec(%esi),%eax |
| 179 | » mov····%esi,%ebx | 179 | » mov····%esi,%ebx |
| 180 | » lea····-0x18(%eax),%edx | 180 | » lea····-0x18(%eax),%edx |
| Offset 228, 15 lines modified | Offset 228, 15 lines modified | ||
| 228 | /usr/include/boost/throw_exception.hpp:71·(discriminator·2) | 228 | /usr/include/boost/throw_exception.hpp:71·(discriminator·2) |
| 229 | » lea····-0x6cd8(%esi),%eax | 229 | » lea····-0x6cd8(%esi),%eax |
| 230 | /usr/include/boost/throw_exception.hpp:131·(discriminator·2) | 230 | /usr/include/boost/throw_exception.hpp:131·(discriminator·2) |
| 231 | » push···%edx | 231 | » push···%edx |
| 232 | /usr/include/boost/throw_exception.hpp:71·(discriminator·2) | 232 | /usr/include/boost/throw_exception.hpp:71·(discriminator·2) |
| 233 | » mov····%eax,0xc(%edi) | 233 | » mov····%eax,0xc(%edi) |
| 234 | /usr/include/boost/throw_exception.hpp:131·(discriminator·2) | 234 | /usr/include/boost/throw_exception.hpp:131·(discriminator·2) |
| 235 | » lea····-0x57 | 235 | » lea····-0x57e19c(%esi),%eax |
| 236 | » push···%eax | 236 | » push···%eax |
| 237 | » lea····-0x6ef8(%esi),%eax | 237 | » lea····-0x6ef8(%esi),%eax |
| 238 | » push···%eax | 238 | » push···%eax |
| 239 | » push···%edi | 239 | » push···%edi |
| 240 | /usr/include/boost/exception/exception.hpp:250·(discriminator·1) | 240 | /usr/include/boost/exception/exception.hpp:250·(discriminator·1) |
| 241 | » movq···%xmm2,-0x20(%ebp) | 241 | » movq···%xmm2,-0x20(%ebp) |
| 242 | » movq···%xmm2,0x14(%edi) | 242 | » movq···%xmm2,0x14(%edi) |
| Offset 268, 16 lines modified | Offset 268, 16 lines modified | ||
| 268 | 0008161a·<boost::wrapexcept<boost::math::rounding_error>::rethrow()·const@@Base>: | 268 | 0008161a·<boost::wrapexcept<boost::math::rounding_error>::rethrow()·const@@Base>: |
| 269 | boost::wrapexcept<boost::math::rounding_error>::rethrow()·const: | 269 | boost::wrapexcept<boost::math::rounding_error>::rethrow()·const: |
| 270 | /usr/include/boost/throw_exception.hpp:123 | 270 | /usr/include/boost/throw_exception.hpp:123 |
| 271 | » push···%ebp | 271 | » push···%ebp |
| 272 | » mov····%esp,%ebp | 272 | » mov····%esp,%ebp |
| 273 | » push···%edi | 273 | » push···%edi |
| 274 | » call···1302 | 274 | » call···1302ad·<Eigen::ScalarBinaryOpTraits<double,·Eigen::internal::traits<Eigen::Block<Eigen::Inverse<Eigen::FullPivLU<Eigen::Matrix<double,·-1,·-1,·0,·-1,·-1>·>·>·const,·-1,·1,·true>·>::Scalar,·Eigen::internal::scalar_product_op<double,·Eigen::internal::traits<Eigen::Block<Eigen::Inverse<Eigen::FullPivLU<Eigen::Matrix<double,·-1,·-1,·0,·-1,·-1>·>·>·const,·-1,·1,·true>·>::Scalar>·>::ReturnType·Eigen::MatrixBase<Eigen::Block<Eigen::Transpose<Eigen::Matrix<double,·-1,·1,·0,·-1,·1>·>·const,·1,·-1,·true>·>::dot<Eigen::Block<Eigen::Inverse<Eigen::FullPivLU<Eigen::Matrix<double,·-1,·-1,·0,·-1,·-1>·>·>·const,·-1,·1,·true>·>(Eigen::MatrixBase<Eigen::Block<Eigen::Inverse<Eigen::FullPivLU<Eigen::Matrix<double,·-1,·-1,·0,·-1,·-1>·>·>·const,·-1,·1,·true>·>·const&)·const@@Base+0x76d> |
| 275 | » add····$0x61 | 275 | » add····$0x61e409,%edi |
| 276 | » push···%esi | 276 | » push···%esi |
| 277 | » push···%ebx | 277 | » push···%ebx |
| 278 | » sub····$0x38,%esp | 278 | » sub····$0x38,%esp |
| 279 | /usr/include/boost/throw_exception.hpp:131 | 279 | /usr/include/boost/throw_exception.hpp:131 |
| 280 | » push···$0x24 | 280 | » push···$0x24 |
| 281 | » lea····-0x6c74(%edi),%eax | 281 | » lea····-0x6c74(%edi),%eax |
| 282 | » mov····%edi,%ebx | 282 | » mov····%edi,%ebx |
| Offset 332, 15 lines modified | Offset 332, 15 lines modified | ||
| 332 | /usr/include/boost/throw_exception.hpp:71·(discriminator·2) | 332 | /usr/include/boost/throw_exception.hpp:71·(discriminator·2) |
| 333 | » lea····-0x6c60(%edi),%eax | 333 | » lea····-0x6c60(%edi),%eax |
| 334 | /usr/include/boost/throw_exception.hpp:131·(discriminator·2) | 334 | /usr/include/boost/throw_exception.hpp:131·(discriminator·2) |
| 335 | » push···%edx | 335 | » push···%edx |
| Max diff block lines reached; 84537861/84547368 bytes (99.99%) of diff not shown. | |||
| Offset 1, 14 lines modified | Offset 1, 14 lines modified | ||
| 1 | Disassembly·of·section·.fini: | 1 | Disassembly·of·section·.fini: |
| 2 | 0051 | 2 | 00516594·<.fini>: |
| 3 | _fini(): | 3 | _fini(): |
| 4 | » push···%ebx | 4 | » push···%ebx |
| 5 | » sub····$0x8,%esp | 5 | » sub····$0x8,%esp |
| 6 | » call···e8 | 6 | » call···e8510·<_start@@Base+0x30> |
| 7 | » add····$0x189 | 7 | » add····$0x18948f,%ebx |
| 8 | » add····$0x8,%esp | 8 | » add····$0x8,%esp |
| 9 | » pop····%ebx | 9 | » pop····%ebx |
| 10 | » ret | 10 | » ret |
| Offset 1, 50239 lines modified | Offset 1, 50253 lines modified | ||
| Diff chunk too large, falling back to line-by-line diff (9738 lines added, 9994 lines removed) | |||
| 1 | Hex·dump·of·section·'.rodata': | 1 | Hex·dump·of·section·'.rodata': |
| 2 | ··0x0051 | 2 | ··0x00517000·03000000·01000200·0000805f·0000803f·..........._...? |
| 3 | ··0x0051 | 3 | ··0x00517010·00000040·00004040·60c7223e·0000c03f·...@..@@`.">...? |
| 4 | ··0x0051 | 4 | ··0x00517020·1035073f·d06ee73e·000000bf·0000003f·.5.?.n.>.......? |
| 5 | ··0x0051 | 5 | ··0x00517030·0000903f·e0c0853f·0000dc42·d0d6cf3e·...?...?...B...> |
| 6 | ··0x0051 | 6 | ··0x00517040·00002040·f0b8013f·00009040·00006040·..·@...?...@..`@ |
| 7 | ··0x0051 | 7 | ··0x00517050·20630a3f·d0e90e3f·00001041·0000c842··c.?...?...A...B |
| 8 | ··0x0051 | 8 | ··0x00517060·00004842·00703146·006c3146·006c31c6·..HB.p1F.l1F.l1. |
| 9 | ··0x0051 | 9 | ··0x00517070·f9021550·006ce63c·b099833f·0000a0c1·...P.l.<...?.... |
| 10 | ··0x0051 | 10 | ··0x00517080·00002a43·0000803e·00008040·00007041·..*C...>...@..pA |
| 11 | ··0x0051 | 11 | ··0x00517090·0000a041·00002041·00001643·00004041·...A..·A...C..@A |
| 12 | ··0x0051 | 12 | ··0x005170a0·00009043·0000f041·0000004f·000000cf·...C...A...O.... |
| 13 | ··0x0051 | 13 | ··0x005170b0·00007a44·0000403f·00004843·0000005f·..zD..@?..HC..._ |
| 14 | ··0x0051 | 14 | ··0x005170c0·00002042·00504347·00008025·0000c843·..·B.PCG...%...C |
| 15 | ··0x0051 | 15 | ··0x005170d0·0000c07f·00008035·000000c0·0000807f·.......5........ |
| 16 | ··0x0051 | 16 | ··0x005170e0·00000000·00401c46·002474c9·010e020d·.....@.F.$t..... |
| 17 | ··0x0051 | 17 | ··0x005170f0·0b0a0c02·0e05010f·13111612·00007042·..............pB |
| 18 | ··0x0051 | 18 | ··0x00517100·000080ff·00247449·0000803a·00008030·.....$tI...:...0 |
| 19 | ··0x0051 | 19 | ··0x00517110·0000a040·00007043·00003041·0000c040·...@..pC..0A...@ |
| 20 | ··0x0051 | 20 | ··0x00517120·0050c347·00007ac4·0000802f·000080ce·.P.G..z..../.... |
| 21 | ··0x0051 | 21 | ··0x00517130·000040bf·000080bf·0000e0be·00008032·..@............2 |
| 22 | ··0x0051 | 22 | ··0x00517140·000020c2·00009841·00008039·0000803b·..·....A...9...; |
| 23 | ··0x0051 | 23 | ··0x00517150·0000d841·00406244·0000a242·0000e040·...A.@bD...B...@ |
| 24 | ··0x0051 | 24 | ··0x00517160·00009041·0000b842·00007543·0000e041·...A...B..uC...A |
| 25 | ··0x0051 | 25 | ··0x00517170·00006842·00000444·0000ee42·00008041·..hB...D...B...A |
| 26 | ··0x0051 | 26 | ··0x00517180·00006041·00002c42·00808e43·00000842·..`A..,B...C...B |
| 27 | ··0x0051 | 27 | ··0x00517190·0000c043·00008c42·0000b841·00007743·...C...B...A..wC |
| 28 | ··0x0051 | 28 | ··0x005171a0·00000643·00006c42·0000d242·00988a45·...C..lB...B...E |
| 29 | ··0x0051 | 29 | ··0x005171b0·0080bd43·0000e841·00005a43·0080a343·...C...A..ZC...C |
| 30 | ··0x0051 | 30 | ··0x005171c0·00409644·00000042·00005844·0000b041·.@.D...B..XD...A |
| 31 | ··0x0051 | 31 | ··0x005171d0·00004a43·0000fa43·00003042·0000a143·..JC...C..0B...C |
| 32 | ··0x0051 | 32 | ··0x005171e0·0000ae42·00401a44·003c1cc6·0000a842·...B.@.D.<.....B |
| 33 | ··0x0051 | 33 | ··0x005171f0·00000c43·00005243·0000d243·00c09f44·...C..RC...C...D |
| 34 | ··0x0051 | 34 | ··0x00517200·00a08e44·00807144·00c03744·00801d45·...D..qD..7D...E |
| 35 | ··0x0051 | 35 | ··0x00517210·00006944·00c03044·0000e743·0080d944·..iD..0D...C...D |
| 36 | ··0x0051 | 36 | ··0x00517220·00405e44·00009343·00c09344·00002844·.@^D...C...D..(D |
| 37 | ··0x0051 | 37 | ··0x00517230·00007c43·00809d45·00801744·00002f43·..|C...E...D../C |
| 38 | ··0x0051 | 38 | ··0x00517240·00008443·0000fe42·0000ad43·0000f042·...C...B...C...B |
| 39 | ··0x0051 | 39 | ··0x00517250·0000c642·00406c46·0040ec46·00005245·...B.@lF.@.F..RE |
| 40 | ··0x0051 | 40 | ··0x00517260·0000bd44·005a8748·c0f7034b·00006042·...D.Z.H...K..`B |
| 41 | ··0x0051 | 41 | ··0x00517270·00e0c446·00a2f349·c0f7834b·00807745·...F...I...K..wE |
| 42 | ··0x0051 | 42 | ··0x00517280·c0f7034a·fa56904d·0000b442·0090d847·...J.V.M...B...G |
| 43 | ··0x0051 | 43 | ··0x00517290·90f1e64b·8870f74e·00f07f46·98cb1b4c·...K.p.N...F...L |
| 44 | ··0x0051 | 44 | ··0x005172a0·00003643·009c6a49·00000026·00008059·..6C..jI...&...Y |
| 45 | ··0x0051 | 45 | ··0x005172b0·0000800b·000080c0·000080be·00c07944·..............yD |
| 46 | ··0x0051 | 46 | ··0x005172c0·0000804e·00008049·00008034·0000801f·...N...I...4.... |
| 47 | ··0x0051 | 47 | ··0x005172d0·0000803d·0000a441·0000203f·00000443·...=...A..·?...C |
| 48 | ··0x0051 | 48 | ··0x005172e0·00905846·006c2248·746f7461·6c206c65·..XF.l"Htotal·le |
| 49 | ··0x0051 | 49 | ··0x005172f0·6e677468·3a20006d·65616e20·6c656e67·ngth:·.mean·leng |
| 50 | ··0x0051 | 50 | ··0x00517300·74683a20·00506172·73696d6f·6e792073·th:·.Parsimony·s |
| 51 | ··0x0051 | 51 | ··0x00517310·636f7265·2069733a·20004572·726f7220·core·is:·.Error· |
| 52 | ··0x0051 | 52 | ··0x00517320·666f756e·64206174·206c696e·6520002c·found·at·line·., |
| 53 | ··0x0051 | 53 | ··0x00517330·20636f6c·756d6e20·00202866·696c6520··column·.·(file· |
| 54 | ··0x0051 | 54 | ··0x00517340·706f7369·74696f6e·2000293a·00736875·position·.):.shu |
| 55 | ··0x0051 | 55 | ··0x00517350·66666c65·416c6967·6e6d656e·7400496e·ffleAlignment.In |
| 56 | ··0x0051 | 56 | ··0x00517360·7465726e·616c2065·72726f72·3a200062·ternal·error:·.b |
| 57 | ··0x0051 | 57 | ··0x00517370·61736963·5f737472·696e673a·3a617070·asic_string::app |
| 58 | ··0x0051 | 58 | ··0x00517380·656e6400·2e2f616c·69676e6d·656e742f·end../alignment/ |
| 59 | ··0x0051 | 59 | ··0x00517390·616c6967·6e6d656e·742e6370·7000416c·alignment.cpp.Al |
| 60 | ··0x0051 | 60 | ··0x005173a0·69676e6d·656e7420·66696c65·20697320·ignment·file·is· |
| 61 | ··0x0051 | 61 | ··0x005173b0·746f6f20·73686f72·742e0073·74617465·too·short..state |
| 62 | ··0x0051 | 62 | ··0x005173c0·3a202020·20202020·20202020·20202000·:··············. |
| 63 | ··0x0051 | 63 | ··0x005173d0·706f6d6f·5f73616d·706c6564·5f737461·pomo_sampled_sta |
| 64 | ··0x0051 | 64 | ··0x005173e0·7465732e·73697a65·28293a20·00737461·tes.size():·.sta |
| 65 | ··0x0051 | 65 | ··0x005173f0·7465203c·206e756d·5f737461·74657300·te·<·num_states. |
| 66 | ··0x0051 | 66 | ··0x00517400·70616972·5f667265·71007365·715f6964·pair_freq.seq_id |
| 67 | ··0x0051 | 67 | ··0x00517410·203c2067·65744e53·65712829·0067656e··<·getNSeq().gen |
| 68 | ··0x0051 | 68 | ··0x00517420·65746963·5f636f64·65002e2f·6e636c2f·etic_code../ncl/ |
| 69 | ··0x0051 | 69 | ··0x00517430·6e787363·68617261·63746572·73626c6f·nxscharactersblo |
| 70 | ··0x0051 | 70 | ··0x00517440·636b2e68·0073796d·626f6c73·0070203c·ck.h.symbols.p·< |
| 71 | ··0x0051 | 71 | ··0x00517450·20737472·6c656e28·73796d62·6f6c7329··strlen(symbols) |
| 72 | ··0x0051 | 72 | ··0x00517460·00206861·7320696e·76616c69·64207369·.·has·invalid·si |
| 73 | ··0x0051 | 73 | ··0x00517470·6e676c65·20737461·74652000·20617420·ngle·state·.·at· |
| 74 | ··0x0051 | 74 | ··0x00517480·73697465·20002320·416c6967·6e6d656e·site·.#·Alignmen |
| 75 | ··0x0051 | 75 | ··0x00517490·74207369·74652073·74617469·73746963·t·site·statistic |
| 76 | ··0x0051 | 76 | ··0x005174a0·73002320·20207461·623d7265·61642e74·s.#···tab=read.t |
| 77 | ··0x0051 | 77 | ··0x005174b0·61626c65·28270023·20202050·6172743a·able('.#···Part: |
| 78 | ··0x0051 | 78 | ··0x005174c0·20202050·61727469·74696f6e·20494400····Partition·ID. |
| 79 | ··0x0051 | 79 | ··0x005174d0·23202020·53697465·3a202020·53697465·#···Site:···Site |
| 80 | ··0x0051 | 80 | ··0x005174e0·20494400·50617274·09005369·74650953··ID.Part..Site.S |
| 81 | ··0x0051 | 81 | ··0x005174f0·74617400·53544154·455f554e·4b4e4f57·tat.STATE_UNKNOW |
| 82 | ··0x0051 | 82 | ··0x00517500·4e203c20·31323600·636f646f·6e5f7461·N·<·126.codon_ta |
| 83 | ··0x0051 | 83 | ··0x00517510·626c6500·4e4f5445·3a205374·61746528·ble.NOTE:·State( |
| 84 | ··0x0051 | 84 | ··0x00517520·73292000·206e6f74·20707265·73656e74·s)·.·not·present |
| 85 | ··0x0051 | 85 | ··0x00517530·20696e20·00574152·4e494e47·3a205374··in·.WARNING:·St |
| 86 | ··0x0051 | 86 | ··0x00517540·61746573·28732920·00207261·72656c79·ates(s)·.·rarely |
| 87 | ··0x0051 | 87 | ··0x00517550·20617070·65617220·696e2000·57726f6e··appear·in·.Wron |
| 88 | ··0x0051 | 88 | ··0x00517560·67206765·6e657469·6320636f·64652000·g·genetic·code·. |
| 89 | ··0x0051 | 89 | ··0x00517570·7374726c·656e2867·656e6574·69635f63·strlen(genetic_c |
| 90 | ··0x0051 | 90 | ··0x00517580·6f646529·203d3d20·36340042·494e0050·ode)·==·64.BIN.P |
| 91 | ··0x0051 | 91 | ··0x00517590·524f5400·4e543241·41004d4f·52504800·ROT.NT2AA.MORPH. |
| 92 | ··0x0051 | 92 | ··0x005175a0·54494e41·004d554c·54490043·4f444f4e·TINA.MULTI.CODON |
| 93 | ··0x0051 | 93 | ··0x005175b0·00222069·6e737465·61640073·74617465·."·instead.state |
| 94 | ··0x0051 | 94 | ··0x005175c0·3c323300·69735f69·6e766172·69616e74·<23.is_invariant |
| 95 | ··0x0051 | 95 | ··0x005175d0·203e3d20·69735f63·6f6e7374·00456d70··>=·is_const.Emp |
| 96 | ··0x0051 | 96 | ··0x005175e0·69726963·616c2073·74617465·20667265·irical·state·fre |
| 97 | ··0x0051 | 97 | ··0x005175f0·7175656e·63696573·3a200066·61627328·quencies:·.fabs( |
| 98 | ··0x0051 | 98 | ··0x00517600·73756d2d·312e3029·3c31652d·3500556e·sum-1.0)<1e-5.Un |
| 99 | ··0x0051 | 99 | ··0x00517610·73757070·6f727465·6420636f·646f6e20·supported·codon· |
| 100 | ··0x0051 | 100 | ··0x00517620·66726571·75656e63·79006e73·69746520·frequency.nsite· |
| 101 | ··0x0051 | 101 | ··0x00517630·3d3d2072·6566416c·69676e2e·6765744e·==·refAlign.getN |
| 102 | ··0x0051 | 102 | ··0x00517640·53697465·28290073·697a6528·29203d3d·Site().size()·== |
| 103 | ··0x0051 | 103 | ··0x00517650·20706174·7465726e·5f667265·712e7369··pattern_freq.si |
| 104 | ··0x0051 | 104 | ··0x00517660·7a652829·004e4f54·453a204c·696e6520·ze().NOTE:·Line· |
| 105 | ··0x0051 | 105 | ··0x00517670·00626173·69635f73·7472696e·673a3a73·.basic_string::s |
| 106 | ··0x0051 | 106 | ··0x00517680·75627374·72003a20·556e7265·636f676e·ubstr.:·Unrecogn |
| 107 | ··0x0051 | 107 | ··0x00517690·697a6564·20636861·72616374·65722000·ized·character·. |
| 108 | ··0x0051 | 108 | ··0x005176a0·53697465·5f476170·20200053·6974655f·Site_Gap··.Site_ |
| 109 | ··0x0051 | 109 | ··0x005176b0·416d6269·20005369·74652067·61702d63·Ambi·.Site·gap-c |
| 110 | ··0x0051 | 110 | ··0x005176c0·6f756e74·73207072·696e7465·6420746f·ounts·printed·to |
| 111 | ··0x0051 | 111 | ··0x005176d0·2000416c·69676e6d·656e7420·77617320··.Alignment·was· |
| 112 | ··0x0051 | 112 | ··0x005176e0·7072696e·74656420·746f2000·5741524e·printed·to·.WARN |
| 113 | ··0x0051 | 113 | ··0x005176f0·494e473a·20496465·6e746963·616c2073·ING:·Identical·s |
| 114 | ··0x0051 | 114 | ··0x00517700·65717565·6e636573·20006c6f·674c4c2e·equences·.logLL. |
| 115 | ··0x0051 | 115 | ··0x00517710·73697a65·2829203d·3d207061·744e756d·size()·==·patNum |
| 116 | ··0x0051 | 116 | ··0x00517720·00526561·64696e67·20736974·6520706f·.Reading·site·po |
| 117 | ··0x0051 | 117 | ··0x00517730·73697469·6f6e206c·69737420·0052616e·sition·list·.Ran |
| 118 | ··0x0051 | 118 | ··0x00517740·6765206d·75737420·62652070·6f736974·ge·must·be·posit |
| 119 | ··0x0051 | 119 | ··0x00517750·69766500·236e6578·75730062·6567696e·ive.#nexus.begin |
| 120 | ··0x0051 | 120 | ··0x00517760·20646174·613b0020·2064696d·656e7369··data;.··dimensi |
| 121 | ··0x0051 | 121 | ··0x00517770·6f6e7320·6e746178·3d00206e·63686172·ons·ntax=.·nchar |
| 122 | ··0x0051 | 122 | ··0x00517780·3d002020·666f726d·61742064·61746174·=.··format·datat |
| 123 | ··0x0051 | 123 | ··0x00517790·7970653d·006e7563·6c656f74·69646500·ype=.nucleotide. |
| 124 | ··0x0051 | 124 | ··0x005177a0·7374616e·64617264·0070726f·7465696e·standard.protein |
| 125 | ··0x0051 | 125 | ··0x005177b0·00206d69·7373696e·673d3f20·6761703d·.·missing=?·gap= |
| Max diff block lines reached; 5401589/6723758 bytes (80.34%) of diff not shown. | |||
| Offset 1, 3564 lines modified | Offset 1, 3564 lines modified | ||
| Diff chunk too large, falling back to line-by-line diff (3561 lines added, 3561 lines removed) | |||
| 1 | Hex·dump·of·section·'.eh_frame_hdr': | 1 | Hex·dump·of·section·'.eh_frame_hdr': |
| 2 | ··0x005d | 2 | ··0x005db498·011b033b·88de0000·d01b0000·884baaff·...;.........K.. |
| 3 | ··0x005d | 3 | ··0x005db4a8·d0de0000·b85eaaff·f4de0000·e85eaaff·.....^.......^.. |
| 4 | ··0x005d | 4 | ··0x005db4b8·78df0000·9e5faaff·64e70000·9060aaff·x...._..d....`.. |
| 5 | ··0x005d | 5 | ··0x005db4c8·90e70000·8261aaff·bce70000·7a62aaff·.....a......zb.. |
| 6 | ··0x005d | 6 | ··0x005db4d8·e8e70000·7263aaff·60f00000·9463aaff·....rc..`....c.. |
| 7 | ··0x005d | 7 | ··0x005db4e8·d0f00000·c463aaff·f0f00000·8464aaff·.....c.......d.. |
| 8 | ··0x005d | 8 | ··0x005db4f8·28f20000·0665aaff·00f30000·ae65aaff·(....e.......e.. |
| 9 | ··0x005d | 9 | ··0x005db508·20f80000·0c66aaff·5cfa0000·1266aaff··....f..\....f.. |
| 10 | ··0x005d | 10 | ··0x005db518·b0fa0000·f066aaff·6cfb0000·0c67aaff·.....f..l....g.. |
| 11 | ··0x005d | 11 | ··0x005db528·d0fe0000·ad67aaff·a8ff0000·f068aaff·.....g.......h.. |
| 12 | ··0x005d | 12 | ··0x005db538·1c020100·f668aaff·40040100·7c69aaff·.....h..@...|i.. |
| 13 | ··0x005d | 13 | ··0x005db548·b0040100·f86aaaff·14050100·466baaff·.....j......Fk.. |
| 14 | ··0x005d | 14 | ··0x005db558·a4070100·666baaff·08080100·966caaff·....fk.......l.. |
| 15 | ··0x005d | 15 | ··0x005db568·a8090100·9c6caaff·c80a0100·b06caaff·.....l.......l.. |
| 16 | ··0x005d | 16 | ··0x005db578·180c0100·cc6caaff·300f0100·d66caaff·.....l..0....l.. |
| 17 | ··0x005d | 17 | ··0x005db588·04100100·e06caaff·90110100·206daaff·.....l......·m.. |
| 18 | ··0x005d | 18 | ··0x005db598·54120100·486daaff·ec120100·596daaff·T...Hm......Ym.. |
| 19 | ··0x005d | 19 | ··0x005db5a8·9c130100·fe6faaff·64150100·e270aaff·.....o..d....p.. |
| 20 | ··0x005d | 20 | ··0x005db5b8·001a0100·fc72aaff·6c1a0100·6c74aaff·.....r..l...lt.. |
| 21 | ··0x005d | 21 | ··0x005db5c8·d01a0100·fc75aaff·801d0100·1476aaff·.....u.......v.. |
| 22 | ··0x005d | 22 | ··0x005db5d8·d41d0100·6876aaff·301e0100·2e77aaff·....hv..0....w.. |
| 23 | ··0x005d | 23 | ··0x005db5e8·901e0100·f677aaff·f01e0100·e27baaff·.....w.......{.. |
| 24 | ··0x005d | 24 | ··0x005db5f8·5c1f0100·8c7caaff·c01f0100·367daaff·\....|......6}.. |
| 25 | ··0x005d | 25 | ··0x005db608·24200100·767eaaff·d0210100·e081aaff·$·..v~...!...... |
| 26 | ··0x005d | 26 | ··0x005db618·4c220100·7883aaff·2c270100·e086aaff·L"..x...,'...... |
| 27 | ··0x005d | 27 | ··0x005db628·90270100·d889aaff·302d0100·468aaaff·.'......0-..F... |
| 28 | ··0x005d | 28 | ··0x005db638·cc2d0100·5a8caaff·9c2f0100·928caaff·.-..Z..../...... |
| 29 | ··0x005d | 29 | ··0x005db648·e43d0100·fc8caaff·a03f0100·5c8daaff·.=.......?..\... |
| 30 | ··0x005d | 30 | ··0x005db658·74400100·728daaff·58440100·908eaaff·t@..r...XD...... |
| 31 | ··0x005d | 31 | ··0x005db668·24460100·c48faaff·98460100·d690aaff·$F.......F...... |
| 32 | ··0x005d | 32 | ··0x005db678·f4460100·ba92aaff·50470100·2093aaff·.F......PG..·... |
| 33 | ··0x005d | 33 | ··0x005db688·ac470100·f293aaff·08480100·3694aaff·.G.......H..6... |
| 34 | ··0x005d | 34 | ··0x005db698·64480100·fe94aaff·bc480100·9a95aaff·dH.......H...... |
| 35 | ··0x005d | 35 | ··0x005db6a8·1c490100·4e96aaff·78490100·ca9baaff·.I..N...xI...... |
| 36 | ··0x005d | 36 | ··0x005db6b8·104a0100·54a1aaff·b44a0100·70a5aaff·.J..T....J..p... |
| 37 | ··0x005d | 37 | ··0x005db6c8·344b0100·b4acaaff·c84b0100·f8b0aaff·4K.......K...... |
| 38 | ··0x005d | 38 | ··0x005db6d8·544c0100·14b7aaff·e44c0100·48c6aaff·TL.......L..H... |
| 39 | ··0x005d | 39 | ··0x005db6e8·604d0100·44d7aaff·384e0100·60daaaff·`M..D...8N..`... |
| 40 | ··0x005d | 40 | ··0x005db6f8·a04e0100·acdaaaff·004f0100·02dbaaff·.N.......O...... |
| 41 | ··0x005d | 41 | ··0x005db708·744f0100·aedbaaff·d04f0100·38dcaaff·tO.......O..8... |
| 42 | ··0x005d | 42 | ··0x005db718·2c500100·84dcaaff·84500100·fadcaaff·,P.......P...... |
| 43 | ··0x005d | 43 | ··0x005db728·dc500100·2eddaaff·48510100·74dfaaff·.P......HQ..t... |
| 44 | ··0x005d | 44 | ··0x005db738·ac510100·0ee0aaff·08520100·2ee1aaff·.Q.......R...... |
| 45 | ··0x005d | 45 | ··0x005db748·6c520100·30e4aaff·cc520100·5ee4aaff·lR..0....R..^... |
| 46 | ··0x005d | 46 | ··0x005db758·28530100·3ae5aaff·88530100·eae5aaff·(S..:....S...... |
| 47 | ··0x005d | 47 | ··0x005db768·e4530100·3ce6aaff·44540100·8ce6aaff·.S..<...DT...... |
| 48 | ··0x005d | 48 | ··0x005db778·ac540100·58e8aaff·40550100·4beeaaff·.T..X...@U..K... |
| 49 | ··0x005d | 49 | ··0x005db788·98fb0000·81eeaaff·c4290100·08efaaff·.........)...... |
| 50 | ··0x005d | 50 | ··0x005db798·382a0100·8fefaaff·a8360100·16f0aaff·8*.......6...... |
| 51 | ··0x005d | 51 | ··0x005db7a8·9c560100·26f0aaff·8c5b0100·3af0aaff·.V..&....[..:... |
| 52 | ··0x005d | 52 | ··0x005db7b8·e45b0100·4ef0aaff·485f0100·64f0aaff·.[..N...H_..d... |
| 53 | ··0x005d | 53 | ··0x005db7c8·3c650100·8ef0aaff·94650100·b8f0aaff·<e.......e...... |
| 54 | ··0x005d | 54 | ··0x005db7d8·1c6a0100·e2f0aaff·4c6d0100·40f1aaff·.j......Lm..@... |
| 55 | ··0x005d | 55 | ··0x005db7e8·706e0100·9ef1aaff·e46e0100·9af3aaff·pn.......n...... |
| 56 | ··0x005d | 56 | ··0x005db7f8·e46f0100·a4f3aaff·60710100·bcf3aaff·.o......`q...... |
| 57 | ··0x005d | 57 | ··0x005db808·d4770100·caf4aaff·34780100·2ef5aaff·.w......4x...... |
| 58 | ··0x005d | 58 | ··0x005db818·90780100·82f5aaff·ec780100·e6f5aaff·.x.......x...... |
| 59 | ··0x005d | 59 | ··0x005db828·287d0100·f0f5aaff·807d0100·3af6aaff·(}.......}..:... |
| 60 | ··0x005d | 60 | ··0x005db838·d87d0100·86f6aaff·587e0100·8cf6aaff·.}......X~...... |
| 61 | ··0x005d | 61 | ··0x005db848·e87e0100·a0f6aaff·24810100·c6f6aaff·.~......$....... |
| 62 | ··0x005d | 62 | ··0x005db858·b0820100·52f7aaff·04840100·58f7aaff·....R.......X... |
| 63 | ··0x005d | 63 | ··0x005db868·68840100·7ef8aaff·f8870100·96f8aaff·h...~........... |
| 64 | ··0x005d | 64 | ··0x005db878·d0880100·b2f8aaff·c4890100·c6f8aaff·................ |
| 65 | ··0x005d | 65 | ··0x005db888·e08a0100·daf8aaff·c48c0100·f2f8aaff·................ |
| 66 | ··0x005d | 66 | ··0x005db898·4c920100·3cf9aaff·bc920100·50f9aaff·L...<.......P... |
| 67 | ··0x005d | 67 | ··0x005db8a8·08950100·a0f9aaff·1c960100·baf9aaff·................ |
| 68 | ··0x005d | 68 | ··0x005db8b8·e0980100·c0f9aaff·709a0100·caf9aaff·........p....... |
| 69 | ··0x005d | 69 | ··0x005db8c8·c89a0100·48faaaff·289b0100·72faaaff·....H...(...r... |
| 70 | ··0x005d | 70 | ··0x005db8d8·449c0100·bcfaaaff·409d0100·e6faaaff·D.......@....... |
| 71 | ··0x005d | 71 | ··0x005db8e8·9c9d0100·6afbaaff·349f0100·e4fbaaff·....j...4....... |
| 72 | ··0x005d | 72 | ··0x005db8f8·ac9f0100·1cfdaaff·18a00100·ecfdaaff·................ |
| 73 | ··0x005d | 73 | ··0x005db908·7ca00100·bcfeaaff·d8a00100·f6ffaaff·|............... |
| 74 | ··0x005d | 74 | ··0x005db918·40a10100·0601abff·a4a10100·6202abff·@...........b... |
| 75 | ··0x005d | 75 | ··0x005db928·18a20100·6c03abff·bca20100·b003abff·....l........... |
| 76 | ··0x005d | 76 | ··0x005db938·64a30100·f003abff·0ca50100·f603abff·d............... |
| 77 | ··0x005d | 77 | ··0x005db948·c0a80100·fc03abff·dca90100·0605abff·................ |
| 78 | ··0x005d | 78 | ··0x005db958·f4aa0100·f805abff·70ac0100·ba06abff·........p....... |
| 79 | ··0x005d | 79 | ··0x005db968·e8ad0100·7207abff·58ae0100·3808abff·....r...X...8... |
| 80 | ··0x005d | 80 | ··0x005db978·d0ae0100·220babff·a0b10100·3e0babff·....".......>... |
| 81 | ··0x005d | 81 | ··0x005db988·dcb20100·dc0babff·38b30100·f20babff·........8....... |
| 82 | ··0x005d | 82 | ··0x005db998·44b40100·d60cabff·a8b40100·0a0dabff·D............... |
| 83 | ··0x005d | 83 | ··0x005db9a8·6cb50100·b60dabff·e0b50100·9a0eabff·l............... |
| 84 | ··0x005d | 84 | ··0x005db9b8·44b80100·5a0fabff·bcb80100·7410abff·D...Z.......t... |
| 85 | ··0x005d | 85 | ··0x005db9c8·98ba0100·0411abff·e4bb0100·0c11abff·................ |
| 86 | ··0x005d | 86 | ··0x005db9d8·94bc0100·1211abff·e8bc0100·b211abff·................ |
| 87 | ··0x005d | 87 | ··0x005db9e8·e0bd0100·3212abff·3cbe0100·6a13abff·....2...<...j... |
| 88 | ··0x005d | 88 | ··0x005db9f8·98be0100·a214abff·f4be0100·be16abff·................ |
| 89 | ··0x005d | 89 | ··0x005dba08·8cc20100·2a17abff·f8c20100·1818abff·....*........... |
| 90 | ··0x005d | 90 | ··0x005dba18·78c70100·2018abff·1cc90100·5818abff·x...·.......X... |
| 91 | ··0x005d | 91 | ··0x005dba28·68ce0100·4619abff·80cf0100·4c19abff·h...F.......L... |
| 92 | ··0x005d | 92 | ··0x005dba38·f4d10100·7e19abff·d4d30100·9c1aabff·....~........... |
| 93 | ··0x005d | 93 | ··0x005dba48·48d40100·fa1babff·c8d40100·2c1eabff·H...........,... |
| 94 | ··0x005d | 94 | ··0x005dba58·fcd50100·521eabff·70d60100·601fabff·....R...p...`... |
| 95 | ··0x005da | 95 | ··0x005dba68·d4d90100·a21fabff·78da0100·dc1fabff·........x....... |
| 96 | ··0x005d | 96 | ··0x005dba78·74db0100·e21fabff·d4de0100·6820abff·t...........h·.. |
| 97 | ··0x005d | 97 | ··0x005dba88·bce00100·8a20abff·60e20100·e820abff·.....·..`....·.. |
| 98 | ··0x005da9 | 98 | ··0x005dba98·e4e20100·2421abff·78e30100·1c23abff·....$!..x....#.. |
| 99 | ··0x005d | 99 | ··0x005dbaa8·78e60100·6c24abff·9ce70100·dc24abff·x...l$.......$.. |
| 100 | ··0x005d | 100 | ··0x005dbab8·70e80100·3e25abff·dce80100·5827abff·p...>%......X'.. |
| 101 | ··0x005d | 101 | ··0x005dbac8·7ce90100·ce2cabff·b8ea0100·0435abff·|....,.......5.. |
| 102 | ··0x005d | 102 | ··0x005dbad8·6cec0100·9235abff·c4ec0100·f835abff·l....5.......5.. |
| 103 | ··0x005d | 103 | ··0x005dbae8·1ced0100·2a36abff·78ed0100·5e36abff·....*6..x...^6.. |
| 104 | ··0x005d | 104 | ··0x005dbaf8·d4ed0100·bc36abff·3cee0100·3837abff·.....6..<...87.. |
| 105 | ··0x005d | 105 | ··0x005dbb08·98ee0100·a037abff·38ef0100·a637abff·.....7..8....7.. |
| 106 | ··0x005d | 106 | ··0x005dbb18·44f50100·c837abff·14f90100·2638abff·D....7......&8.. |
| 107 | ··0x005d | 107 | ··0x005dbb28·44fb0100·f238abff·b8fb0100·ce39abff·D....8.......9.. |
| 108 | ··0x005d | 108 | ··0x005dbb38·64fd0100·de39abff·ccfd0100·0a3aabff·d....9.......:.. |
| 109 | ··0x005d | 109 | ··0x005dbb48·b0fe0100·103aabff·3c010200·163aabff·.....:..<....:.. |
| 110 | ··0x005d | 110 | ··0x005dbb58·c0030200·1c3aabff·34050200·223aabff·.....:..4...":.. |
| 111 | ··0x005d | 111 | ··0x005dbb68·b4060200·3e3aabff·dc070200·b43aabff·....>:.......:.. |
| 112 | ··0x005d | 112 | ··0x005dbb78·50080200·f43aabff·a8080200·403babff·P....:......@;.. |
| 113 | ··0x005d | 113 | ··0x005dbb88·74090200·6c3babff·d0090200·d83babff·t...l;.......;.. |
| 114 | ··0x005d | 114 | ··0x005dbb98·280a0200·023cabff·a80c0200·1a3cabff·(....<.......<.. |
| 115 | ··0x005d | 115 | ··0x005dbba8·000e0200·343cabff·540e0200·483cabff·....4<..T...H<.. |
| 116 | ··0x005d | 116 | ··0x005dbbb8·700f0200·463dabff·44100200·f63dabff·p...F=..D....=.. |
| 117 | ··0x005d | 117 | ··0x005dbbc8·b0100200·8e3fabff·08110200·ea3fabff·.....?.......?.. |
| 118 | ··0x005d | 118 | ··0x005dbbd8·68110200·9441abff·1c120200·c844abff·h....A.......D.. |
| 119 | ··0x005d | 119 | ··0x005dbbe8·5c130200·d145abff·b4130200·1c46abff·\....E.......F.. |
| 120 | ··0x005d | 120 | ··0x005dbbf8·ec140200·a647abff·54150200·4449abff·.....G..T...DI.. |
| 121 | ··0x005d | 121 | ··0x005dbc08·e0150200·d64aabff·4c160200·6a4cabff·.....J..L...jL.. |
| 122 | ··0x005d | 122 | ··0x005dbc18·b0160200·a84dabff·18190200·f24dabff·.....M.......M.. |
| 123 | ··0x005d | 123 | ··0x005dbc28·60190200·264eabff·b8190200·684eabff·`...&N......hN.. |
| 124 | ··0x005d | 124 | ··0x005dbc38·141a0200·2e4fabff·0c1b0200·fe4fabff·.....O.......O.. |
| 125 | ··0x005d | 125 | ··0x005dbc48·a81c0200·2850abff·041d0200·5250abff·....(P......RP.. |
| Max diff block lines reached; 0/477230 bytes (0.00%) of diff not shown. | |||
| Offset 1, 36866 lines modified | Offset 1, 36866 lines modified | ||
| Diff chunk too large, falling back to line-by-line diff (36863 lines added, 36863 lines removed) | |||
| 1 | Hex·dump·of·section·'.eh_frame': | 1 | Hex·dump·of·section·'.eh_frame': |
| 2 | ··0x005e | 2 | ··0x005e9324·14000000·00000000·017a5200·017c0801·.........zR..|.. |
| 3 | ··0x005e | 3 | ··0x005e9334·1b0c0404·88010708·10000000·1c000000·................ |
| 4 | ··0x005e | 4 | ··0x005e9344·9cf1afff·2c000000·00000000·14000000·....,........... |
| 5 | ··0x005e | 5 | ··0x005e9354·00000000·017a5200·017c0801·1b0c0404·.....zR..|...... |
| 6 | ··0x005e | 6 | ··0x005e9364·88010000·20000000·1c000000·b06ca9ff·....·........l.. |
| 7 | ··0x005e | 7 | ··0x005e9374·30130000·000e0846·0e0c4a0f·0b740478·0......F..J..t.x |
| 8 | ··0x005e | 8 | ··0x005e9384·003f1a3b·2a322422·10000000·40000000·.?.;*2$"....@... |
| 9 | ··0x005e | 9 | ··0x005e9394·bc7fa9ff·18000000·00000000·10000000·................ |
| 10 | ··0x005e | 10 | ··0x005e93a4·54000000·68f6afff·06000000·00000000·T...h........... |
| 11 | ··0x005e | 11 | ··0x005e93b4·1c000000·00000000·017a504c·5200017c·.........zPLR..| |
| 12 | ··0x005e | 12 | ··0x005e93c4·08079b41·6c0b001b·1b0c0404·88010000·...Al........... |
| 13 | ··0x005e | 13 | ··0x005e93d4·38000000·24000000·34f2afff·f7030000·8...$...4....... |
| 14 | ··0x005e | 14 | ··0x005e93e4·0423ff08·00410e08·8502420d·05488703·.#...A....B..H.. |
| 15 | ··0x005e | 15 | ··0x005e93f4·86045283·0502592e·20712e10·0328020a·..R...Y.·q...(.. |
| 16 | ··0x005e | 16 | ··0x005e9404·c341c641·c741c50c·0404460b·1c000000·.A.A.A....F..... |
| 17 | ··0x005e | 17 | ··0x005e9414·60000000·687fa9ff·b6000000·04fdfe08·`...h........... |
| 18 | ··0x005e | 18 | ··0x005e9424·000c0508·83058502·86048703·10000000·................ |
| 19 | ··0x005e | 19 | ··0x005e9434·e4000000·def5afff·04000000·00000000·................ |
| 20 | ··0x005e | 20 | ··0x005e9444·10000000·f8000000·0474b3ff·03000000·.........t...... |
| 21 | ··0x005e | 21 | ··0x005e9454·00000000·10000000·0c010000·0074b3ff·.............t.. |
| 22 | ··0x005e | 22 | ··0x005e9464·0b000000·00000000·10000000·20010000·............·... |
| 23 | ··0x005e | 23 | ··0x005e9474·fc73b3ff·01000000·00000000·10000000·.s.............. |
| 24 | ··0x005e | 24 | ··0x005e9484·34010000·f873b3ff·01000000·00000000·4....s.......... |
| 25 | ··0x005e | 25 | ··0x005e9494·10000000·48010000·f473b3ff·01000000·....H....s...... |
| 26 | ··0x005e | 26 | ··0x005e94a4·00000000·10000000·5c010000·f073b3ff·........\....s.. |
| 27 | ··0x005e | 27 | ··0x005e94b4·01000000·00000000·3c000000·70010000·........<...p... |
| 28 | ··0x005e | 28 | ··0x005e94c4·7cf5afff·d6000000·00410e08·8502410e·|........A....A. |
| 29 | ··0x005e | 29 | ··0x005e94d4·0c870341·0e108604·410e1483·05430e30·...A....A....C.0 |
| 30 | ··0x005e | 30 | ··0x005e94e4·02bf0a0e·1441c30e·1041c60e·0c41c70e·.....A...A...A.. |
| 31 | ··0x005e | 31 | ··0x005e94f4·0841c50e·04460b00·18000000·b0010000·.A...F.......... |
| 32 | ··0x005e | 32 | ··0x005e9504·1cf6afff·32000000·00410e08·830270c3·....2....A....p. |
| 33 | ··0x005e | 33 | ··0x005e9514·0e040000·80000000·cc010000·9073b3ff·.............s.. |
| 34 | ··0x005e | 34 | ··0x005e9524·ab000000·00410e08·8602410e·0c83034e·.....A....A....N |
| 35 | ··0x005e | 35 | ··0x005e9534·0e1c470e·20460e1c·470e1841·0e1c410e·..G.·F..G..A..A. |
| 36 | ··0x005e | 36 | ··0x005e9544·20460e1c·410e1844·0e1c410e·20460e1c··F..A..D..A.·F.. |
| 37 | ··0x005e | 37 | ··0x005e9554·410e1847·0e1c410e·20460e1c·410e1844·A..G..A.·F..A..D |
| 38 | ··0x005e | 38 | ··0x005e9564·0e1c410e·20460e1c·470e1841·0e1c410e·..A.·F..G..A..A. |
| 39 | ··0x005e | 39 | ··0x005e9574·20480e14·440e1844·0e1c410e·20460e1c··H..D..D..A.·F.. |
| 40 | ··0x005e | 40 | ··0x005e9584·410e1847·0e1c410e·204e0e1c·410e1846·A..G..A.·N..A..F |
| 41 | ··0x005e | 41 | ··0x005e9594·0e1c410e·20000000·20000000·50020000·..A.·...·...P... |
| 42 | ··0x005e | 42 | ··0x005e95a4·bc73b3ff·26000000·00410e08·83024e0e·.s..&....A....N. |
| 43 | ··0x005e | 43 | ··0x005e95b4·1c4d0e20·480e0841·c30e0400·28000000·.M.·H..A....(... |
| 44 | ··0x005e | 44 | ··0x005e95c4·74020000·c873b3ff·30000000·00410e08·t....s..0....A.. |
| 45 | ··0x005e | 45 | ··0x005e95d4·8602410e·0c83034e·0e1c4d0e·20500e0c·..A....N..M.·P.. |
| 46 | ··0x005e | 46 | ··0x005e95e4·41c30e08·41c60e04·2c000000·a0020000·A...A...,....... |
| 47 | ··0x005e | 47 | ··0x005e95f4·cc73b3ff·67000000·00410e08·8602410e·.s..g....A....A. |
| 48 | ··0x005e | 48 | ··0x005e9604·0c83034e·0e18720e·1c410e20·610e0c41·...N..r..A.·a..A |
| 49 | ··0x005e | 49 | ··0x005e9614·c30e0841·c60e0400·20000000·d0020000·...A....·....... |
| 50 | ··0x005e | 50 | ··0x005e9624·ec74b3ff·26000000·00410e08·83024e0e·.t..&....A....N. |
| 51 | ··0x005e | 51 | ··0x005e9634·1c4d0e20·480e0841·c30e0400·28000000·.M.·H..A....(... |
| 52 | ··0x005e | 52 | ··0x005e9644·f4020000·f874b3ff·30000000·00410e08·.....t..0....A.. |
| 53 | ··0x005e | 53 | ··0x005e9654·8602410e·0c83034e·0e1c4d0e·20500e0c·..A....N..M.·P.. |
| 54 | ··0x005e | 54 | ··0x005e9664·41c30e08·41c60e04·20000000·20030000·A...A...·...·... |
| 55 | ··0x005e | 55 | ··0x005e9674·fc74b3ff·26000000·00410e08·83024e0e·.t..&....A....N. |
| 56 | ··0x005e | 56 | ··0x005e9684·1c4d0e20·480e0841·c30e0400·28000000·.M.·H..A....(... |
| 57 | ··0x005e | 57 | ··0x005e9694·44030000·0875b3ff·30000000·00410e08·D....u..0....A.. |
| 58 | ··0x005e | 58 | ··0x005e96a4·8602410e·0c83034e·0e1c4d0e·20500e0c·..A....N..M.·P.. |
| 59 | ··0x005e | 59 | ··0x005e96b4·41c30e08·41c60e04·74000000·70030000·A...A...t...p... |
| 60 | ··0x005e | 60 | ··0x005e96c4·9cf4afff·a7010000·00410e08·8702410e·.........A....A. |
| 61 | ··0x005e | 61 | ··0x005e96d4·0c860345·0e108304·024d0e18·4a0e1c41·...E.....M..J..A |
| 62 | ··0x005e | 62 | ··0x005e96e4·0e20480e·10520ac3·0e0c43c6·0e0841c7·.·H..R....C...A. |
| 63 | ··0x005e | 63 | ··0x005e96f4·0e04430b·530ac30e·0c44c60e·0841c70e·..C.S....D...A.. |
| 64 | ··0x005e | 64 | ··0x005e9704·04480b5b·0e184a0e·1c410e20·480e1054·.H.[..J..A.·H..T |
| 65 | ··0x005e | 65 | ··0x005e9714·0ac30e0c·41c60e08·41c70e04·4c0b460a·....A...A...L.F. |
| 66 | ··0x005e | 66 | ··0x005e9724·c30e0c41·c60e0843·c70e0446·0b000000·...A...C...F.... |
| 67 | ··0x005e | 67 | ··0x005e9734·20000000·e8030000·d4f5afff·38000000··...........8... |
| 68 | ··0x005e | 68 | ··0x005e9744·00410e08·8302630a·c30e044c·0b47c30e·.A....c....L.G.. |
| 69 | ··0x005e | 69 | ··0x005e9754·04000000·24000000·0c040000·f0f5afff·....$........... |
| 70 | ··0x005e | 70 | ··0x005e9764·2e000000·00410e08·83024e0e·10470e14·.....A....N..G.. |
| 71 | ··0x005e | 71 | ··0x005e9774·4b0e1841·0e1c470e·20000000·24000000·K..A..G.·...$... |
| 72 | ··0x005e | 72 | ··0x005e9784·34040000·f8f5afff·2e000000·00410e08·4............A.. |
| 73 | ··0x005e | 73 | ··0x005e9794·83024e0e·10470e14·4b0e1841·0e1c470e·..N..G..K..A..G. |
| 74 | ··0x005e | 74 | ··0x005e97a4·20000000·24000000·5c040000·00f6afff··...$...\....... |
| 75 | ··0x005e | 75 | ··0x005e97b4·2e000000·00410e08·83024e0e·10470e14·.....A....N..G.. |
| 76 | ··0x005e | 76 | ··0x005e97c4·4b0e1841·0e1c470e·20000000·24000000·K..A..G.·...$... |
| 77 | ··0x005e | 77 | ··0x005e97d4·84040000·08f6afff·2e000000·00410e08·.............A.. |
| 78 | ··0x005e | 78 | ··0x005e97e4·83024e0e·10470e14·4b0e1841·0e1c470e·..N..G..K..A..G. |
| 79 | ··0x005e | 79 | ··0x005e97f4·20000000·24000000·ac040000·10f6afff··...$........... |
| 80 | ··0x005e | 80 | ··0x005e9804·2e000000·00410e08·83024e0e·10470e14·.....A....N..G.. |
| 81 | ··0x005e | 81 | ··0x005e9814·4b0e1841·0e1c470e·20000000·60000000·K..A..G.·...`... |
| 82 | ··0x005e8 | 82 | ··0x005e9824·d4040000·d873b3ff·34020000·00410e08·.....s..4....A.. |
| 83 | ··0x005e | 83 | ··0x005e9834·8502410e·0c870341·0e108604·410e1483·..A....A....A... |
| 84 | ··0x005e | 84 | ··0x005e9844·054e0e60·03a9010a·0e1441c3·0e1041c6·.N.`......A...A. |
| 85 | ··0x005e | 85 | ··0x005e9854·0e0c41c7·0e0841c5·0e04410b·02500a0e·..A...A...A..P.. |
| 86 | ··0x005e | 86 | ··0x005e9864·1441c30e·1041c60e·0c41c70e·0841c50e·.A...A...A...A.. |
| 87 | ··0x005e87 | 87 | ··0x005e9874·04410b47·0e644b0e·68410e6c·470e7000·.A.G.dK.hA.lG.p. |
| 88 | ··0x005e | 88 | ··0x005e9884·58000000·38050000·b475b3ff·b3080000·X...8....u...... |
| 89 | ··0x005e | 89 | ··0x005e9894·00410e08·8502410e·0c870341·0e108604·.A....A....A.... |
| 90 | ··0x005e | 90 | ··0x005e98a4·4c0e1483·05460ee0·0103ca04·0a0e1441·L....F.........A |
| 91 | ··0x005e | 91 | ··0x005e98b4·c30e1041·c60e0c41·c70e0841·c50e0445·...A...A...A...E |
| 92 | ··0x005e | 92 | ··0x005e98c4·0b038a03·0a0e1441·c30e1041·c60e0c41·.......A...A...A |
| 93 | ··0x005e | 93 | ··0x005e98d4·c70e0841·c50e0441·0b000000·60000000·...A...A....`... |
| 94 | ··0x005e | 94 | ··0x005e98e4·94050000·58f5afff·6b010000·00410e08·....X...k....A.. |
| 95 | ··0x005e | 95 | ··0x005e98f4·8502410e·0c870341·0e108604·4c0e1483·..A....A....L... |
| 96 | ··0x005e | 96 | ··0x005e9904·05430e30·02b70a0e·1441c30e·1041c60e·.C.0.....A...A.. |
| 97 | ··0x005e | 97 | ··0x005e9914·0c41c70e·0841c50e·04430b02·6e0a0e14·.A...A...C..n... |
| 98 | ··0x005e | 98 | ··0x005e9924·41c30e10·41c60e0c·41c70e08·41c50e04·A...A...A...A... |
| 99 | ··0x005e | 99 | ··0x005e9934·410b500e·344b0e38·410e3c47·0e400000·A.P.4K.8A.<G.@.. |
| 100 | ··0x005e | 100 | ··0x005e9944·4c000000·f8050000·64f6afff·8c020000·L.......d....... |
| 101 | ··0x005e | 101 | ··0x005e9954·00410e08·8502410e·0c870341·0e108604·.A....A....A.... |
| 102 | ··0x005e | 102 | ··0x005e9964·410e1483·054e0e70·03e5010a·0e1441c3·A....N.p......A. |
| 103 | ··0x005e | 103 | ··0x005e9974·0e1041c6·0e0c41c7·0e0841c5·0e04450b·..A...A...A...E. |
| 104 | ··0x005e | 104 | ··0x005e9984·02740e74·4b0e7841·0e7c470e·80010000·.t.tK.xA.|G..... |
| 105 | ··0x005e | 105 | ··0x005e9994·2c000000·48060000·a4f8afff·ca050000·,...H........... |
| 106 | ··0x005e | 106 | ··0x005e99a4·00410e08·8302510e·e803035d·040a0e08·.A....Q....].... |
| 107 | ··0x005e | 107 | ··0x005e99b4·41c30e04·500b033e·010e0841·c30e0400·A...P..>...A.... |
| 108 | ··0x005e | 108 | ··0x005e99c4·5c000000·78060000·44feafff·a7000000·\...x...D....... |
| 109 | ··0x005e | 109 | ··0x005e99d4·00410e08·8502430e·0c870343·0e108604·.A....C....C.... |
| 110 | ··0x005e | 110 | ··0x005e99e4·430e1483·054e0e30·02400a0e·1441c30e·C....N.0.@...A.. |
| 111 | ··0x005e | 111 | ··0x005e99f4·1041c60e·0c41c70e·0841c50e·04440b53·.A...A...A...D.S |
| 112 | ··0x005e | 112 | ··0x005e9a04·0e34420e·38450e3c·410e404c·0e30480e·.4B.8E.<A.@L.0H. |
| 113 | ··0x005e | 113 | ··0x005e9a14·34410e38·410e3c41·0e404e0e·30000000·4A.8A.<A.@N.0... |
| 114 | ··0x005e | 114 | ··0x005e9a24·50000000·d8060000·94feafff·9a000000·P............... |
| 115 | ··0x005e | 115 | ··0x005e9a34·00410e08·8702410e·0c860341·0e108304·.A....A....A.... |
| 116 | ··0x005e | 116 | ··0x005e9a44·02400e18·420e1c41·0e204c0e·10540ac3·.@..B..A.·L..T.. |
| 117 | ··0x005e | 117 | ··0x005e9a54·0e0c41c6·0e0841c7·0e04480b·430e1c41·..A...A...H.C..A |
| 118 | ··0x005e | 118 | ··0x005e9a64·0e20450e·10470e14·480e1841·0e1c470e·.·E..G..H..A..G. |
| 119 | ··0x005e | 119 | ··0x005e9a74·20480e10·40000000·2c070000·e0feafff··H..@...,....... |
| 120 | ··0x005e | 120 | ··0x005e9a84·83090000·00410e08·8502410e·0c870341·.....A....A....A |
| 121 | ··0x005e | 121 | ··0x005e9a94·0e108604·410e1483·05480ec0·03030609·....A....H...... |
| 122 | ··0x005e | 122 | ··0x005e9aa4·0a0e1441·c30e1041·c60e0c41·c70e0841·...A...A...A...A |
| 123 | ··0x005e | 123 | ··0x005e9ab4·c50e044a·0b000000·78000000·70070000·...J....x...p... |
| 124 | ··0x005e | 124 | ··0x005e9ac4·2c08b0ff·44040000·00410e08·8502410e·,...D....A....A. |
| 125 | ··0x005e | 125 | ··0x005e9ad4·0c870341·0e108604·4c0e1483·05430e88·...A....L....C.. |
| Max diff block lines reached; 0/4939684 bytes (0.00%) of diff not shown. | |||
| Offset 1, 7800 lines modified | Offset 1, 7800 lines modified | ||
| Diff chunk too large, falling back to line-by-line diff (7797 lines added, 7797 lines removed) | |||
| 1 | Hex·dump·of·section·'.gcc_except_table': | 1 | Hex·dump·of·section·'.gcc_except_table': |
| 2 | ··0x0067 | 2 | ··0x00679308·ffff0112·7605e007·00a7010d·f00700cb·....v........... |
| 3 | ··0x0067 | 3 | ··0x00679318·01ff05eb·0700ffff·01110c16·2c006905·............,.i. |
| 4 | ··0x0067 | 4 | ··0x00679328·00007a05·2c00a201·050000ff·ff0110bd·..z.,........... |
| 5 | ··0x0067 | 5 | ··0x00679338·01050000·c80103d0·0100ec01·050000ff·................ |
| 6 | ··0x0067 | 6 | ··0x00679348·ff0110bd·01050000·c80103d0·0100ec01·................ |
| 7 | ··0x0067 | 7 | ··0x00679358·050000ff·ff0110bd·01050000·c80103d0·................ |
| 8 | ··0x0067 | 8 | ··0x00679368·0100f201·050000ff·ff0110bd·01050000·................ |
| 9 | ··0x0067 | 9 | ··0x00679378·c80103d0·0100f201·050000ff·ff0100ff·................ |
| 10 | ··0x0067 | 10 | ··0x00679388·ff0100ff·ff0100ff·ff0100ff·ff0100ff·................ |
| 11 | ··0x0067 | 11 | ··0x00679398·ff0100ff·ff0100ff·ff0100ff·ff0100ff·................ |
| 12 | ··0x0067 | 12 | ··0x006793a8·ff0100ff·ff0100ff·ff0100ff·ff0100ff·................ |
| 13 | ··0x0067 | 13 | ··0x006793b8·ff0100ff·ff0100ff·ff0100ff·ff0100ff·................ |
| 14 | ··0x0067 | 14 | ··0x006793c8·ff0100ff·ff0100ff·ff0100ff·ff0100ff·................ |
| 15 | ··0x0067 | 15 | ··0x006793d8·ff0100ff·ff0100ff·ff010000·ff9b1501·................ |
| 16 | ··0x0067 | 16 | ··0x006793e8·0dda01e2·010000f9·03c201bb·05010100·................ |
| 17 | ··0x0067 | 17 | ··0x006793f8·00000000·ff9b1101·0818051d·002b0500·.............+.. |
| 18 | ··0x0067 | 18 | ··0x00679408·00010000·00000000·ffff010a·3e5ea901·............>^.. |
| 19 | ··0x0067 | 19 | ··0x00679418·00bb0105·00000000·ff9b0d01·05670589·.............g.. |
| 20 | ··0x0067 | 20 | ··0x00679428·02010100·00000000·ff9b0d01·05670591·.............g.. |
| 21 | ··0x0067 | 21 | ··0x00679438·02010100·00000000·ff9b2901·1c8d01a5·..........)..... |
| 22 | ··0x0067 | 22 | ··0x00679448·010000fe·0205e704·01ad0305·0000de03·................ |
| 23 | ··0x0067 | 23 | ··0x00679458·05e20401·dd040500·00010000·7d000000·............}... |
| 24 | ··0x0067 | 24 | ··0x00679468·00000000·ff9b2501·18540559·03780584·......%..T.Y.x.. |
| 25 | ··0x0067 | 25 | ··0x00679478·01007f05·96010091·01050000·a3010500·................ |
| 26 | ··0x0067 | 26 | ··0x00679488·00010000·7d000000·00000000·ff9b1101·....}........... |
| 27 | ··0x0067 | 27 | ··0x00679498·09310500·005405c0·07010100·00000000·.1...T.......... |
| 28 | ··0x0067 | 28 | ··0x006794a8·ff9b1101·08290533·00530500·00010000·.....).3.S...... |
| 29 | ··0x0067 | 29 | ··0x006794b8·00000000·ffff0121·5c200000·ae03539b·.......!\·....S. |
| 30 | ··0x0067 | 30 | ··0x006794c8·0800a704·05960800·8805058c·0800c905·................ |
| 31 | ··0x0067 | 31 | ··0x006794d8·05850800·80080500·00ffff01·13460500·.............F.. |
| 32 | ··0x0067 | 32 | ··0x006794e8·0068056d·00a10105·4b00bf01·17d60100·.h.m....K....... |
| 33 | ··0x0067 | 33 | ··0x006794f8·ffff011d·83010500·00e40156·ff0500dc·...........V.... |
| 34 | ··0x0067 | 34 | ··0x00679508·02058b06·00af0305·84060097·04e30100·................ |
| 35 | ··0x0067 | 35 | ··0x00679518·00ffff01·1219055a·00440500·008a0105·.......Z.D...... |
| 36 | ··0x0067 | 36 | ··0x00679528·1e009c01·055a00ff·ff013081·02d60200·.....Z....0..... |
| 37 | ··0x0067 | 37 | ··0x00679538·00f00405·c01600a3·0505bb16·00b40605·................ |
| 38 | ··0x0067 | 38 | ··0x00679548·b41600c0·0705af16·00970905·aa16008d·................ |
| 39 | ··0x0067 | 39 | ··0x00679558·0a05c716·00d10c05·aa1600ff·ff011420·...............· |
| 40 | ··0x0067 | 40 | ··0x00679568·05950200·4e058101·007c0591·02008c02·....N....|...... |
| 41 | ··0x0067 | 41 | ··0x00679578·050000ff·ff0125a0·01b302ed·0e00ac04·......%......... |
| 42 | ··0x0067 | 42 | ··0x00679588·05fb0e00·d60505ed·0e00eb05·05f40e00·................ |
| 43 | ··0x0067 | 43 | ··0x00679598·fc0640ed·0e00f808·05fb0e00·ffff0108·..@............. |
| 44 | ··0x0067 | 44 | ··0x006795a8·3f050000·7b050100·ffff0135·49180000·?...{......5I... |
| 45 | ··0x0067 | 45 | ··0x006795b8·fa0117fa·0a00b502·05f50a00·840352fa·..............R. |
| 46 | ··0x0067 | 46 | ··0x006795c8·0a00fa03·05f00a00·e904ae03·fa0a00d4·................ |
| 47 | ··0x0067 | 47 | ··0x006795d8·0850e30a·00a90905·e80a00e6·096dfa0a·.P...........m.. |
| 48 | ··0x0067 | 48 | ··0x006795e8·00ffff01·2c162040·00840105·0000a101·....,.·@........ |
| 49 | ··0x0067 | 49 | ··0x006795f8·05e30100·bc0105fa·0100d401·05000092·................ |
| 50 | ··0x0067 | 50 | ··0x00679608·0216fa01·00ca0205·f60200e7·0205fa01·................ |
| 51 | ··0x0067 | 51 | ··0x00679618·00000000·ff9b1901·11bd011f·0000e602·................ |
| 52 | ··0x0067 | 52 | ··0x00679628·05f30501·8f03e402·00000100·78710200·............xq.. |
| 53 | ··0x0067 | 53 | ··0x00679638·ff9b1501·0c1f053c·00271500·00490500·.......<.'...I.. |
| 54 | ··0x0067 | 54 | ··0x00679648·00010000·60710200·ff9b3101·24800305·....`q....1.$... |
| 55 | ··0x0067 | 55 | ··0x00679658·c30801d8·0372e508·03870505·c30801df·.....r.......... |
| 56 | ··0x0067 | 56 | ··0x00679668·0572db08·03f80605·c30801d0·076ed108·.r...........n.. |
| 57 | ··0x0067 | 57 | ··0x00679678·037f0000·7d000000·2c710200·01000000·....}...,q...... |
| 58 | ··0x0067 | 58 | ··0x00679688·ff9b2901·1d19051e·034b0500·006e051e·..)......K...n.. |
| 59 | ··0x0067 | 59 | ··0x00679698·03860105·0000b301·23e00103·fe0123ab·........#.....#. |
| 60 | ··0x0067 | 60 | ··0x006796a8·02037f00·007d0000·fc700200·0100ffff·.....}...p...... |
| 61 | ··0x0067 | 61 | ··0x006796b8·01127add·020000e6·03ab01d2·0500c105·..z............. |
| 62 | ··0x0067 | 62 | ··0x006796c8·05cb0500·ffff0135·1f059405·00350590·.......5.....5.. |
| 63 | ··0x0067 | 63 | ··0x006796d8·05004705·98050075·05a40400·cc012d00·..G....u......-. |
| 64 | ··0x0067 | 64 | ··0x006796e8·00900205·f70200a7·0205b303·00ed0246·...............F |
| 65 | ··0x0067 | 65 | ··0x006796f8·0000e803·05ed0300·9a047100·00ffff01·..........q..... |
| 66 | ··0x0067 | 66 | ··0x00679708·2ab50105·c8060095·0305d606·00f20405·*............... |
| 67 | ··0x0067 | 67 | ··0x00679718·cf0600aa·0605d606·00b90605·cf0600be·................ |
| 68 | ··0x0067 | 68 | ··0x00679728·0605d606·00c30605·cf0600ff·ff01058f·................ |
| 69 | ··0x0067 | 69 | ··0x00679738·01050000·ffff0134·93060586·07009806·.......4........ |
| 70 | ··0x0067 | 70 | ··0x00679748·0500009d·0605a706·00a20605·ab0600e8·................ |
| 71 | ··0x0067 | 71 | ··0x00679758·06050000·ed0605ab·0600f206·05860700·................ |
| 72 | ··0x0067 | 72 | ··0x00679768·f7060a8a·07008107·05a70600·ff9b3901·..............9. |
| 73 | ··0x0067 | 73 | ··0x00679778·26ac0105·ea0d03e0·0105d40d·03ee0105·&............... |
| 74 | ··0x0067 | 74 | ··0x00679788·fc0d0386·02a307e0·0d03c909·05db0d05·................ |
| 75 | ··0x0067 | 75 | ··0x00679798·e20ae502·e00d0301·00007d02·00000000·..........}..... |
| 76 | ··0x0067 | 76 | ··0x006797a8·00000000·04700200·ff9b2901·1918335a·.....p....)...3Z |
| 77 | ··0x0067 | 77 | ··0x006797b8·03df0105·e503008f·02055a03·a203225a·..........Z..."Z |
| 78 | ··0x0067 | 78 | ··0x006797c8·03d6033e·00000100·007d0200·00000000·...>.....}...... |
| 79 | ··0x0067 | 79 | ··0x006797d8·d86f0200·ff9b3501·24b00105·ba0503dc·.o....5.$....... |
| 80 | ··0x0067 | 80 | ··0x006797e8·01059f05·03ea0105·8e050387·0264ad05·.............d.. |
| 81 | ··0x0067 | 81 | ··0x006797f8·03b10305·a80505c3·0436ad05·03010000·.........6...... |
| 82 | ··0x0067 | 82 | ··0x00679808·7d020000·00000000·a06f0200·ff9b1d01·}........o...... |
| 83 | ··0x0067 | 83 | ··0x00679818·0bcd0105·b70200b2·02340000·0100007d·.........4.....} |
| 84 | ··0x0067 | 84 | ··0x00679828·02000000·00000000·806f0200·ff9b3901·.........o....9. |
| 85 | ··0x0067 | 85 | ··0x00679838·26c20105·bb0803ee·0105b208·03fc0105·&............... |
| 86 | ··0x0067 | 86 | ··0x00679848·a1080399·02c602c8·08039705·059c0805·................ |
| 87 | ··0x0067 | 87 | ··0x00679858·ac06e301·c8080301·00007d02·00000000·..........}..... |
| 88 | ··0x0067 | 88 | ··0x00679868·00000000·446f0200·ff9b2101·11e50105·....Do....!..... |
| 89 | ··0x006787 | 89 | ··0x00679878·dc020091·02059b02·03d20239·00000100·...........9.... |
| 90 | ··0x0067 | 90 | ··0x00679888·007d0200·00000000·206f0200·ffff0115·.}......·o...... |
| 91 | ··0x0067 | 91 | ··0x00679898·3a03ec01·004d03e8·01008a01·16e10100·:....M.......... |
| 92 | ··0x0067 | 92 | ··0x006798a8·85020500·00ffff01·15320500·00810103·.........2...... |
| 93 | ··0x0067 | 93 | ··0x006798b8·d50100c3·0105d701·00ff0118·0000ffff·................ |
| 94 | ··0x0067 | 94 | ··0x006798c8·01153205·00008101·03d50100·c30105d7·..2............. |
| 95 | ··0x0067 | 95 | ··0x006798d8·0100ff01·180000ff·ff011532·05000081·...........2.... |
| 96 | ··0x0067 | 96 | ··0x006798e8·0103d501·00c30105·d70100f9·01180000·................ |
| 97 | ··0x0067 | 97 | ··0x006798f8·ffff0115·32050000·810103d5·0100c301·....2........... |
| 98 | ··0x0067 | 98 | ··0x00679908·05d70100·f9011800·00ffff01·13e603f0·................ |
| 99 | ··0x0067 | 99 | ··0x00679918·03ad0900·fc0705a6·0900f608·30ad0900·............0... |
| 100 | ··0x0067 | 100 | ··0x00679928·ffff0108·0f054e00·44050000·ffff011e·......N.D....... |
| 101 | ··0x0067 | 101 | ··0x00679938·91010599·0900c201·05940900·950305a0·................ |
| 102 | ··0x0067 | 102 | ··0x00679948·0900c204·05ac0900·820732a7·0900ffff·..........2..... |
| 103 | ··0x0067 | 103 | ··0x00679958·010e3405·00005105·0a008201·05870100·..4...Q......... |
| 104 | ··0x0067 | 104 | ··0x00679968·ffff0124·c10205e5·0a00fc03·05d40a00·...$............ |
| 105 | ··0x0067 | 105 | ··0x00679978·b20635e0·0a00d708·05c60a00·860905db·..5............. |
| 106 | ··0x0067 | 106 | ··0x00679988·0a00810a·45cd0a00·ffff010f·20053700·....E.......·.7. |
| 107 | ··0x0067 | 107 | ··0x00679998·94010500·00b10105·c3010000·ff9b6901·..............i. |
| 108 | ··0x0067 | 108 | ··0x006799a8·50a70272·0000e704·059b1405·990505a8·P..r............ |
| 109 | ··0x0067 | 109 | ··0x006799b8·1405ac05·05af1405·c905aa04·c01405b4·................ |
| 110 | ··0x0067 | 110 | ··0x006799c8·0a059614·07d30c05·0000860d·3ac01405·............:... |
| 111 | ··0x0067 | 111 | ··0x006799d8·ad104a00·00901105·c01405c3·11050000·..J............. |
| 112 | ··0x0067 | 112 | ··0x006799e8·ad12058f·1400ab13·05c01405·f0130500·................ |
| 113 | ··0x0067 | 113 | ··0x006799f8·00020001·7d007d03·00000000·00000000·....}.}......... |
| 114 | ··0x0067 | 114 | ··0x00679a08·ac6d0200·a46d0200·ff9b3d01·271c9a01·.m...m....=.'... |
| 115 | ··0x0067 | 115 | ··0x00679a18·00008b03·050000a2·0405d304·00860505·................ |
| 116 | ··0x0067 | 116 | ··0x00679a28·00009f05·05c80500·ef050500·008b06cd·................ |
| 117 | ··0x0067 | 117 | ··0x00679a38·01900305·0200017d·007d0300·00000000·.......}.}...... |
| 118 | ··0x0067 | 118 | ··0x00679a48·6c6d0200·646d0200·ffff0119·56059507·lm..dm......V... |
| 119 | ··0x0067 | 119 | ··0x00679a58·00910185·039c0700·a40405a6·0700fd04·................ |
| 120 | ··0x0067 | 120 | ··0x00679a68·85029c07·00ffff01·0c0f054e·00440500·...........N.D.. |
| 121 | ··0x0067 | 121 | ··0x00679a78·0070194e·00ffff01·194d05b7·05009f01·.p.N.....M...... |
| 122 | ··0x0067 | 122 | ··0x00679a88·c701b205·00f40205·ab0500c9·03cd01b2·................ |
| 123 | ··0x0067 | 123 | ··0x00679a98·0500ffff·010c0f05·59004f05·00007b19·........Y.O...{. |
| 124 | ··0x0067 | 124 | ··0x00679aa8·5900ffff·01195605·ba0f0089·01e806b5·Y.....V......... |
| 125 | ··0x0067 | 125 | ··0x00679ab8·0f00fd07·05c10f00·b608f506·b50f00ff·................ |
| Max diff block lines reached; 0/1044836 bytes (0.00%) of diff not shown. | |||
| Offset 1, 6 lines modified | Offset 1, 6 lines modified | ||
| 1 | Hex·dump·of·section·'.init_array': | 1 | Hex·dump·of·section·'.init_array': |
| 2 | ··0x0069 | 2 | ··0x0069812c·00860e00·b0460e00·40480e00·506e0e00·.....F..@H..Pn.. |
| 3 | ··0x0069 | 3 | ··0x0069813c·70700e00·90720e00·60750e00·80770e00·pp...r..`u...w.. |
| 4 | ··0x0069 | 4 | ··0x0069814c·507a0e00·c07d0e00·807f0e00·c0830e00·Pz...}.......... |
| Offset 1, 4 lines modified | Offset 1, 4 lines modified | ||
| 1 | Hex·dump·of·section·'.fini_array': | 1 | Hex·dump·of·section·'.fini_array': |
| 2 | ··0x0069 | 2 | ··0x0069815c·b0850e00····························.... |
| Offset 1, 1917 lines modified | Offset 1, 1917 lines modified | ||
| Diff chunk too large, falling back to line-by-line diff (915 lines added, 1171 lines removed) | |||
| 1 | Hex·dump·of·section·'.data.rel.ro': | 1 | Hex·dump·of·section·'.data.rel.ro': |
| 2 | ··0x0069 | 2 | ··0x00698160·00000000·d88a6900·60091200·90091200·......i.`....... |
| 3 | ··0x0069 | 3 | ··0x00698170·a0081200·9c816900·3c8c6900·508c6900·......i.<.i.P.i. |
| 4 | ··0x0069 | 4 | ··0x00698180·148c6900·288c6900·c4816900·b0816900·..i.(.i...i...i. |
| 5 | ··0x0069 | 5 | ··0x00698190·64010000·00000000·e48a6900·c0091200·d.........i..... |
| 6 | ··0x0069 | 6 | ··0x006981a0·20171200·08000000·a4feffff·e48a6900··.............i. |
| 7 | ··0x0069 | 7 | ··0x006981b0·a00a1200·a0171200·9cfeffff·9cfeffff·................ |
| 8 | ··0x0069 | 8 | ··0x006981c0·e48a6900·300a1200·10181200·00000000·..i.0........... |
| 9 | ··0x0069 | 9 | ··0x006981d0·308e6900·c0021300·00031300·1c826900·0.i...........i. |
| 10 | ··0x0069 | 10 | ··0x006981e0·208f6900·e48e6900·bc8e6900·d08e6900··.i...i...i...i. |
| 11 | ··0x0069 | 11 | ··0x006981f0·948e6900·a88e6900·0c8f6900·f88e6900·..i...i...i...i. |
| 12 | ··0x0069 | 12 | ··0x00698200·488f6900·348f6900·44826900·30826900·H.i.4.i.D.i.0.i. |
| 13 | ··0x0069 | 13 | ··0x00698210·48000000·00000000·488e6900·60231500·H.......H.i.`#.. |
| 14 | ··0x0069 | 14 | ··0x00698220·c0241500·40000000·f8ffffff·488e6900·.$..@.......H.i. |
| 15 | ··0x0069 | 15 | ··0x00698230·b0221500·70251500·b8ffffff·b8ffffff·."..p%.......... |
| 16 | ··0x0069 | 16 | ··0x00698240·488e6900·10241500·20261500·00000000·H.i..$..·&...... |
| 17 | ··0x0069 | 17 | ··0x00698250·90966900·90c91a00·30b51a00·a0b51a00·..i.....0....... |
| 18 | ··0x0069 | 18 | ··0x00698260·c0b41a00·c0b71a00·d0b61a00·d0b41a00·................ |
| 19 | ··0x0069 | 19 | ··0x00698270·a0b61a00·e0b41a00·20b61a00·00000000·........·....... |
| 20 | ··0x0069 | 20 | ··0x00698280·98966900·60bc1900·90791a00·d08b1900·..i.`....y...... |
| 21 | ··0x0069 | 21 | ··0x00698290·d08c1900·10631900·60631900·30621900·.....c..`c..0b.. |
| 22 | ··0x0069 | 22 | ··0x006982a0·f0701900·806d1900·90d01900·d0f51900·.p...m.......... |
| 23 | ··0x0069 | 23 | ··0x006982b0·a0651a00·d0f11900·40601900·30201500·.e......@`..0·.. |
| 24 | ··0x0069 | 24 | ··0x006982c0·d0601900·00e51900·40201500·40af1900·.`......@·..@... |
| 25 | ··0x0069 | 25 | ··0x006982d0·00000000·c0966900·80ce1a00·10cf1a00·......i......... |
| 26 | ··0x0069 | 26 | ··0x006982e0·10601b00·00000000·d8966900·b06c1b00·.`........i..l.. |
| 27 | ··0x0069 | 27 | ··0x006982f0·206d1b00·206c1b00·606a1b00·006a1b00··m..·l..`j...j.. |
| 28 | ··0x0069 | 28 | ··0x00698300·00000000·e0966900·00841b00·e0831b00·......i......... |
| 29 | ··0x0069 | 29 | ··0x00698310·a0831b00·c0b41a00·c0b71a00·d0b61a00·................ |
| 30 | ··0x0069 | 30 | ··0x00698320·d0b41a00·a0b61a00·e0b41a00·20b61a00·............·... |
| 31 | ··0x0069 | 31 | ··0x00698330·00000000·7c996900·c0e11c00·60d91c00·....|.i.....`... |
| 32 | ··0x0069 | 32 | ··0x00698340·b0d91c00·c0b41a00·c0b71a00·d0b61a00·................ |
| 33 | ··0x0069 | 33 | ··0x00698350·d0b41a00·a0b61a00·e0b41a00·20b61a00·............·... |
| 34 | ··0x0069 | 34 | ··0x00698360·00000000·5c9e6900·b0f21d00·10f21d00·....\.i......... |
| 35 | ··0x0069 | 35 | ··0x00698370·60f21d00·30f51d00·d0f31d00·20f41d00·`...0.......·... |
| 36 | ··0x0069 | 36 | ··0x00698380·c0f41d00·e0f31d00·f0f31d00·90f51d00·................ |
| 37 | ··0x0069 | 37 | ··0x00698390·00000000·a49e6900·f0991e00·609a1e00·......i.....`... |
| 38 | ··0x0069 | 38 | ··0x006983a0·509b1e00·809a1e00·109a1e00·00000000·P............... |
| 39 | ··0x0069 | 39 | ··0x006983b0·b09e6900·e0991e00·209a1e00·a09a1e00·..i.....·....... |
| 40 | ··0x0069 | 40 | ··0x006983c0·409a1e00·009a1e00·0c9d5100·169d5100·@.........Q...Q. |
| 41 | ··0x0069 | 41 | ··0x006983d0·7a1d5200·1d9d5100·c39c5100·259d5100·z.R...Q...Q.%.Q. |
| 42 | ··0x0069 | 42 | ··0x006983e0·00000000·a4a16900·a0c82200·d0c82200·......i..."...". |
| 43 | ··0x0069 | 43 | ··0x006983f0·00000000·50a36900·007d2d00·c07d2d00·....P.i..}-..}-. |
| 44 | ··0x0069 | 44 | ··0x00698400·007e2d00·e07d2d00·307d2d00·00000000·.~-..}-.0}-..... |
| 45 | ··0x0069 | 45 | ··0x00698410·5ca36900·f07c2d00·807d2d00·b07e2d00·\.i..|-..}-..~-. |
| 46 | ··0x0069 | 46 | ··0x00698420·a07d2d00·207d2d00·00000000·68a36900·.}-.·}-.....h.i. |
| 47 | ··0x0069 | 47 | ··0x00698430·e07c2d00·407d2d00·607f2d00·607d2d00·.|-.@}-.`.-.`}-. |
| 48 | ··0x0069 | 48 | ··0x00698440·107d2d00·00000000·7ca36900·a0342f00·.}-.....|.i..4/. |
| 49 | ··0x0069 | 49 | ··0x00698450·70352f00·a0322f00·b0322f00·40502f00·p5/..2/..2/.@P/. |
| 50 | ··0x0069 | 50 | ··0x00698460·804b2f00·10512f00·504c2f00·c0472f00·.K/..Q/.PL/..G/. |
| 51 | ··0x0069 | 51 | ··0x00698470·404e2f00·d0472f00·10152f00·00000000·@N/..G/.../..... |
| 52 | ··0x0069 | 52 | ··0x00698480·74a46900·70863200·f0863200·00000000·t.i.p.2...2..... |
| 53 | ··0x0069 | 53 | ··0x00698490·e8a56900·b07e3400·007f3400·00000000·..i..~4...4..... |
| 54 | ··0x0069 | 54 | ··0x006984a0·04000000·04000000·02000000·04000000·................ |
| 55 | ··0x0069 | 55 | ··0x006984b0·04000000·01000000·02000000·08000000·................ |
| 56 | ··0x0069 | 56 | ··0x006984c0·02000000·02000000·00000000·00000000·................ |
| 57 | ··0x0069 | 57 | ··0x006984d0·03000000·2c5a5d00·02000000·00000000·....,Z]......... |
| 58 | ··0x0069 | 58 | ··0x006984e0·a0555d00·10000000·10000000·04000000·.U]............. |
| 59 | ··0x0069 | 59 | ··0x006984f0·10000000·10000000·06000000·04000000·................ |
| 60 | ··0x0069 | 60 | ··0x00698500·40000000·06000000·04000000·00000000·@............... |
| 61 | ··0x0069 | 61 | ··0x00698510·00000000·0f000000·1c5a5d00·04000000·.........Z]..... |
| 62 | ··0x0069 | 62 | ··0x00698520·00000000·a0555d00·90010000·90010000·.....U]......... |
| 63 | ··0x0069 | 63 | ··0x00698530·14000000·90010000·90010000·be000000·................ |
| 64 | ··0x0069 | 64 | ··0x00698540·14000000·cc010000·be000000·14000000·................ |
| 65 | ··0x0069 | 65 | ··0x00698550·00000000·00000000·16000000·045a5d00·.............Z]. |
| 66 | ··0x0069 | 66 | ··0x00698560·14000000·01000000·40555d00·00010000·........@U]..... |
| 67 | ··0x0069 | 67 | ··0x00698570·00010000·10000000·00010000·00010000·................ |
| 68 | ··0x0069 | 68 | ··0x00698580·78000000·10000000·00100000·78000000·x...........x... |
| 69 | ··0x0069 | 69 | ··0x00698590·10000000·00000000·00000000·ff000000·................ |
| 70 | ··0x0069 | 70 | ··0x006985a0·00000000·10000000·01000000·40515d00·............@Q]. |
| 71 | ··0x0069 | 71 | ··0x006985b0·24000000·24000000·06000000·24000000·$...$.......$... |
| 72 | ··0x0069 | 72 | ··0x006985c0·24000000·0f000000·06000000·80010000·$............... |
| 73 | ··0x0069 | 73 | ··0x006985d0·0f000000·06000000·00000000·00000000·................ |
| 74 | ··0x0069 | 74 | ··0x006985e0·3f000000·00000000·06000000·01000000·?............... |
| 75 | ··0x0069 | 75 | ··0x006985f0·a0555d00·31000000·31000000·07000000·.U].1...1....... |
| 76 | ··0x0069 | 76 | ··0x00698600·31000000·31000000·15000000·07000000·1...1........... |
| 77 | ··0x0069 | 77 | ··0x00698610·80030000·15000000·07000000·00000000·................ |
| 78 | ··0x0069 | 78 | ··0x00698620·00000000·7f000000·00000000·07000000·................ |
| 79 | ··0x0069 | 79 | ··0x00698630·01000000·a0555d00·00040000·00040000·.....U]......... |
| 80 | ··0x0069 | 80 | ··0x00698640·20000000·00040000·00040000·f0010000··............... |
| 81 | ··0x0069 | 81 | ··0x00698650·20000000·20040000·f0010000·20000000··...·.......·... |
| 82 | ··0x0069 | 82 | ··0x00698660·00000000·00000000·20000000·e0595d00·........·....Y]. |
| 83 | ··0x0069 | 83 | ··0x00698670·20000000·01000000·a0505d00·00100000··........P]..... |
| 84 | ··0x0069 | 84 | ··0x00698680·00100000·40000000·00100000·00100000·....@........... |
| 85 | ··0x0069 | 85 | ··0x00698690·e0070000·40000000·40100000·40000000·....@...@...@... |
| 86 | ··0x0069 | 86 | ··0x006986a0·e0070000·00000000·00000000·40000000·............@... |
| 87 | ··0x0069 | 87 | ··0x006986b0·00000000·40000000·01000000·00000000·....@........... |
| 88 | ··0x0069 | 88 | ··0x006986c0·68af6900·b0b06900·80b16900·28b66900·h.i...i...i.(.i. |
| 89 | ··0x0069 | 89 | ··0x006986d0·08b46900·30b56900·00b66900·c8b16900·..i.0.i...i...i. |
| 90 | ··0x0069 | 90 | ··0x006986e0·10b36900·e0b36900·e4b76900·b4b86900·..i...i...i...i. |
| 91 | ··0x0069 | 91 | ··0x006986f0·9cb66900·08ba6900·30bb6900·00bc6900·..i...i.0.i...i. |
| 92 | ··0x0069 | 92 | ··0x00698700·7cbe6900·84bf6900·54c06900·c8c26900·|.i...i.T.i...i. |
| 93 | ··0x0069 | 93 | ··0x00698710·88c06900·d0c16900·a0c26900·1cc46900·..i...i...i...i. |
| 94 | ··0x0069 | 94 | ··0x00698720·ecc46900·e0cb6900·c0c96900·e8ca6900·..i...i...i...i. |
| 95 | ··0x0069 | 95 | ··0x00698730·b8cb6900·74c76900·34c56900·7cc66900·..i.t.i.4.i.|.i. |
| 96 | ··0x0069 | 96 | ··0x00698740·4cc76900·c8c86900·98c96900·98cd6900·L.i...i...i...i. |
| 97 | ··0x0069 | 97 | ··0x00698750·68ce6900·44cc6900·a8ce6900·cccf6900·h.i.D.i...i...i. |
| 98 | ··0x0069 | 98 | ··0x00698760·9cd06900·20d56900·00d36900·28d46900·..i.·.i...i.(.i. |
| 99 | ··0x0069 | 99 | ··0x00698770·f8d46900·e4d06900·08d26900·d8d26900·..i...i...i...i. |
| 100 | ··0x0069 | 100 | ··0x00698780·a8d66900·78d76900·84d56900·c0d76900·..i.x.i...i...i. |
| 101 | ··0x0069 | 101 | ··0x00698790·78d96900·acda6900·d0da6900·f8da6900·x.i...i...i...i. |
| 102 | ··0x0069 | 102 | ··0x006987a0·94dc6900·c8dd6900·ecdd6900·40e46900·..i...i...i.@.i. |
| 103 | ··0x0069 | 103 | ··0x006987b0·3ce16900·d8e26900·0ce46900·30e46900·<.i...i...i.0.i. |
| 104 | ··0x0069 | 104 | ··0x006987c0·1cde6900·d4df6900·08e16900·2ce16900·..i...i...i.,.i. |
| 105 | ··0x0069 | 105 | ··0x006987d0·70e66900·a4e76900·c8e76900·b8e46900·p.i...i...i...i. |
| 106 | ··0x0069 | 106 | ··0x006987e0·40106a00·34106a00·28106a00·1c106a00·@.j.4.j.(.j...j. |
| 107 | ··0x0069 | 107 | ··0x006987f0·10106a00·04106a00·f80f6a00·ec0f6a00·..j...j...j...j. |
| 108 | ··0x0069 | 108 | ··0x00698800·e00f6a00·00000000·00000000·00000000·..j............. |
| 109 | ··0x0069 | 109 | ··0x00698810·00000000·00000000·00000000·00000000·................ |
| 110 | ··0x0069 | 110 | ··0x00698820·54a55d00·4ca55d00·40a55d00·34a55d00·T.].L.].@.].4.]. |
| 111 | ··0x0069 | 111 | ··0x00698830·28a55d00·1ca55d00·0ca55d00·fca45d00·(.]...]...]...]. |
| 112 | ··0x0069 | 112 | ··0x00698840·eca45d00·dca45d00·c8a45d00·b4a45d00·..]...]...]...]. |
| 113 | ··0x0069 | 113 | ··0x00698850·a0a45d00·8ca45d00·78a45d00·64a45d00·..]...].x.].d.]. |
| 114 | ··0x0069 | 114 | ··0x00698860·50a45d00·3ca45d00·28a45d00·10a45d00·P.].<.].(.]...]. |
| 115 | ··0x0069 | 115 | ··0x00698870·f8a35d00·e0a35d00·c8a35d00·b0a35d00·..]...]...]...]. |
| 116 | ··0x0069 | 116 | ··0x00698880·98a35d00·80a35d00·60a35d00·40a35d00·..]...].`.].@.]. |
| 117 | ··0x0069 | 117 | ··0x00698890·20a35d00·00a35d00·e0a25d00·c0a25d00··.]...]...]...]. |
| 118 | ··0x0069 | 118 | ··0x006988a0·80a25d00·40a25d00·00a25d00·c0a15d00·..].@.]...]...]. |
| 119 | ··0x0069 | 119 | ··0x006988b0·80a15d00·10a45d00·00000000·00000000·..]...]......... |
| 120 | ··0x0069 | 120 | ··0x006988c0·60ab5d00·00ab5d00·a0aa5d00·40aa5d00·`.]...]...].@.]. |
| 121 | ··0x0069 | 121 | ··0x006988d0·e0a95d00·80a65d00·20a65d00·c0a55d00·..]...].·.]...]. |
| 122 | ··0x0069 | 122 | ··0x006988e0·60a55d00·80a95d00·c0a85d00·a0a75d00·`.]...]...]...]. |
| 123 | ··0x0069 | 123 | ··0x006988f0·00000000·88f26900·80e84700·10896900·......i...G...i. |
| 124 | ··0x0069 | 124 | ··0x00698900·24896900·5c010000·00000000·9cf26900·$.i.\.........i. |
| 125 | ··0x0069 | 125 | ··0x00698910·e0484800·104a4800·a4feffff·a4feffff·.HH..JH......... |
| Max diff block lines reached; 116440/256330 bytes (45.43%) of diff not shown. | |||
| Offset 1, 96 lines modified | Offset 1, 96 lines modified | ||
| 1 | Hex·dump·of·section·'.got': | 1 | Hex·dump·of·section·'.got': |
| 2 | ·NOTE:·This·section·has·relocations·against·it,·but·these·have·NOT·been·applied·to·this·dump. | 2 | ·NOTE:·This·section·has·relocations·against·it,·but·these·have·NOT·been·applied·to·this·dump. |
| 3 | ··0x0069 | 3 | ··0x0069fa2c·fcf86900·00000000·00000000·36000800·..i.........6... |
| 4 | ··0x0069 | 4 | ··0x0069fa3c·46000800·56000800·66000800·76000800·F...V...f...v... |
| 5 | ··0x0069 | 5 | ··0x0069fa4c·86000800·96000800·a6000800·b6000800·................ |
| 6 | ··0x0069 | 6 | ··0x0069fa5c·c6000800·d6000800·e6000800·f6000800·................ |
| 7 | ··0x0069 | 7 | ··0x0069fa6c·06010800·16010800·26010800·36010800·........&...6... |
| 8 | ··0x0069 | 8 | ··0x0069fa7c·46010800·56010800·66010800·76010800·F...V...f...v... |
| 9 | ··0x0069 | 9 | ··0x0069fa8c·86010800·96010800·a6010800·b6010800·................ |
| 10 | ··0x0069 | 10 | ··0x0069fa9c·c6010800·d6010800·e6010800·f6010800·................ |
| 11 | ··0x0069 | 11 | ··0x0069faac·06020800·16020800·26020800·36020800·........&...6... |
| 12 | ··0x0069 | 12 | ··0x0069fabc·46020800·56020800·66020800·76020800·F...V...f...v... |
| 13 | ··0x0069 | 13 | ··0x0069facc·86020800·96020800·a6020800·b6020800·................ |
| 14 | ··0x0069 | 14 | ··0x0069fadc·c6020800·d6020800·e6020800·f6020800·................ |
| 15 | ··0x0069 | 15 | ··0x0069faec·06030800·16030800·26030800·36030800·........&...6... |
| 16 | ··0x0069 | 16 | ··0x0069fafc·46030800·56030800·66030800·76030800·F...V...f...v... |
| 17 | ··0x0069 | 17 | ··0x0069fb0c·86030800·96030800·a6030800·b6030800·................ |
| 18 | ··0x0069 | 18 | ··0x0069fb1c·c6030800·d6030800·e6030800·f6030800·................ |
| 19 | ··0x0069 | 19 | ··0x0069fb2c·06040800·16040800·26040800·36040800·........&...6... |
| 20 | ··0x0069 | 20 | ··0x0069fb3c·46040800·56040800·66040800·76040800·F...V...f...v... |
| 21 | ··0x0069 | 21 | ··0x0069fb4c·86040800·96040800·a6040800·b6040800·................ |
| 22 | ··0x0069 | 22 | ··0x0069fb5c·c6040800·d6040800·e6040800·f6040800·................ |
| 23 | ··0x0069 | 23 | ··0x0069fb6c·06050800·16050800·26050800·36050800·........&...6... |
| 24 | ··0x0069 | 24 | ··0x0069fb7c·46050800·56050800·66050800·76050800·F...V...f...v... |
| 25 | ··0x0069 | 25 | ··0x0069fb8c·86050800·96050800·a6050800·b6050800·................ |
| 26 | ··0x0069 | 26 | ··0x0069fb9c·c6050800·d6050800·e6050800·f6050800·................ |
| 27 | ··0x0069 | 27 | ··0x0069fbac·06060800·16060800·26060800·36060800·........&...6... |
| 28 | ··0x0069 | 28 | ··0x0069fbbc·46060800·56060800·66060800·76060800·F...V...f...v... |
| 29 | ··0x0069 | 29 | ··0x0069fbcc·86060800·96060800·a6060800·b6060800·................ |
| 30 | ··0x0069 | 30 | ··0x0069fbdc·c6060800·d6060800·e6060800·f6060800·................ |
| 31 | ··0x0069 | 31 | ··0x0069fbec·06070800·16070800·26070800·36070800·........&...6... |
| 32 | ··0x0069 | 32 | ··0x0069fbfc·46070800·56070800·66070800·76070800·F...V...f...v... |
| 33 | ··0x0069 | 33 | ··0x0069fc0c·86070800·96070800·a6070800·b6070800·................ |
| 34 | ··0x0069 | 34 | ··0x0069fc1c·c6070800·d6070800·e6070800·f6070800·................ |
| 35 | ··0x0069 | 35 | ··0x0069fc2c·06080800·16080800·26080800·36080800·........&...6... |
| 36 | ··0x0069 | 36 | ··0x0069fc3c·46080800·56080800·66080800·76080800·F...V...f...v... |
| 37 | ··0x0069 | 37 | ··0x0069fc4c·86080800·96080800·a6080800·b6080800·................ |
| 38 | ··0x0069 | 38 | ··0x0069fc5c·c6080800·d6080800·e6080800·f6080800·................ |
| 39 | ··0x0069 | 39 | ··0x0069fc6c·06090800·16090800·26090800·36090800·........&...6... |
| 40 | ··0x0069 | 40 | ··0x0069fc7c·46090800·56090800·66090800·76090800·F...V...f...v... |
| 41 | ··0x0069 | 41 | ··0x0069fc8c·86090800·96090800·a6090800·b6090800·................ |
| 42 | ··0x0069 | 42 | ··0x0069fc9c·c6090800·d6090800·e6090800·f6090800·................ |
| 43 | ··0x0069 | 43 | ··0x0069fcac·060a0800·160a0800·260a0800·360a0800·........&...6... |
| 44 | ··0x0069 | 44 | ··0x0069fcbc·460a0800·560a0800·660a0800·760a0800·F...V...f...v... |
| 45 | ··0x0069 | 45 | ··0x0069fccc·860a0800·960a0800·a60a0800·b60a0800·................ |
| 46 | ··0x0069 | 46 | ··0x0069fcdc·c60a0800·d60a0800·e60a0800·f60a0800·................ |
| 47 | ··0x0069 | 47 | ··0x0069fcec·060b0800·160b0800·260b0800·360b0800·........&...6... |
| 48 | ··0x0069 | 48 | ··0x0069fcfc·460b0800·560b0800·660b0800·760b0800·F...V...f...v... |
| 49 | ··0x0069 | 49 | ··0x0069fd0c·860b0800·960b0800·a60b0800·b60b0800·................ |
| 50 | ··0x0069 | 50 | ··0x0069fd1c·c60b0800·d60b0800·e60b0800·f60b0800·................ |
| 51 | ··0x0069 | 51 | ··0x0069fd2c·060c0800·160c0800·260c0800·360c0800·........&...6... |
| 52 | ··0x0069 | 52 | ··0x0069fd3c·460c0800·560c0800·660c0800·760c0800·F...V...f...v... |
| 53 | ··0x0069 | 53 | ··0x0069fd4c·860c0800·960c0800·a60c0800·b60c0800·................ |
| 54 | ··0x0069 | 54 | ··0x0069fd5c·c60c0800·d60c0800·e60c0800·f60c0800·................ |
| 55 | ··0x0069 | 55 | ··0x0069fd6c·060d0800·160d0800·260d0800·360d0800·........&...6... |
| 56 | ··0x0069 | 56 | ··0x0069fd7c·460d0800·560d0800·660d0800·760d0800·F...V...f...v... |
| 57 | ··0x0069 | 57 | ··0x0069fd8c·860d0800·960d0800·a60d0800·b60d0800·................ |
| 58 | ··0x0069 | 58 | ··0x0069fd9c·c60d0800·d60d0800·e60d0800·f60d0800·................ |
| 59 | ··0x0069 | 59 | ··0x0069fdac·060e0800·160e0800·260e0800·360e0800·........&...6... |
| 60 | ··0x0069 | 60 | ··0x0069fdbc·460e0800·560e0800·660e0800·760e0800·F...V...f...v... |
| 61 | ··0x0069 | 61 | ··0x0069fdcc·860e0800·960e0800·a60e0800·b60e0800·................ |
| 62 | ··0x0069 | 62 | ··0x0069fddc·c60e0800·d60e0800·e60e0800·f60e0800·................ |
| 63 | ··0x0069 | 63 | ··0x0069fdec·060f0800·160f0800·260f0800·360f0800·........&...6... |
| 64 | ··0x0069 | 64 | ··0x0069fdfc·460f0800·560f0800·660f0800·760f0800·F...V...f...v... |
| 65 | ··0x0069 | 65 | ··0x0069fe0c·860f0800·960f0800·a60f0800·b60f0800·................ |
| 66 | ··0x0069 | 66 | ··0x0069fe1c·c60f0800·d60f0800·e60f0800·f60f0800·................ |
| 67 | ··0x0069 | 67 | ··0x0069fe2c·06100800·16100800·26100800·36100800·........&...6... |
| 68 | ··0x0069 | 68 | ··0x0069fe3c·46100800·56100800·66100800·76100800·F...V...f...v... |
| 69 | ··0x0069 | 69 | ··0x0069fe4c·86100800·96100800·a6100800·b6100800·................ |
| 70 | ··0x0069 | 70 | ··0x0069fe5c·c6100800·d6100800·e6100800·f6100800·................ |
| 71 | ··0x0069 | 71 | ··0x0069fe6c·06110800·16110800·26110800·36110800·........&...6... |
| 72 | ··0x0069 | 72 | ··0x0069fe7c·46110800·56110800·66110800·76110800·F...V...f...v... |
| 73 | ··0x0069 | 73 | ··0x0069fe8c·86110800·96110800·a6110800·b6110800·................ |
| 74 | ··0x0069 | 74 | ··0x0069fe9c·c6110800·d6110800·e6110800·f6110800·................ |
| 75 | ··0x0069 | 75 | ··0x0069feac·06120800·16120800·26120800·36120800·........&...6... |
| 76 | ··0x0069 | 76 | ··0x0069febc·46120800·56120800·66120800·76120800·F...V...f...v... |
| 77 | ··0x0069 | 77 | ··0x0069fecc·86120800·96120800·a6120800·b6120800·................ |
| 78 | ··0x0069 | 78 | ··0x0069fedc·c6120800·d6120800·e6120800·f6120800·................ |
| 79 | ··0x0069 | 79 | ··0x0069feec·06130800·16130800·26130800·36130800·........&...6... |
| 80 | ··0x0069 | 80 | ··0x0069fefc·46130800·b0a16900·40a26900·00000000·F.....i.@.i..... |
| 81 | ··0x0069 | 81 | ··0x0069ff0c·00000000·ec1c6b00·00000000·e81c6b00·......k.......k. |
| 82 | ··0x0069 | 82 | ··0x0069ff1c·00000000·1ca26900·40712d00·504a0e00·......i.@q-.PJ.. |
| 83 | ··0x0069 | 83 | ··0x0069ff2c·10a26900·00000000·00000000·00000000·..i............. |
| 84 | ··0x0069 | 84 | ··0x0069ff3c·eca16900·00000000·00000000·00000000·..i............. |
| 85 | ··0x0069 | 85 | ··0x0069ff4c·f0702d00·00000000·00000000·00000000·.p-............. |
| 86 | ··0x0069 | 86 | ··0x0069ff5c·00000000·00000000·00000000·00000000·................ |
| 87 | ··0x0069 | 87 | ··0x0069ff6c·00000000·00000000·00000000·00000000·................ |
| 88 | ··0x0069 | 88 | ··0x0069ff7c·00000000·00000000·00000000·00000000·................ |
| 89 | ··0x0069 | 89 | ··0x0069ff8c·00000000·601b6b00·706e2d00·c06e2d00·....`.k.pn-..n-. |
| 90 | ··0x0069 | 90 | ··0x0069ff9c·00000000·00000000·00000000·00000000·................ |
| 91 | ··0x0069 | 91 | ··0x0069ffac·00000000·30722d00·00000000·00000000·....0r-......... |
| 92 | ··0x0069 | 92 | ··0x0069ffbc·bca16900·00702d00·00000000·00000000·..i..p-......... |
| 93 | ··0x0069 | 93 | ··0x0069ffcc·00000000·00000000·00000000·00000000·................ |
| 94 | ··0x0069 | 94 | ··0x0069ffdc·00000000·00000000·00000000··········............ |
| Offset 1, 4173 lines modified | Offset 1, 4173 lines modified | ||
| Diff chunk too large, falling back to line-by-line diff (4170 lines added, 4170 lines removed) | |||
| 1 | Hex·dump·of·section·'.data': | 1 | Hex·dump·of·section·'.data': |
| 2 | ··0x006 | 2 | ··0x006a0000·00000000·04006a00·00000000·00000000·......j......... |
| 3 | ··0x006 | 3 | ··0x006a0010·00000000·00000000·00000000·00000000·................ |
| 4 | ··0x006 | 4 | ··0x006a0020·4b4e4b4e·54545454·52535253·49494d49·KNKNTTTTRSRSIIMI |
| 5 | ··0x006 | 5 | ··0x006a0030·51485148·50505050·52525252·4c4c4c4c·QHQHPPPPRRRRLLLL |
| 6 | ··0x006 | 6 | ··0x006a0040·45444544·41414141·47474747·56565656·EDEDAAAAGGGGVVVV |
| 7 | ··0x006 | 7 | ··0x006a0050·2a592a59·53535353·47435743·4c464c46·*Y*YSSSSGCWCLFLF |
| 8 | ··0x006 | 8 | ··0x006a0060·00000000·00000000·00000000·00000000·................ |
| 9 | ··0x006 | 9 | ··0x006a0070·00000000·00000000·00000000·00000000·................ |
| 10 | ··0x006 | 10 | ··0x006a0080·4b4e4b4e·54545454·53534b53·49494d49·KNKNTTTTSSKSIIMI |
| 11 | ··0x006 | 11 | ··0x006a0090·51485148·50505050·52525252·4c4c4c4c·QHQHPPPPRRRRLLLL |
| 12 | ··0x006 | 12 | ··0x006a00a0·45444544·41414141·47474747·56565656·EDEDAAAAGGGGVVVV |
| 13 | ··0x006 | 13 | ··0x006a00b0·2a592a59·53535353·57435743·4c464c46·*Y*YSSSSWCWCLFLF |
| 14 | ··0x006 | 14 | ··0x006a00c0·00000000·00000000·00000000·00000000·................ |
| 15 | ··0x006 | 15 | ··0x006a00d0·00000000·00000000·00000000·00000000·................ |
| 16 | ··0x006 | 16 | ··0x006a00e0·4b4e4b4e·54545454·52535253·49494d49·KNKNTTTTRSRSIIMI |
| 17 | ··0x006 | 17 | ··0x006a00f0·51485148·50505050·52525252·4c4c4c4c·QHQHPPPPRRRRLLLL |
| 18 | ··0x006 | 18 | ··0x006a0100·45444544·41414141·47474747·56565656·EDEDAAAAGGGGVVVV |
| 19 | ··0x006 | 19 | ··0x006a0110·2a592a59·53535353·2a435743·2a464c46·*Y*YSSSS*CWC*FLF |
| 20 | ··0x006 | 20 | ··0x006a0120·00000000·00000000·00000000·00000000·................ |
| 21 | ··0x006 | 21 | ··0x006a0130·00000000·00000000·00000000·00000000·................ |
| 22 | ··0x006 | 22 | ··0x006a0140·4b4e4b4e·54545454·52535253·49494d49·KNKNTTTTRSRSIIMI |
| 23 | ··0x006 | 23 | ··0x006a0150·51485148·50505050·52525252·4c4c4c4c·QHQHPPPPRRRRLLLL |
| 24 | ··0x006 | 24 | ··0x006a0160·45444544·41414141·47474747·56565656·EDEDAAAAGGGGVVVV |
| 25 | ··0x006 | 25 | ··0x006a0170·2a594c59·2a535353·2a435743·4c464c46·*YLY*SSS*CWCLFLF |
| 26 | ··0x006 | 26 | ··0x006a0180·00000000·00000000·00000000·00000000·................ |
| 27 | ··0x006 | 27 | ··0x006a0190·00000000·00000000·00000000·00000000·................ |
| 28 | ··0x006 | 28 | ··0x006a01a0·4e4e4b4e·54545454·53535353·4d494d49·NNKNTTTTSSSSMIMI |
| 29 | ··0x006 | 29 | ··0x006a01b0·51485148·50505050·52525252·4c4c4c4c·QHQHPPPPRRRRLLLL |
| 30 | ··0x006 | 30 | ··0x006a01c0·45444544·41414141·47474747·56565656·EDEDAAAAGGGGVVVV |
| 31 | ··0x006 | 31 | ··0x006a01d0·2a592a59·53535353·57435743·4c464c46·*Y*YSSSSWCWCLFLF |
| 32 | ··0x006 | 32 | ··0x006a01e0·00000000·00000000·00000000·00000000·................ |
| 33 | ··0x006 | 33 | ··0x006a01f0·00000000·00000000·00000000·00000000·................ |
| 34 | ··0x006 | 34 | ··0x006a0200·4b4e4b4e·54545454·52535253·49494d49·KNKNTTTTRSRSIIMI |
| 35 | ··0x006 | 35 | ··0x006a0210·51485148·50505050·52525252·4c4c4c4c·QHQHPPPPRRRRLLLL |
| 36 | ··0x006 | 36 | ··0x006a0220·45444544·41414141·47474747·56565656·EDEDAAAAGGGGVVVV |
| 37 | ··0x006 | 37 | ··0x006a0230·2a594c59·53535353·2a435743·4c464c46·*YLYSSSS*CWCLFLF |
| 38 | ··0x006 | 38 | ··0x006a0240·00000000·00000000·00000000·00000000·................ |
| 39 | ··0x006 | 39 | ··0x006a0250·00000000·00000000·00000000·00000000·................ |
| 40 | ··0x006 | 40 | ··0x006a0260·4b4e4b4e·54545454·52535253·49494d49·KNKNTTTTRSRSIIMI |
| 41 | ··0x006 | 41 | ··0x006a0270·51485148·50505050·52525252·4c4c4c4c·QHQHPPPPRRRRLLLL |
| 42 | ··0x006 | 42 | ··0x006a0280·45444544·41414141·47474747·56565656·EDEDAAAAGGGGVVVV |
| 43 | ··0x006 | 43 | ··0x006a0290·2a595159·53535353·2a435743·4c464c46·*YQYSSSS*CWCLFLF |
| 44 | ··0x006 | 44 | ··0x006a02a0·00000000·00000000·00000000·00000000·................ |
| 45 | ··0x006 | 45 | ··0x006a02b0·00000000·00000000·00000000·00000000·................ |
| 46 | ··0x006 | 46 | ··0x006a02c0·4e4e4b4e·54545454·53535353·49494d49·NNKNTTTTSSSSIIMI |
| 47 | ··0x006 | 47 | ··0x006a02d0·51485148·50505050·52525252·4c4c4c4c·QHQHPPPPRRRRLLLL |
| 48 | ··0x006 | 48 | ··0x006a02e0·45444544·41414141·47474747·56565656·EDEDAAAAGGGGVVVV |
| 49 | ··0x006 | 49 | ··0x006a02f0·59592a59·53535353·57435743·4c464c46·YY*YSSSSWCWCLFLF |
| 50 | ··0x006 | 50 | ··0x006a0300·00000000·00000000·00000000·00000000·................ |
| 51 | ··0x006 | 51 | ··0x006a0310·00000000·00000000·00000000·00000000·................ |
| 52 | ··0x006 | 52 | ··0x006a0320·4b4e4b4e·54545454·47534753·4d494d49·KNKNTTTTGSGSMIMI |
| 53 | ··0x006 | 53 | ··0x006a0330·51485148·50505050·52525252·4c4c4c4c·QHQHPPPPRRRRLLLL |
| 54 | ··0x006 | 54 | ··0x006a0340·45444544·41414141·47474747·56565656·EDEDAAAAGGGGVVVV |
| 55 | ··0x006 | 55 | ··0x006a0350·2a592a59·53535353·57435743·4c464c46·*Y*YSSSSWCWCLFLF |
| 56 | ··0x006 | 56 | ··0x006a0360·00000000·00000000·00000000·00000000·................ |
| 57 | ··0x006 | 57 | ··0x006a0370·00000000·00000000·00000000·00000000·................ |
| 58 | ··0x006 | 58 | ··0x006a0380·4b4e4b4e·54545454·52535253·49494d49·KNKNTTTTRSRSIIMI |
| 59 | ··0x006 | 59 | ··0x006a0390·51485148·50505050·52525252·4c4c534c·QHQHPPPPRRRRLLSL |
| 60 | ··0x006 | 60 | ··0x006a03a0·45444544·41414141·47474747·56565656·EDEDAAAAGGGGVVVV |
| 61 | ··0x006 | 61 | ··0x006a03b0·2a592a59·53535353·2a435743·4c464c46·*Y*YSSSS*CWCLFLF |
| 62 | ··0x006 | 62 | ··0x006a03c0·00000000·00000000·00000000·00000000·................ |
| 63 | ··0x006 | 63 | ··0x006a03d0·00000000·00000000·00000000·00000000·................ |
| 64 | ··0x006 | 64 | ··0x006a03e0·4b4e4b4e·54545454·52535253·49494d49·KNKNTTTTRSRSIIMI |
| 65 | ··0x006 | 65 | ··0x006a03f0·51485148·50505050·52525252·4c4c4c4c·QHQHPPPPRRRRLLLL |
| 66 | ··0x006 | 66 | ··0x006a0400·45444544·41414141·47474747·56565656·EDEDAAAAGGGGVVVV |
| 67 | ··0x006 | 67 | ··0x006a0410·2a592a59·53535353·2a435743·4c464c46·*Y*YSSSS*CWCLFLF |
| 68 | ··0x006 | 68 | ··0x006a0420·00000000·00000000·00000000·00000000·................ |
| 69 | ··0x006 | 69 | ··0x006a0430·00000000·00000000·00000000·00000000·................ |
| 70 | ··0x006 | 70 | ··0x006a0440·4b4e4b4e·54545454·52535253·49494d49·KNKNTTTTRSRSIIMI |
| 71 | ··0x006 | 71 | ··0x006a0450·51485148·50505050·52525252·4c4c4c4c·QHQHPPPPRRRRLLLL |
| 72 | ··0x006 | 72 | ··0x006a0460·45444544·41414141·47474747·56565656·EDEDAAAAGGGGVVVV |
| 73 | ··0x006 | 73 | ··0x006a0470·2a592a59·53535353·43435743·4c464c46·*Y*YSSSSCCWCLFLF |
| 74 | ··0x006 | 74 | ··0x006a0480·00000000·00000000·00000000·00000000·................ |
| 75 | ··0x006 | 75 | ··0x006a0490·00000000·00000000·00000000·00000000·................ |
| 76 | ··0x006 | 76 | ··0x006a04a0·4e4e4b4e·54545454·53535353·49494d49·NNKNTTTTSSSSIIMI |
| 77 | ··0x006 | 77 | ··0x006a04b0·51485148·50505050·52525252·4c4c4c4c·QHQHPPPPRRRRLLLL |
| 78 | ··0x006 | 78 | ··0x006a04c0·45444544·41414141·47474747·56565656·EDEDAAAAGGGGVVVV |
| 79 | ··0x006 | 79 | ··0x006a04d0·2a592a59·53535353·57435743·4c464c46·*Y*YSSSSWCWCLFLF |
| 80 | ··0x006 | 80 | ··0x006a04e0·00000000·00000000·00000000·00000000·................ |
| 81 | ··0x006 | 81 | ··0x006a04f0·00000000·00000000·00000000·00000000·................ |
| 82 | ··0x006 | 82 | ··0x006a0500·4b4e4b4e·54545454·52535253·49494d49·KNKNTTTTRSRSIIMI |
| 83 | ··0x006 | 83 | ··0x006a0510·51485148·50505050·52525252·4c4c4c4c·QHQHPPPPRRRRLLLL |
| 84 | ··0x006 | 84 | ··0x006a0520·45444544·41414141·47474747·56565656·EDEDAAAAGGGGVVVV |
| 85 | ··0x006 | 85 | ··0x006a0530·51595159·53535353·2a435743·4c464c46·QYQYSSSS*CWCLFLF |
| 86 | ··0x006 | 86 | ··0x006a0540·00000000·00000000·00000000·00000000·................ |
| 87 | ··0x006 | 87 | ··0x006a0550·00000000·00000000·00000000·00000000·................ |
| 88 | ··0x006 | 88 | ··0x006a0560·4b4e4b4e·54545454·53535353·4d494d49·KNKNTTTTSSSSMIMI |
| 89 | ··0x006 | 89 | ··0x006a0570·51485148·50505050·52525252·4c4c4c4c·QHQHPPPPRRRRLLLL |
| 90 | ··0x006 | 90 | ··0x006a0580·45444544·41414141·47474747·56565656·EDEDAAAAGGGGVVVV |
| 91 | ··0x006 | 91 | ··0x006a0590·2a592a59·53535353·57435743·4c464c46·*Y*YSSSSWCWCLFLF |
| 92 | ··0x006 | 92 | ··0x006a05a0·00000000·00000000·00000000·00000000·................ |
| 93 | ··0x006 | 93 | ··0x006a05b0·00000000·00000000·00000000·00000000·................ |
| 94 | ··0x006 | 94 | ··0x006a05c0·4b4e4b4e·54545454·52535253·49494d49·KNKNTTTTRSRSIIMI |
| 95 | ··0x006 | 95 | ··0x006a05d0·51485148·50505050·52525252·4c4c4c4c·QHQHPPPPRRRRLLLL |
| 96 | ··0x006 | 96 | ··0x006a05e0·45444544·41414141·47474747·56565656·EDEDAAAAGGGGVVVV |
| 97 | ··0x006 | 97 | ··0x006a05f0·2a592a59·53535353·57435743·4c464c46·*Y*YSSSSWCWCLFLF |
| 98 | ··0x006 | 98 | ··0x006a0600·00000000·00000000·00000000·00000000·................ |
| 99 | ··0x006 | 99 | ··0x006a0610·00000000·00000000·00000000·00000000·................ |
| 100 | ··0x006 | 100 | ··0x006a0620·4b4e4b4e·54545454·52535253·4d494d49·KNKNTTTTRSRSMIMI |
| 101 | ··0x006 | 101 | ··0x006a0630·51485148·50505050·52525252·54545454·QHQHPPPPRRRRTTTT |
| 102 | ··0x006 | 102 | ··0x006a0640·45444544·41414141·47474747·56565656·EDEDAAAAGGGGVVVV |
| 103 | ··0x006 | 103 | ··0x006a0650·2a592a59·53535353·57435743·4c464c46·*Y*YSSSSWCWCLFLF |
| 104 | ··0x006 | 104 | ··0x006a0660·00000000·00000000·00000000·00000000·................ |
| 105 | ··0x006 | 105 | ··0x006a0670·00000000·00000000·00000000·00000000·................ |
| 106 | ··0x006 | 106 | ··0x006a0680·4b4e4b4e·54545454·2a532a53·4d494d49·KNKNTTTT*S*SMIMI |
| 107 | ··0x006 | 107 | ··0x006a0690·51485148·50505050·52525252·4c4c4c4c·QHQHPPPPRRRRLLLL |
| 108 | ··0x006 | 108 | ··0x006a06a0·45444544·41414141·47474747·56565656·EDEDAAAAGGGGVVVV |
| 109 | ··0x006 | 109 | ··0x006a06b0·2a592a59·53535353·57435743·4c464c46·*Y*YSSSSWCWCLFLF |
| 110 | ··0x006 | 110 | ··0x006a06c0·00000000·00000000·00000000·00000000·................ |
| 111 | ··0x006 | 111 | ··0x006a06d0·00000000·00000000·00000000·00000000·................ |
| 112 | ··0x006 | 112 | ··0x006a06e0·4b4e4b4e·54545454·52535253·49494d49·KNKNTTTTRSRSIIMI |
| 113 | ··0x006 | 113 | ··0x006a06f0·51485148·50505050·52525252·4c4c4c4c·QHQHPPPPRRRRLLLL |
| 114 | ··0x006 | 114 | ··0x006a0700·45444544·41414141·47474747·56565656·EDEDAAAAGGGGVVVV |
| 115 | ··0x006 | 115 | ··0x006a0710·2a592a59·53535353·2a435743·4c464c46·*Y*YSSSS*CWCLFLF |
| 116 | ··0x006 | 116 | ··0x006a0720·00000000·00000000·00000000·00000000·................ |
| 117 | ··0x006 | 117 | ··0x006a0730·00000000·00000000·00000000·00000000·................ |
| 118 | ··0x006 | 118 | ··0x006a0740·30313233·34353637·38394142·43444546·0123456789ABCDEF |
| 119 | ··0x006 | 119 | ··0x006a0750·4748494a·4b4c4d4e·4f505152·53545556·GHIJKLMNOPQRSTUV |
| 120 | ··0x006 | 120 | ··0x006a0760·00000000·41434755·00000000·41434754·....ACGU....ACGT |
| 121 | ··0x006 | 121 | ··0x006a0770·00000000·41524e44·43514547·48494c4b·....ARNDCQEGHILK |
| 122 | ··0x006 | 122 | ··0x006a0780·4d465053·54575956·58000000·fc995200·MFPSTWYVX.....R. |
| 123 | ··0x006 | 123 | ··0x006a0790·209a5200·9a795100·7c795100·409a5200··.R..yQ.|yQ.@.R. |
| 124 | ··0x006 | 124 | ··0x006a07a0·7c9a5200·f0605200·ffffffff·2c8b6900·|.R..`R.....,.i. |
| 125 | ··0x006 | 125 | ··0x006a07b0·00000000·00000000·00000000·00000000·................ |
| Max diff block lines reached; 0/558828 bytes (0.00%) of diff not shown. | |||
| Offset 1, 8 lines modified | Offset 1, 8 lines modified | ||
| 1 | Hex·dump·of·section·'.gnu_debugaltlink': | 1 | Hex·dump·of·section·'.gnu_debugaltlink': |
| 2 | ··0x00000000·2f757372·2f6c6962·2f646562·75672f2e·/usr/lib/debug/. | 2 | ··0x00000000·2f757372·2f6c6962·2f646562·75672f2e·/usr/lib/debug/. |
| 3 | ··0x00000010·64777a2f·69333836·2d6c696e·75782d67·dwz/i386-linux-g | 3 | ··0x00000010·64777a2f·69333836·2d6c696e·75782d67·dwz/i386-linux-g |
| 4 | ··0x00000020·6e752f69·71747265·652e6465·62756700·nu/iqtree.debug. | 4 | ··0x00000020·6e752f69·71747265·652e6465·62756700·nu/iqtree.debug. |
| 5 | ··0x00000030· | 5 | ··0x00000030·6b572d48·6c5a52d6·d5a227cc·ab12a58e·kW-HlZR...'..... |
| 6 | ··0x00000040· | 6 | ··0x00000040·b8e8e5e8····························.... |
| Offset 1, 7 lines modified | Offset 1, 7 lines modified | ||
| 1 | Hex·dump·of·section·'.gnu_debuglink': | 1 | Hex·dump·of·section·'.gnu_debuglink': |
| 2 | ··0x00000000·32613466·64356231·39633663·33303237·2a4fd5b19c6c3027 | ||
| 3 | ··0x000000 | 2 | ··0x00000000·35666565·34363061·33303830·65386363·5fee460a3080e8cc |
| 3 | ··0x00000010·32303832·39333236·62346235·30613335·20829326b4b50a35 | ||
| 4 | ··0x00000020· | 4 | ··0x00000020·31366235·36622e64·65627567·00000000·16b56b.debug.... |
| 5 | ··0x00000030· | 5 | ··0x00000030·8297311b····························..1. |
| Offset 4, 17 lines modified | Offset 4, 17 lines modified | ||
| 4 | ··Data:······························2's·complement,·little·endian | 4 | ··Data:······························2's·complement,·little·endian |
| 5 | ··Version:···························1·(current) | 5 | ··Version:···························1·(current) |
| 6 | ··OS/ABI:····························UNIX·-·GNU | 6 | ··OS/ABI:····························UNIX·-·GNU |
| 7 | ··ABI·Version:·······················0 | 7 | ··ABI·Version:·······················0 |
| 8 | ··Type:······························DYN·(Position-Independent·Executable·file) | 8 | ··Type:······························DYN·(Position-Independent·Executable·file) |
| 9 | ··Machine:···························Intel·80386 | 9 | ··Machine:···························Intel·80386 |
| 10 | ··Version:···························0x1 | 10 | ··Version:···························0x1 |
| 11 | ··Entry·point·address:···············0xe7 | 11 | ··Entry·point·address:···············0xe7e30 |
| 12 | ··Start·of·program·headers:··········52·(bytes·into·file) | 12 | ··Start·of·program·headers:··········52·(bytes·into·file) |
| 13 | ··Start·of·section·headers:··········69 | 13 | ··Start·of·section·headers:··········6993464·(bytes·into·file) |
| 14 | ··Flags:·····························0x0 | 14 | ··Flags:·····························0x0 |
| 15 | ··Size·of·this·header:···············52·(bytes) | 15 | ··Size·of·this·header:···············52·(bytes) |
| 16 | ··Size·of·program·headers:···········32·(bytes) | 16 | ··Size·of·program·headers:···········32·(bytes) |
| 17 | ··Number·of·program·headers:·········12 | 17 | ··Number·of·program·headers:·········12 |
| 18 | ··Size·of·section·headers:···········40·(bytes) | 18 | ··Size·of·section·headers:···········40·(bytes) |
| 19 | ··Number·of·section·headers:·········30 | 19 | ··Number·of·section·headers:·········30 |
| 20 | ··Section·header·string·table·index:·29 | 20 | ··Section·header·string·table·index:·29 |
| Offset 1, 27 lines modified | Offset 1, 27 lines modified | ||
| 1 | Elf·file·type·is·DYN·(Position-Independent·Executable·file) | 1 | Elf·file·type·is·DYN·(Position-Independent·Executable·file) |
| 2 | Entry·point·0xe7 | 2 | Entry·point·0xe7e30 |
| 3 | There·are·12·program·headers,·starting·at·offset·52 | 3 | There·are·12·program·headers,·starting·at·offset·52 |
| 4 | Program·Headers: | 4 | Program·Headers: |
| 5 | ··Type···········Offset···VirtAddr···PhysAddr···FileSiz·MemSiz··Flg·Align | 5 | ··Type···········Offset···VirtAddr···PhysAddr···FileSiz·MemSiz··Flg·Align |
| 6 | ··PHDR···········0x000034·0x00000034·0x00000034·0x00180·0x00180·R···0x4 | 6 | ··PHDR···········0x000034·0x00000034·0x00000034·0x00180·0x00180·R···0x4 |
| 7 | ··INTERP·········0x0001d8·0x000001d8·0x000001d8·0x00013·0x00013·R···0x1 | 7 | ··INTERP·········0x0001d8·0x000001d8·0x000001d8·0x00013·0x00013·R···0x1 |
| 8 | ······[Requesting·program·interpreter:·/lib/ld-linux.so.2] | 8 | ······[Requesting·program·interpreter:·/lib/ld-linux.so.2] |
| 9 | ··LOAD···········0x000000·0x00000000·0x00000000·0x7fba8·0x7fba8·R···0x1000 | 9 | ··LOAD···········0x000000·0x00000000·0x00000000·0x7fba8·0x7fba8·R···0x1000 |
| 10 | ··LOAD···········0x080000·0x00080000·0x00080000·0x49 | 10 | ··LOAD···········0x080000·0x00080000·0x00080000·0x492e68·0x492e68·R·E·0x1000 |
| 11 | ··LOAD···········0x51 | 11 | ··LOAD···········0x513000·0x00513000·0x00513000·0x17fecc·0x17fecc·R···0x1000 |
| 12 | ··LOAD···········0x69 | 12 | ··LOAD···········0x69316c·0x0069316c·0x0069316c·0x18330·0x24614·RW··0x1000 |
| 13 | ··DYNAMIC········0x69 | 13 | ··DYNAMIC········0x69a93c·0x0069a93c·0x0069a93c·0x00128·0x00128·RW··0x4 |
| 14 | ··NOTE···········0x0001b4·0x000001b4·0x000001b4·0x00024·0x00024·R···0x4 | 14 | ··NOTE···········0x0001b4·0x000001b4·0x000001b4·0x00024·0x00024·R···0x4 |
| 15 | ··NOTE···········0x69 | 15 | ··NOTE···········0x692eac·0x00692eac·0x00692eac·0x00020·0x00020·R···0x4 |
| 16 | ··GNU_EH_FRAME···0x5d | 16 | ··GNU_EH_FRAME···0x5d72f8·0x005d72f8·0x005d72f8·0x0de0c·0x0de0c·R···0x4 |
| 17 | ··GNU_STACK······0x000000·0x00000000·0x00000000·0x00000·0x00000·RW··0x10 | 17 | ··GNU_STACK······0x000000·0x00000000·0x00000000·0x00000·0x00000·RW··0x10 |
| 18 | ··GNU_RELRO······0x69 | 18 | ··GNU_RELRO······0x69316c·0x0069316c·0x0069316c·0x07e94·0x07e94·R···0x1 |
| 19 | ·Section·to·Segment·mapping: | 19 | ·Section·to·Segment·mapping: |
| 20 | ··Segment·Sections... | 20 | ··Segment·Sections... |
| 21 | ···00····· | 21 | ···00····· |
| 22 | ···01·····.interp· | 22 | ···01·····.interp· |
| 23 | ···02·····.note.gnu.build-id·.interp·.gnu.hash·.dynsym·.dynstr·.gnu.version·.gnu.version_r·.rel.dyn·.rel.plt· | 23 | ···02·····.note.gnu.build-id·.interp·.gnu.hash·.dynsym·.dynstr·.gnu.version·.gnu.version_r·.rel.dyn·.rel.plt· |
| 24 | ···03·····.init·.plt·.plt.got·.text·.fini· | 24 | ···03·····.init·.plt·.plt.got·.text·.fini· |
| Offset 1, 8 lines modified | Offset 1, 8 lines modified | ||
| 1 | There·are·30·section·headers,·starting·at·offset·0x6a | 1 | There·are·30·section·headers,·starting·at·offset·0x6ab638: |
| 2 | Section·Headers: | 2 | Section·Headers: |
| 3 | ··[Nr]·Name··············Type············Addr·····Off····Size···ES·Flg·Lk·Inf·Al | 3 | ··[Nr]·Name··············Type············Addr·····Off····Size···ES·Flg·Lk·Inf·Al |
| 4 | ··[·0]···················NULL············00000000·000000·000000·00······0···0··0 | 4 | ··[·0]···················NULL············00000000·000000·000000·00······0···0··0 |
| 5 | ··[·1]·.note.gnu.build-id·NOTE············000001b4·0001b4·000024·00···A··0···0··4 | 5 | ··[·1]·.note.gnu.build-id·NOTE············000001b4·0001b4·000024·00···A··0···0··4 |
| 6 | ··[·2]·.interp···········PROGBITS········000001d8·0001d8·000013·00···A··0···0··1 | 6 | ··[·2]·.interp···········PROGBITS········000001d8·0001d8·000013·00···A··0···0··1 |
| 7 | ··[·3]·.gnu.hash·········GNU_HASH········000001ec·0001ec·00abb8·04···A··4···0··4 | 7 | ··[·3]·.gnu.hash·········GNU_HASH········000001ec·0001ec·00abb8·04···A··4···0··4 |
| Offset 11, 29 lines modified | Offset 11, 29 lines modified | ||
| 11 | ··[·6]·.gnu.version······VERSYM··········0006fec2·06fec2·0030a4·02···A··4···0··2 | 11 | ··[·6]·.gnu.version······VERSYM··········0006fec2·06fec2·0030a4·02···A··4···0··2 |
| 12 | ··[·7]·.gnu.version_r····VERNEED·········00072f68·072f68·0002e0·00···A··5···5··4 | 12 | ··[·7]·.gnu.version_r····VERNEED·········00072f68·072f68·0002e0·00···A··5···5··4 |
| 13 | ··[·8]·.rel.dyn··········REL·············00073248·073248·00c048·08···A··4···0··4 | 13 | ··[·8]·.rel.dyn··········REL·············00073248·073248·00c048·08···A··4···0··4 |
| 14 | ··[·9]·.rel.plt··········REL·············0007f290·07f290·000918·08··AI··4··24··4 | 14 | ··[·9]·.rel.plt··········REL·············0007f290·07f290·000918·08··AI··4··24··4 |
| 15 | ··[10]·.init·············PROGBITS········00080000·080000·000020·00··AX··0···0··4 | 15 | ··[10]·.init·············PROGBITS········00080000·080000·000020·00··AX··0···0··4 |
| 16 | ··[11]·.plt··············PROGBITS········00080020·080020·001240·04··AX··0···0·16 | 16 | ··[11]·.plt··············PROGBITS········00080020·080020·001240·04··AX··0···0·16 |
| 17 | ··[12]·.plt.got··········PROGBITS········00081260·081260·000018·08··AX··0···0··8 | 17 | ··[12]·.plt.got··········PROGBITS········00081260·081260·000018·08··AX··0···0··8 |
| 18 | ··[13]·.text·············PROGBITS········00081280·081280·49 | 18 | ··[13]·.text·············PROGBITS········00081280·081280·491bd4·00··AX··0···0·64 |
| 19 | ··[14]·.fini·············PROGBITS········0051 | 19 | ··[14]·.fini·············PROGBITS········00512e54·512e54·000014·00··AX··0···0··4 |
| 20 | ··[15]·.rodata···········PROGBITS········0051 | 20 | ··[15]·.rodata···········PROGBITS········00513000·513000·0c42f8·00···A··0···0·32 |
| 21 | ··[16]·.eh_frame_hdr·····PROGBITS········005d | 21 | ··[16]·.eh_frame_hdr·····PROGBITS········005d72f8·5d72f8·00de0c·00···A··0···0··4 |
| 22 | ··[17]·.eh_frame·········PROGBITS········005e | 22 | ··[17]·.eh_frame·········PROGBITS········005e5104·5e5104·08f8b0·00···A··0···0··4 |
| 23 | ··[18]·.gcc_except_table·PROGBITS········0067 | 23 | ··[18]·.gcc_except_table·PROGBITS········006749b4·6749b4·01e4f5·00···A··0···0··4 |
| 24 | ··[19]·.note.ABI-tag·····NOTE············0069 | 24 | ··[19]·.note.ABI-tag·····NOTE············00692eac·692eac·000020·00···A··0···0··4 |
| 25 | ··[20]·.init_array·······INIT_ARRAY······0069 | 25 | ··[20]·.init_array·······INIT_ARRAY······0069316c·69316c·000030·04··WA··0···0··4 |
| 26 | ··[21]·.fini_array·······FINI_ARRAY······0069 | 26 | ··[21]·.fini_array·······FINI_ARRAY······0069319c·69319c·000004·04··WA··0···0··4 |
| 27 | ··[22]·.data.rel.ro······PROGBITS········0069 | 27 | ··[22]·.data.rel.ro······PROGBITS········006931a0·6931a0·00779c·00··WA··0···0·32 |
| 28 | ··[23]·.dynamic··········DYNAMIC·········0069 | 28 | ··[23]·.dynamic··········DYNAMIC·········0069a93c·69a93c·000128·08··WA··5···0··4 |
| 29 | ··[24]·.got··············PROGBITS········0069 | 29 | ··[24]·.got··············PROGBITS········0069aa64·69aa64·000580·04··WA··0···0··4 |
| 30 | ··[25]·.data·············PROGBITS········0069 | 30 | ··[25]·.data·············PROGBITS········0069b000·69b000·01049c·00··WA··0···0·32 |
| 31 | ··[26]·.bss··············NOBITS··········006a | 31 | ··[26]·.bss··············NOBITS··········006ab4a0·6ab49c·00c2e0·00··WA··0···0·32 |
| 32 | ··[27]·.gnu_debugaltlink·PROGBITS········00000000·6a | 32 | ··[27]·.gnu_debugaltlink·PROGBITS········00000000·6ab49c·000044·00······0···0··1 |
| 33 | ··[28]·.gnu_debuglink····PROGBITS········00000000·6a | 33 | ··[28]·.gnu_debuglink····PROGBITS········00000000·6ab4e0·000034·00······0···0··4 |
| 34 | ··[29]·.shstrtab·········STRTAB··········00000000·6a | 34 | ··[29]·.shstrtab·········STRTAB··········00000000·6ab514·000123·00······0···0··1 |
| 35 | Key·to·Flags: | 35 | Key·to·Flags: |
| 36 | ··W·(write),·A·(alloc),·X·(execute),·M·(merge),·S·(strings),·I·(info), | 36 | ··W·(write),·A·(alloc),·X·(execute),·M·(merge),·S·(strings),·I·(info), |
| 37 | ··L·(link·order),·O·(extra·OS·processing·required),·G·(group),·T·(TLS), | 37 | ··L·(link·order),·O·(extra·OS·processing·required),·G·(group),·T·(TLS), |
| 38 | ··C·(compressed),·x·(unknown),·o·(OS·specific),·E·(exclude), | 38 | ··C·(compressed),·x·(unknown),·o·(OS·specific),·E·(exclude), |
| 39 | ··R·(retain),·D·(mbind),·p·(processor·specific) | 39 | ··R·(retain),·D·(mbind),·p·(processor·specific) |
| Offset 360, 5870 lines modified | Offset 360, 5870 lines modified | ||
| 360 | ···356:·00000000·····0·FUNC····GLOBAL·DEFAULT··UND·_ZNKSt7__cxx1112basic_stringIcSt11char_traitsIcESaIcEE16find_last_not_ofEPKcjj@GLIBCXX_3.4.21·(5) | 360 | ···356:·00000000·····0·FUNC····GLOBAL·DEFAULT··UND·_ZNKSt7__cxx1112basic_stringIcSt11char_traitsIcESaIcEE16find_last_not_ofEPKcjj@GLIBCXX_3.4.21·(5) |
| 361 | ···357:·00000000·····0·FUNC····GLOBAL·DEFAULT··UND·_ZNSt7__cxx1112basic_stringIcSt11char_traitsIcESaIcEE9_M_mutateEjjPKcj@GLIBCXX_3.4.21·(5) | 361 | ···357:·00000000·····0·FUNC····GLOBAL·DEFAULT··UND·_ZNSt7__cxx1112basic_stringIcSt11char_traitsIcESaIcEE9_M_mutateEjjPKcj@GLIBCXX_3.4.21·(5) |
| 362 | ···358:·00000000·····0·FUNC····GLOBAL·DEFAULT··UND·__isoc23_strtol@GLIBC_2.38·(14) | 362 | ···358:·00000000·····0·FUNC····GLOBAL·DEFAULT··UND·__isoc23_strtol@GLIBC_2.38·(14) |
| 363 | ···359:·00000000·····0·FUNC····GLOBAL·DEFAULT··UND·realloc@GLIBC_2.0·(4) | 363 | ···359:·00000000·····0·FUNC····GLOBAL·DEFAULT··UND·realloc@GLIBC_2.0·(4) |
| 364 | ···360:·00000000·····0·FUNC····GLOBAL·DEFAULT··UND·fopen@GLIBC_2.1·(10) | 364 | ···360:·00000000·····0·FUNC····GLOBAL·DEFAULT··UND·fopen@GLIBC_2.1·(10) |
| 365 | ···361:·00000000·····0·FUNC····GLOBAL·DEFAULT··UND·_ZNSt6localeC1Ev@GLIBCXX_3.4·(3) | 365 | ···361:·00000000·····0·FUNC····GLOBAL·DEFAULT··UND·_ZNSt6localeC1Ev@GLIBCXX_3.4·(3) |
| 366 | ···362:·00000000·····0·FUNC····GLOBAL·DEFAULT··UND·ftell@GLIBC_2.0·(4) | 366 | ···362:·00000000·····0·FUNC····GLOBAL·DEFAULT··UND·ftell@GLIBC_2.0·(4) |
| 367 | ···363:·003d2 | 367 | ···363:·003d2a00····71·FUNC····GLOBAL·DEFAULT···13·_ZN8RateFree9meanRatesEv |
| 368 | ···364:·004aad | 368 | ···364:·004aadf0····37·FUNC····GLOBAL·DEFAULT···13·_ZN10Checkpoint11setFileNameENSt7__cxx1112basic_stringIcSt11char_traitsIcESaIcEEE |
| 369 | ···365:·0038f9 | 369 | ···365:·0038f9e0···792·FUNC····GLOBAL·DEFAULT···13·bitVectorInitravSpecial |
| 370 | ···366:·00187 | 370 | ···366:·00187810··1892·FUNC····GLOBAL·DEFAULT···13·_ZN6IQTreeD2Ev |
| 371 | ···367:·004051 | 371 | ···367:·004051a0····42·FUNC····GLOBAL·DEFAULT···13·_ZTv0_n188_N16ModelPoMoMixture9writeInfoERSo |
| 372 | ···368:·0016e4 | 372 | ···368:·0016e4e0··1025·FUNC····WEAK···DEFAULT···13·_ZNSt6vectorIxSaIxEE14_M_fill_insertEN9__gnu_cxx17__normal_iteratorIPxS1_EEjRKx |
| 373 | ···369:·00398a | 373 | ···369:·00398ad0···959·FUNC····GLOBAL·DEFAULT···13·makenewzGeneric |
| 374 | ···370:·002710 | 374 | ···370:·00271080··2196·FUNC····WEAK···DEFAULT···13·_ZN9PhyloTree38computeLikelihoodFromBufferGenericSIMDI5Vec2dLb0ELb1EEEdv |
| 375 | ···371:·003554 | 375 | ···371:·00355480·····1·FUNC····GLOBAL·DEFAULT···13·_ZN22PhyloSuperTreeUnlinked8mapTreesEv |
| 376 | ···372:·003179 | 376 | ···372:·003179f0··5548·FUNC····GLOBAL·DEFAULT···13·_ZN9PDNetwork13findPDArea_LPER6ParamsRSt6vectorI8SplitSetSaIS3_EE |
| 377 | ···373:·004ef | 377 | ···373:·004efd60···172·FUNC····GLOBAL·DEFAULT···13·_ZN8NxsTokenC2ERSi |
| 378 | ···374:·00245e | 378 | ···374:·00245e80··4134·FUNC····GLOBAL·DEFAULT···13·_Z18doKmeansClusteringR6ParamsP14PhyloSuperTreeiRSt6vectorIdSaIdEER15ModelCheckpointP11ModelsBlockiRS3_ISt3setIiSt4lessIiESaIiEESaISF_EERS3_INSt7__cxx1112basic_stringIcSt11char_traitsIcESaIcEEESaISO_EE |
| 379 | ···375:·00337 | 379 | ···375:·00337a20···121·FUNC····GLOBAL·DEFAULT···13·_ZN6PDTreeC1ERS_ |
| 380 | ···376:·001b47 | 380 | ···376:·001b47e0···552·FUNC····WEAK···DEFAULT···13·_ZNSt6vectorIS_IP4NodeSaIS1_EESaIS3_EE17_M_realloc_appendIJRKS3_EEEvDpOT_ |
| 381 | ···377:·006a | 381 | ···377:·006ac628·····8·OBJECT··UNIQUE·DEFAULT···26·_ZGVZN4YAML3Exp8EscBreakEvE1e |
| 382 | ···378:·0050 | 382 | ···378:·005055b0···592·FUNC····GLOBAL·DEFAULT···13·_ZN8terraces15bad_input_errorC1ENS_20bad_input_error_typeENSt7__cxx1112basic_stringIcSt11char_traitsIcESaIcEEE |
| 383 | ···379:·003be | 383 | ···379:·003bee60····58·FUNC····GLOBAL·DEFAULT···13·_ZN18PartitionModelPlenC2ER6ParamsP18PhyloSuperTreePlenP11ModelsBlock |
| 384 | ···380:·0019a | 384 | ···380:·0019ad70···408·FUNC····GLOBAL·DEFAULT···13·_ZN5MTreeC1ERS_ |
| 385 | ···381:·00155 | 385 | ···381:·00155f50···407·FUNC····WEAK···DEFAULT···13·_ZNSt8_Rb_treeINSt7__cxx1112basic_stringIcSt11char_traitsIcESaIcEEESt4pairIKS5_dESt10_Select1stIS8_ESt4lessIS5_ESaIS8_EE16_M_insert_uniqueIS8_EES6_ISt17_Rb_tree_iteratorIS8_EbEOT_ |
| 386 | ···382:·001c5 | 386 | ···382:·001c5430···185·FUNC····GLOBAL·DEFAULT···13·_ZN18PhyloSuperTreePlen11linkCheckReEiP4NodeS1_P13PhyloNeighborS3_ |
| 387 | ···383:·001f0 | 387 | ···383:·001f0870···141·FUNC····GLOBAL·DEFAULT···13·_ZN12outstreambuf5closeEv |
| 388 | ···384:·002a2f | 388 | ···384:·002a2fa0··1123·FUNC····WEAK···DEFAULT···13·_ZN9PhyloTree27computeLikelihoodBufferSIMDI5Vec2dLb0ELi4ELb0ELb1EEEvP13PhyloNeighborP9PhyloNodejji |
| 389 | ···385:·004f6 | 389 | ···385:·004f6f80···734·FUNC····GLOBAL·DEFAULT···13·_ZN8terraces31maximum_comprehensive_columnsetERKNS_9bitmatrixE |
| 390 | ···386:·003422 | 390 | ···386:·003422a0····59·FUNC····GLOBAL·DEFAULT···13·_ZN12MSplitsBlock5ResetEv |
| 391 | ···387:·0069 | 391 | ···387:·00693ce8···120·OBJECT··WEAK···DEFAULT···22·_ZTV9Alignment |
| 392 | ···388:·004d38 | 392 | ···388:·004d38a0···154·FUNC····GLOBAL·DEFAULT···13·_ZN19NxsAssumptionsBlockD2Ev |
| 393 | ···389:·0050 | 393 | ···389:·0050f370···681·FUNC····GLOBAL·DEFAULT···13·_ZN8terraces14print_tree_dotERKSt6vectorINS_4nodeESaIS1_EERKS0_INSt7__cxx1112basic_stringIcSt11char_traitsIcESaIcEEESaISB_EERSob |
| 394 | ···390:·0045b | 394 | ···390:·0045b900····98·FUNC····GLOBAL·DEFAULT···13·_ZN11ModelUnrest9setBoundsEPdS0_Pb |
| 395 | ···391:·001546 | 395 | ···391:·001546c0···394·FUNC····WEAK···DEFAULT···13·_Z9quicksortIdiEvPT_iiPT0_ |
| 396 | ···392:·00348 | 396 | ···392:·00348e20···848·FUNC····GLOBAL·DEFAULT···13·FixDistance |
| 397 | ···393:·0019c | 397 | ···393:·0019ce10···463·FUNC····GLOBAL·DEFAULT···13·_ZN5MTree19getPreOrderBranchesERSt6vectorIP4NodeSaIS2_EES5_S2_S2_ |
| 398 | ···394:·00176 | 398 | ···394:·00176c70····82·FUNC····GLOBAL·DEFAULT···13·_ZN6IQTree12getBestTreesB5cxx11Ei |
| 399 | ···395:·00454 | 399 | ···395:·00454b00···119·FUNC····WEAK···DEFAULT···13·_ZN8ModelDNAD1Ev |
| 400 | ···396:·0047af | 400 | ···396:·0047aff0···269·FUNC····WEAK···DEFAULT···13·_ZN5Eigen8internal21dense_assignment_loopINS0_31generic_dense_assignment_kernelINS0_9evaluatorINS_6MatrixISt7complexIdELi4ELi4ELi0ELi4ELi4EEEEENS3_INS_7ProductINS9_INS_3MapIS7_Li16ENS_6StrideILi0ELi0EEEEENS4_IdLi4ELi4ELi0ELi4ELi4EEELi0EEESD_Li1EEEEENS0_9assign_opIS6_S6_EELi0EEELi2ELi0EE3runERSK_ |
| 401 | ···397:·0038ac | 401 | ···397:·0038acf0····72·FUNC····GLOBAL·DEFAULT···13·getUndetermined |
| 402 | ···398:·004d2b | 402 | ···398:·004d2bf0··1363·FUNC····WEAK···DEFAULT···13·_ZNSt6vectorI7PatternSaIS0_EE14_M_fill_insertEN9__gnu_cxx17__normal_iteratorIPS0_S2_EEjRKS0_ |
| 403 | ···399:·003c07 | 403 | ···399:·003c07c0···115·FUNC····GLOBAL·DEFAULT···13·_ZN9RateGamma9setBoundsEPdS0_Pb |
| 404 | ···400:·005c | 404 | ···400:·005c2c90····10·OBJECT··WEAK···DEFAULT···15·_ZTS8MyReader |
| 405 | ···401:·005c | 405 | ···401:·005cdec8····11·OBJECT··WEAK···DEFAULT···15·_ZTS9SuperNode |
| 406 | ···402:·002fe8 | 406 | ···402:·002fe8c0···370·FUNC····GLOBAL·DEFAULT···13·sample_from_counts |
| 407 | ···403:·00151 | 407 | ···403:·00151a60····20·FUNC····WEAK···DEFAULT···13·_ZN9PhyloTree14getAlnNPatternEv |
| 408 | ···404:·004b0 | 408 | ···404:·004b0c00·····1·FUNC····GLOBAL·DEFAULT···13·_ZN9MPIHelper8finalizeEv | Diff chunk too large, falling back to line-by-line diff (605 lines added, 605 lines removed) |
| 409 | ···405:·0008a2a0···135·FUNC····WEAK···DEFAULT···13·_ZN5boost15throw_exceptionISt14overflow_errorEEvRKT_ | 409 | ···405:·0008a2a0···135·FUNC····WEAK···DEFAULT···13·_ZN5boost15throw_exceptionISt14overflow_errorEEvRKT_ |
| 410 | ···406:·001b62 | 410 | ···406:·001b62c0···642·FUNC····GLOBAL·DEFAULT···13·_ZN13PhyloNeighbor21clearForwardPartialLhEP4Node |
| 411 | ···407:·0041a | 411 | ···407:·0041a460··6713·FUNC····GLOBAL·DEFAULT···13·_ZN11ModelMarkov25decomposeRateMatrixNonrevEv |
| 412 | ···408:·00385 | 412 | ···408:·00385370···526·FUNC····GLOBAL·DEFAULT···13·testInsertRestoreBIG |
| 413 | ···409:·003138 | 413 | ···409:·00313880···248·FUNC····GLOBAL·DEFAULT···13·_ZN9PDNetwork12readRootNodeEPKc |
| 414 | ···410:·0069 | 414 | ···410:·006955d0·····8·OBJECT··WEAK···DEFAULT···22·_ZTINSt3tr18__detail12_Rehash_baseINS0_20_Prime_rehash_policyENS_10_HashtableINSt7__cxx1112basic_stringIcSt11char_traitsIcESaIcEEESt4pairIKS9_8NxsModelESaISD_ESt10_Select1stISD_ESt8equal_toIS9_ENS_4hashIS9_EENS0_18_Mod_range_hashingENS0_20_Default_ranged_hashES2_Lb0ELb0ELb1EEEEE |
| 415 | ···411:·003b60 | 415 | ···411:·003b60f0····64·FUNC····WEAK···DEFAULT···13·_ZN12ModelProteinD1Ev |
| 416 | ···412:·00179 | 416 | ···412:·00179e70··1963·FUNC····GLOBAL·DEFAULT···13·_ZN6IQTree15saveCurrentTreeEd |
| 417 | ···413:·006a | 417 | ···413:·006ace50·····4·OBJECT··GLOBAL·DEFAULT···26·seqData |
| 418 | ···414:·00455 | 418 | ···414:·00455370····71·FUNC····GLOBAL·DEFAULT···13·_ZN10ModelCodon8initGY94Eb15CodonKappaStyle |
| 419 | ···415:·0023a4 | 419 | ···415:·0023a4c0···429·FUNC····GLOBAL·DEFAULT···13·_ZN14CandidateModel21evaluateConcatenationB5cxx11ER6ParamsP14SuperAlignmentR15ModelCheckpointP11ModelsBlocki |
| 420 | ···416:·00121 | 420 | ···416:·00121350····91·FUNC····WEAK···DEFAULT···13·_ZThn4_N5boost10wrapexceptISt14overflow_errorED1Ev |
| 421 | ···417:·00130 | 421 | ···417:·00130400····99·FUNC····GLOBAL·DEFAULT···13·_ZN9PhyloTree27computeLikelihoodZeroBranchEP13PhyloNeighborP9PhyloNode |
| 422 | ···418:·00121 | 422 | ···418:·00121a30···103·FUNC····WEAK···DEFAULT···13·_ZThn12_N5boost10wrapexceptISt12domain_errorED0Ev |
| 423 | ···419:·004bd9 | 423 | ···419:·004bd9c0···916·FUNC····GLOBAL·DEFAULT···13·_ZN17AlignmentPairwiseC2EP9PhyloTreeii |
| 424 | ···420:·0033 | 424 | ···420:·0033a000··1028·FUNC····GLOBAL·DEFAULT···13·_ZN6PDTree21calcPDComplementarityERSt6vectorI9PDTaxaSetSaIS1_EEPcRS0_IdSaIdEE |
| 425 | ···421:·0069 | 425 | ···421:·00693a5c····52·OBJECT··WEAK···DEFAULT···22·_ZTV9NxsReader |
| 426 | ···422:·0069 | 426 | ···422:·00693e58····24·OBJECT··WEAK···DEFAULT···22·_ZTISt6vectorIjSaIjEE |
| 427 | ···423:·005c | 427 | ···423:·005ce574····25·OBJECT··WEAK···DEFAULT···15·_ZTSN4YAML15ParserExceptionE |
| 428 | ···424:·0038 | 428 | ···424:·0038b000····85·FUNC····GLOBAL·DEFAULT···13·hookup |
| 429 | ···425:·0013bd | 429 | ···425:·0013bd80··1269·FUNC····GLOBAL·DEFAULT···13·_Z27Statistics_To_Probabilitiesd |
| 430 | ···426:·0069 | 430 | ···426:·00695628·····8·OBJECT··WEAK···DEFAULT···22·_ZTI8NxsModel |
| 431 | ···427:·0045c | 431 | ···427:·0045cb10···199·FUNC····GLOBAL·DEFAULT···13·_ZN14ModelLieMarkov12setVariablesEPd |
| 432 | ···428:·00139d | 432 | ···428:·00139db0···237·FUNC····GLOBAL·DEFAULT···13·_ZN9PhyloTree14computeObsDistEPd |
| 433 | ···429:·003d2 | 433 | ···429:·003d2f40···386·FUNC····GLOBAL·DEFAULT···13·_ZN8RateFree9setBoundsEPdS0_Pb |
| 434 | ···430:·004bb | 434 | ···430:·004bb620···121·FUNC····GLOBAL·DEFAULT···13·free_rng |
| 435 | ···431:·003c8 | 435 | ···431:·003c8f10····21·FUNC····GLOBAL·DEFAULT···13·_ZTvn4_n56_N9RateInvar14saveCheckpointEv |
| 436 | ···432:·0069 | 436 | ···432:·0069a900····20·OBJECT··WEAK···DEFAULT···22·_ZTVN8terraces15bad_input_errorE |
| 437 | ···433:·0047b | 437 | ···433:·0047b100····67·FUNC····WEAK···DEFAULT···13·_ZN5Eigen8internal19gemm_blocking_spaceILi0EddLin1ELi4ELin1ELi4ELb0EED1Ev |
| 438 | ···434:·00427 | 438 | ···434:·00427c20···851·FUNC····WEAK···DEFAULT···13·_ZN5Eigen15PlainObjectBaseINS_6MatrixIdLin1ELin1ELi0ELin1ELin1EEEEC2INS_13CwiseBinaryOpINS_8internal13scalar_sum_opIddEEKS2_S9_EEEERKNS_9DenseBaseIT_EE |
| 439 | ···435:·004c66 | 439 | ···435:·004c66c0··1901·FUNC····GLOBAL·DEFAULT···13·_ZN14SuperAlignment16removePartitionsERSt3setIiSt4lessIiESaIiEE |
| 440 | ···436:·003d3 | 440 | ···436:·003d3760···126·FUNC····GLOBAL·DEFAULT···13·_ZN8RateFree12getVariablesEPd |
| 441 | ···437:·003d94 | 441 | ···437:·003d9490···679·FUNC····GLOBAL·DEFAULT···13·_ZN15RateHeterotachy9writeInfoERSo |
| 442 | ···438:·0019e | 442 | ···438:·0019eb20···993·FUNC····GLOBAL·DEFAULT···13·_ZN5MTree9printTaxaEPKc |
| 443 | ···439:·00195 | 443 | ···439:·00195970···137·FUNC····GLOBAL·DEFAULT···13·_ZN5MTree17countZeroBranchesEP4NodeS1_d |
| 444 | ···440:·00444 | 444 | ···440:·00444360···406·FUNC····WEAK···DEFAULT···13·_ZN5Eigen8internal20generic_product_implINS_3RefINS_6MatrixIdLin1ELin1ELi0ELin1ELin1EEELi0ENS_11OuterStrideILin1EEEEEKNS_5BlockIKS7_Lin1ELi1ELb1EEENS_10DenseShapeESC_Li7EE13scaleAndAddToINS8_IS7_Lin1ELi1ELb1EEEEEvRT_RS9_RSB_RKd |
| 445 | ···441:·004d28 | 445 | ···441:·004d28d0···146·FUNC····GLOBAL·DEFAULT···13·_ZN22SuperAlignmentUnlinked12computeConstER7Pattern |
| 446 | ···442:·001848 | 446 | ···442:·001848c0···777·FUNC····GLOBAL·DEFAULT···13·_ZN6IQTree11doNNISearchEb |
| 447 | ···443:·0069 | 447 | ···443:·006944b8····12·OBJECT··WEAK···DEFAULT···22·_ZTI6IQTree |
| 448 | ···444:·00384 | 448 | ···444:·00384850···867·FUNC····GLOBAL·DEFAULT···13·testInsertBIG |
| 449 | ···445:·003c4 | 449 | ···445:·003c4d60····18·FUNC····GLOBAL·DEFAULT···13·_ZTv0_n80_N14RateGammaInvar12setNCategoryEi |
| 450 | ···446:·004d0 | 450 | ···446:·004d0750····57·FUNC····WEAK···DEFAULT···13·_ZNSt3tr110_HashtableINSt7__cxx1112basic_stringIcSt11char_traitsIcESaIcEEES6_SaIS6_ESt9_IdentityIS6_ESt8equal_toIS6_ENS_4hashIS6_EENS_8__detail18_Mod_range_hashingENSE_20_Default_ranged_hashENSE_20_Prime_rehash_policyELb0ELb1ELb1EED2Ev |
| 451 | ···447:·003b6 | 451 | ···447:·003b6130····67·FUNC····WEAK···DEFAULT···13·_ZThn4_N12ModelProteinD1Ev |
| 452 | ···448:·004d1 | 452 | ···448:·004d1420····47·FUNC····GLOBAL·DEFAULT···13·_ZN26SuperAlignmentPairwisePlenD1Ev |
| 453 | ···449:·003d8 | 453 | ···449:·003d8520····21·FUNC····WEAK···DEFAULT···13·_ZTv0_n92_N13RateFreeInvar7getRateEi |
| 454 | ···450:·004d25 | 454 | ···450:·004d25f0····79·FUNC····GLOBAL·DEFAULT···13·_ZN22SuperAlignmentUnlinkedC1ER6Params |
| 455 | ···451:·003c7 | 455 | ···451:·003c7330···185·FUNC····WEAK···DEFAULT···13·_ZTv0_n48_N14RateGammaInvarD0Ev |
| 456 | ···452:·00486 | 456 | ···452:·00486a00··2236·FUNC····GLOBAL·DEFAULT···13·_ZN12Optimization6lbfgsbEiiPdS0_S0_PiS0_S1_ddS1_S1_iPcii |
| 457 | ···453:·002abf | 457 | ···453:·002abf80··1630·FUNC····WEAK···DEFAULT···13·_ZN9PhyloTree27computeLikelihoodBufferSIMDI5Vec2dLb0ELi4ELb0ELb0EEEvP13PhyloNeighborP9PhyloNodejji |
| 458 | ···454:·000f3 | 458 | ···454:·000f3b10···861·FUNC····GLOBAL·DEFAULT···13·_ZN9AlignmentC1Ev |
| 459 | ···455:·002fe | 459 | ···455:·002fe560····53·FUNC····GLOBAL·DEFAULT···13·unif |
| 460 | ···456:·000f8 | 460 | ···456:·000f8860···143·FUNC····GLOBAL·DEFAULT···13·_ZN9Alignment14getPatternFreqERSt6vectorIiSaIiEE |
| 461 | ···457:·0044 | 461 | ···457:·00449000··3602·FUNC····WEAK···DEFAULT···13·_ZNK5Eigen19HouseholderSequenceINS_6MatrixIdLin1ELin1ELi0ELin1ELin1EEENS1_IdLin1ELi1ELi0ELin1ELi1EEELi1EE6evalToIS2_S3_EEvRT_RT0_ |
| 462 | ···458:·0014f3 | 462 | ···458:·0014f3e0···890·FUNC····GLOBAL·DEFAULT···13·_ZN9PhyloTreeC1Ev |
| 463 | ···459:·004d3a | 463 | ···459:·004d3aa0··3768·FUNC····GLOBAL·DEFAULT···13·_ZN19NxsAssumptionsBlock6ReportERSo |
| 464 | ···460:·002d82 | 464 | ···460:·002d82c0··1079·FUNC····GLOBAL·DEFAULT···13·_ZN4YAML4LoadERKNSt7__cxx1112basic_stringIcSt11char_traitsIcESaIcEEE |
| 465 | ···461:·001219 | 465 | ···461:·001219c0···101·FUNC····WEAK···DEFAULT···13·_ZThn4_N5boost10wrapexceptISt12domain_errorED0Ev |
| 466 | ···462:·00442 | 466 | ···462:·00442820··2599·FUNC····WEAK···DEFAULT···13·_ZN5Eigen8internal40make_block_householder_triangular_factorINS_6MatrixIdLin1ELin1ELi1ELin1ELin1EEENS_5BlockINS2_IdLin1ELin1ELi0ELin1ELin1EEELin1ELin1ELb0EEENS4_IKNS2_IdLin1ELi1ELi0ELin1ELi1EEELin1ELi1ELb0EEEEEvRT_RKT0_RKT1_ |
| 467 | ···463:·0018d | 467 | ···463:·0018d620···101·FUNC····WEAK···DEFAULT···13·_ZSteqIcSt11char_traitsIcESaIcEEbRKNSt7__cxx1112basic_stringIT_T0_T1_EEPKS5_ |
| 468 | ···464:·002c3a | 468 | ···464:·002c3a80··4598·FUNC····WEAK···DEFAULT···13·_ZN9PhyloTree25computeLikelihoodDervSIMDI5Vec2dLb1ELi20ELb0ELb1EEEvP13PhyloNeighborP9PhyloNodePdS6_ |
| 469 | ···465:·004e8b | 469 | ···465:·004e8bd0·····1·FUNC····GLOBAL·DEFAULT···13·_ZN9NxsReader13OutputCommentERK9NxsString |
| 470 | ···466:·0013e | 470 | ···466:·0013e450··3256·FUNC····GLOBAL·DEFAULT···13·_ZN9PhyloTree20computeTraversalInfoEP13PhyloNeighborP9PhyloNodeRPd |
| 471 | ···467:·003b6d | 471 | ···467:·003b6d90····41·FUNC····GLOBAL·DEFAULT···13·_ZN8ModelSet16computeTransDervEdPdS0_S0_i |
| 472 | ···468:·00376d | 472 | ···468:·00376d90··1460·FUNC····GLOBAL·DEFAULT···13·newviewAncestralIterative |
| 473 | ···469:·003e76 | 473 | ···469:·003e76a0····18·FUNC····GLOBAL·DEFAULT···13·_ZTv0_n288_N9ModelPoMo9setBoundsEPdS0_Pb |
| 474 | ···470:·0040 | 474 | ···470:·00403000···910·FUNC····WEAK···DEFAULT···13·_ZN5Eigen8internal20generic_product_implINS_6MatrixIdLin1ELin1ELi1ELin1ELin1EEES3_NS_10DenseShapeES4_Li8EE13scaleAndAddToINS2_IdLin1ELin1ELi0ELin1ELin1EEEEEvRT_RKS3_SB_RKd |
| 475 | ···471:·003dbc | 475 | ···471:·003dbce0·····3·FUNC····GLOBAL·DEFAULT···13·_ZTv0_n92_N20RateHeterotachyInvar7getRateEi |
| 476 | ···472:·0038a | 476 | ···472:·0038af60····30·FUNC····GLOBAL·DEFAULT···13·isTip |
| 477 | ···473:·0050 | 477 | ···473:·005055b0···592·FUNC····GLOBAL·DEFAULT···13·_ZN8terraces15bad_input_errorC2ENS_20bad_input_error_typeENSt7__cxx1112basic_stringIcSt11char_traitsIcESaIcEEE |
| 478 | ···474:·0015fb | 478 | ···474:·0015fbf0··1136·FUNC····GLOBAL·DEFAULT···13·_ZN9PhyloTree29computeMarginalAncestralStateEP13PhyloNeighborP9PhyloNodePdPi |
| 479 | ···475:·0014e6 | 479 | ···475:·0014e6f0···264·FUNC····GLOBAL·DEFAULT···13·_ZN9PhyloTree19optimizeSPRBranchesEv |
| 480 | ···476:·004cbe | 480 | ···476:·004cbea0··1834·FUNC····GLOBAL·DEFAULT···13·_ZN14SuperAlignment16readPartitionDirENSt7__cxx1112basic_stringIcSt11char_traitsIcESaIcEEEPcR9InputTypeS5_b |
| 481 | ···477:·001c4 | 481 | ···477:·001c4770····10·FUNC····GLOBAL·DEFAULT···13·_ZThn128_N18PhyloSuperTreePlen15computeFunctionEd |
| 482 | ···478:·00260 | 482 | ···478:·00260620·····6·FUNC····WEAK···DEFAULT···13·_ZN10ModelSubst12isReversibleEv |
| 483 | ···479:·005c | 483 | ···479:·005cd5e8····11·OBJECT··WEAK···DEFAULT···15·_ZTS9CkpStream |
| 484 | ···480:·00491c | 484 | ···480:·00491cf0··1351·FUNC····GLOBAL·DEFAULT···13·_Z15detectInputFilePKc |
| 485 | ···481:·004df | 485 | ···481:·004df130···282·FUNC····GLOBAL·DEFAULT···13·_ZN18NxsCharactersBlockD1Ev |
| Max diff block lines reached; 1079684/1217219 bytes (88.70%) of diff not shown. | |||
| Offset 1, 680 lines modified | Offset 1, 13 lines modified | ||
| 1 | Relocation·section·'.rel.dyn'·at·offset·0x73248·contains·6153·entries: | 1 | Relocation·section·'.rel.dyn'·at·offset·0x73248·contains·6153·entries: |
| 2 | ·Offset·····Info····Type················Sym.·Value··Symbol's·Name | 2 | ·Offset·····Info····Type················Sym.·Value··Symbol's·Name |
| 3 | 0069216c··00000008·R_386_RELATIVE········ | ||
| 4 | 00692170··00000008·R_386_RELATIVE········ | ||
| 5 | 00692174··00000008·R_386_RELATIVE········ | ||
| 6 | 00692178··00000008·R_386_RELATIVE········ | ||
| 7 | 0069217c··00000008·R_386_RELATIVE········ | ||
| 8 | 00692180··00000008·R_386_RELATIVE········ | ||
| 9 | 00692184··00000008·R_386_RELATIVE········ | ||
| 10 | 00692188··00000008·R_386_RELATIVE········ | ||
| 11 | 0069218c··00000008·R_386_RELATIVE········ | ||
| 12 | 00692190··00000008·R_386_RELATIVE········ | ||
| 13 | 00692194··00000008·R_386_RELATIVE········ | ||
| 14 | 00692198··00000008·R_386_RELATIVE········ | ||
| 15 | 0069219c··00000008·R_386_RELATIVE········ | ||
| 16 | 006921a4··00000008·R_386_RELATIVE········ | ||
| 17 | 006921a8··00000008·R_386_RELATIVE········ | ||
| 18 | 006921ac··00000008·R_386_RELATIVE········ | ||
| 19 | 006921b0··00000008·R_386_RELATIVE········ | ||
| 20 | 006921b4··00000008·R_386_RELATIVE········ | ||
| 21 | 006921b8··00000008·R_386_RELATIVE········ | ||
| 22 | 006921bc··00000008·R_386_RELATIVE········ | ||
| 23 | 006921c0··00000008·R_386_RELATIVE········ | ||
| 24 | 006921c4··00000008·R_386_RELATIVE········ | ||
| 25 | 006921c8··00000008·R_386_RELATIVE········ | ||
| 26 | 006921cc··00000008·R_386_RELATIVE········ | ||
| 27 | 006921d8··00000008·R_386_RELATIVE········ | ||
| 28 | 006921dc··00000008·R_386_RELATIVE········ | ||
| 29 | 006921e0··00000008·R_386_RELATIVE········ | ||
| 30 | 006921ec··00000008·R_386_RELATIVE········ | ||
| 31 | 006921f0··00000008·R_386_RELATIVE········ | ||
| 32 | 006921f4··00000008·R_386_RELATIVE········ | ||
| 33 | 00692200··00000008·R_386_RELATIVE········ | ||
| 34 | 00692204··00000008·R_386_RELATIVE········ | ||
| 35 | 00692208··00000008·R_386_RELATIVE········ | ||
| 36 | 00692210··00000008·R_386_RELATIVE········ | ||
| 37 | 00692214··00000008·R_386_RELATIVE········ | ||
| 38 | 00692218··00000008·R_386_RELATIVE········ | ||
| 39 | 0069221c··00000008·R_386_RELATIVE········ | ||
| 40 | 00692220··00000008·R_386_RELATIVE········ | ||
| 41 | 00692224··00000008·R_386_RELATIVE········ | ||
| 42 | 00692228··00000008·R_386_RELATIVE········ | ||
| 43 | 0069222c··00000008·R_386_RELATIVE········ | ||
| 44 | 00692230··00000008·R_386_RELATIVE········ | ||
| 45 | 00692234··00000008·R_386_RELATIVE········ | ||
| 46 | 00692238··00000008·R_386_RELATIVE········ | ||
| 47 | 0069223c··00000008·R_386_RELATIVE········ | ||
| 48 | 00692240··00000008·R_386_RELATIVE········ | ||
| 49 | 00692244··00000008·R_386_RELATIVE········ | ||
| 50 | 00692248··00000008·R_386_RELATIVE········ | ||
| 51 | 0069224c··00000008·R_386_RELATIVE········ | ||
| 52 | 00692258··00000008·R_386_RELATIVE········ | ||
| 53 | 0069225c··00000008·R_386_RELATIVE········ | ||
| 54 | 00692260··00000008·R_386_RELATIVE········ | ||
| 55 | 0069226c··00000008·R_386_RELATIVE········ | ||
| 56 | 00692270··00000008·R_386_RELATIVE········ | ||
| 57 | 00692274··00000008·R_386_RELATIVE········ | ||
| 58 | 00692280··00000008·R_386_RELATIVE········ | ||
| 59 | 00692284··00000008·R_386_RELATIVE········ | ||
| 60 | 00692288··00000008·R_386_RELATIVE········ | ||
| 61 | 00692290··00000008·R_386_RELATIVE········ | ||
| 62 | 00692294··00000008·R_386_RELATIVE········ | ||
| 63 | 00692298··00000008·R_386_RELATIVE········ | ||
| 64 | 0069229c··00000008·R_386_RELATIVE········ | ||
| 65 | 006922a0··00000008·R_386_RELATIVE········ | ||
| 66 | 006922a4··00000008·R_386_RELATIVE········ | ||
| 67 | 006922a8··00000008·R_386_RELATIVE········ | ||
| 68 | 006922ac··00000008·R_386_RELATIVE········ | ||
| 69 | 006922b0··00000008·R_386_RELATIVE········ | ||
| 70 | 006922b4··00000008·R_386_RELATIVE········ | ||
| 71 | 006922b8··00000008·R_386_RELATIVE········ | ||
| 72 | 006922c0··00000008·R_386_RELATIVE········ | ||
| 73 | 006922c4··00000008·R_386_RELATIVE········ | ||
| 74 | 006922c8··00000008·R_386_RELATIVE········ | ||
| 75 | 006922cc··00000008·R_386_RELATIVE········ | ||
| 76 | 006922d0··00000008·R_386_RELATIVE········ | ||
| 77 | 006922d4··00000008·R_386_RELATIVE········ | ||
| 78 | 006922d8··00000008·R_386_RELATIVE········ | ||
| 79 | 006922dc··00000008·R_386_RELATIVE········ | ||
| 80 | 006922e0··00000008·R_386_RELATIVE········ | ||
| 81 | 006922e4··00000008·R_386_RELATIVE········ | ||
| 82 | 006922e8··00000008·R_386_RELATIVE········ | ||
| 83 | 006922ec··00000008·R_386_RELATIVE········ | ||
| 84 | 006922f0··00000008·R_386_RELATIVE········ | ||
| 85 | 006922f4··00000008·R_386_RELATIVE········ | ||
| 86 | 006922f8··00000008·R_386_RELATIVE········ | ||
| 87 | 006922fc··00000008·R_386_RELATIVE········ | ||
| 88 | 00692300··00000008·R_386_RELATIVE········ | ||
| 89 | 00692304··00000008·R_386_RELATIVE········ | ||
| 90 | 00692308··00000008·R_386_RELATIVE········ | ||
| 91 | 0069230c··00000008·R_386_RELATIVE········ | ||
| 92 | 00692314··00000008·R_386_RELATIVE········ | ||
| 93 | 00692318··00000008·R_386_RELATIVE········ | ||
| 94 | 0069231c··00000008·R_386_RELATIVE········ | ||
| 95 | 00692320··00000008·R_386_RELATIVE········ | ||
| 96 | 00692328··00000008·R_386_RELATIVE········ | ||
| 97 | 0069232c··00000008·R_386_RELATIVE········ | ||
| 98 | 00692330··00000008·R_386_RELATIVE········ | ||
| 99 | 00692334··00000008·R_386_RELATIVE········ | ||
| 100 | 00692338··00000008·R_386_RELATIVE········ | ||
| 101 | 0069233c··00000008·R_386_RELATIVE········ | ||
| 102 | 00692344··00000008·R_386_RELATIVE········ | ||
| 103 | 00692348··00000008·R_386_RELATIVE········ | ||
| 104 | 0069234c··00000008·R_386_RELATIVE········ | ||
| 105 | 00692350··00000008·R_386_RELATIVE········ | ||
| 106 | 00692354··00000008·R_386_RELATIVE········ | ||
| 107 | 00692358··00000008·R_386_RELATIVE········ | ||
| 108 | 0069235c··00000008·R_386_RELATIVE········ | ||
| 109 | 00692360··00000008·R_386_RELATIVE········ | ||
| 110 | 00692364··00000008·R_386_RELATIVE········ | ||
| 111 | 00692368··00000008·R_386_RELATIVE········ | ||
| 112 | 0069236c··00000008·R_386_RELATIVE········ | ||
| 113 | 00692374··00000008·R_386_RELATIVE········ | ||
| 114 | 00692378··00000008·R_386_RELATIVE········ | ||
| 115 | 0069237c··00000008·R_386_RELATIVE········ | ||
| 116 | 00692380··00000008·R_386_RELATIVE········ | ||
| 117 | 00692384··00000008·R_386_RELATIVE········ | ||
| 118 | 00692388··00000008·R_386_RELATIVE········ | ||
| 119 | 0069238c··00000008·R_386_RELATIVE········ | ||
| 120 | 00692390··00000008·R_386_RELATIVE········ | ||
| 121 | 00692394··00000008·R_386_RELATIVE········ | ||
| 122 | 00692398··00000008·R_386_RELATIVE········ | ||
| 123 | 0069239c··00000008·R_386_RELATIVE········ | ||
| 124 | 006923a4··00000008·R_386_RELATIVE········ | ||
| 125 | 006923a8··00000008·R_386_RELATIVE········ | ||
| 126 | 006923ac··00000008·R_386_RELATIVE········ | ||
| Max diff block lines reached; 407696/436623 bytes (93.37%) of diff not shown. | |||
| Offset 1, 29 lines modified | Offset 1, 29 lines modified | ||
| 1 | Dynamic·section·at·offset·0x69 | 1 | Dynamic·section·at·offset·0x69a93c·contains·32·entries: |
| 2 | ··Tag········Type·························Name/Value | 2 | ··Tag········Type·························Name/Value |
| 3 | ·0x00000001·(NEEDED)·····················Shared·library:·[libz.so.1] | 3 | ·0x00000001·(NEEDED)·····················Shared·library:·[libz.so.1] |
| 4 | ·0x00000001·(NEEDED)·····················Shared·library:·[libstdc++.so.6] | 4 | ·0x00000001·(NEEDED)·····················Shared·library:·[libstdc++.so.6] |
| 5 | ·0x00000001·(NEEDED)·····················Shared·library:·[libm.so.6] | 5 | ·0x00000001·(NEEDED)·····················Shared·library:·[libm.so.6] |
| 6 | ·0x00000001·(NEEDED)·····················Shared·library:·[libgomp.so.1] | 6 | ·0x00000001·(NEEDED)·····················Shared·library:·[libgomp.so.1] |
| 7 | ·0x00000001·(NEEDED)·····················Shared·library:·[libgcc_s.so.1] | 7 | ·0x00000001·(NEEDED)·····················Shared·library:·[libgcc_s.so.1] |
| 8 | ·0x00000001·(NEEDED)·····················Shared·library:·[libc.so.6] | 8 | ·0x00000001·(NEEDED)·····················Shared·library:·[libc.so.6] |
| 9 | ·0x0000000c·(INIT)·······················0x80000 | 9 | ·0x0000000c·(INIT)·······················0x80000 |
| 10 | ·0x0000000d·(FINI)·······················0x51 | 10 | ·0x0000000d·(FINI)·······················0x512e54 |
| 11 | ·0x00000019·(INIT_ARRAY)·················0x69 | 11 | ·0x00000019·(INIT_ARRAY)·················0x69316c |
| 12 | ·0x0000001b·(INIT_ARRAYSZ)···············48·(bytes) | 12 | ·0x0000001b·(INIT_ARRAYSZ)···············48·(bytes) |
| 13 | ·0x0000001a·(FINI_ARRAY)·················0x69 | 13 | ·0x0000001a·(FINI_ARRAY)·················0x69319c |
| 14 | ·0x0000001c·(FINI_ARRAYSZ)···············4·(bytes) | 14 | ·0x0000001c·(FINI_ARRAYSZ)···············4·(bytes) |
| 15 | ·0x6ffffef5·(GNU_HASH)···················0x1ec | 15 | ·0x6ffffef5·(GNU_HASH)···················0x1ec |
| 16 | ·0x00000005·(STRTAB)·····················0x232c4 | 16 | ·0x00000005·(STRTAB)·····················0x232c4 |
| 17 | ·0x00000006·(SYMTAB)·····················0xada4 | 17 | ·0x00000006·(SYMTAB)·····················0xada4 |
| 18 | ·0x0000000a·(STRSZ)······················314365·(bytes) | 18 | ·0x0000000a·(STRSZ)······················314365·(bytes) |
| 19 | ·0x0000000b·(SYMENT)·····················16·(bytes) | 19 | ·0x0000000b·(SYMENT)·····················16·(bytes) |
| 20 | ·0x00000015·(DEBUG)······················0x0 | 20 | ·0x00000015·(DEBUG)······················0x0 |
| 21 | ·0x00000003·(PLTGOT)·····················0x69 | 21 | ·0x00000003·(PLTGOT)·····················0x69aa64 |
| 22 | ·0x00000002·(PLTRELSZ)···················2328·(bytes) | 22 | ·0x00000002·(PLTRELSZ)···················2328·(bytes) |
| 23 | ·0x00000014·(PLTREL)·····················REL | 23 | ·0x00000014·(PLTREL)·····················REL |
| 24 | ·0x00000017·(JMPREL)·····················0x7f290 | 24 | ·0x00000017·(JMPREL)·····················0x7f290 |
| 25 | ·0x00000011·(REL)························0x73248 | 25 | ·0x00000011·(REL)························0x73248 |
| 26 | ·0x00000012·(RELSZ)······················49224·(bytes) | 26 | ·0x00000012·(RELSZ)······················49224·(bytes) |
| 27 | ·0x00000013·(RELENT)·····················8·(bytes) | 27 | ·0x00000013·(RELENT)·····················8·(bytes) |
| 28 | ·0x0000001e·(FLAGS)······················BIND_NOW | 28 | ·0x0000001e·(FLAGS)······················BIND_NOW |
| Offset 1, 8 lines modified | Offset 1, 8 lines modified | ||
| 1 | Displaying·notes·found·in:·.note.gnu.build-id | 1 | Displaying·notes·found·in:·.note.gnu.build-id |
| 2 | ··Owner················Data·size·» Description | 2 | ··Owner················Data·size·» Description |
| 3 | ··GNU··················0x00000014» NT_GNU_BUILD_ID·(unique·build·ID·bitstring)» ····Build·ID:· | 3 | ··GNU··················0x00000014» NT_GNU_BUILD_ID·(unique·build·ID·bitstring)» ····Build·ID:·24050f60278d2c0a2b2ce267779cd6da32fb3014 |
| 4 | Displaying·notes·found·in:·.note.ABI-tag | 4 | Displaying·notes·found·in:·.note.ABI-tag |
| 5 | ··Owner················Data·size·» Description | 5 | ··Owner················Data·size·» Description |
| 6 | ··GNU··················0x00000010» NT_GNU_ABI_TAG·(ABI·version·tag)» ····OS:·Linux,·ABI:·3.2.0 | 6 | ··GNU··················0x00000010» NT_GNU_ABI_TAG·(ABI·version·tag)» ····OS:·Linux,·ABI:·3.2.0 |
| Offset 1, 7119 lines modified | Offset 1, 7119 lines modified | ||
| 1 | Contents·of·the·.eh_frame_hdr·section: | 1 | Contents·of·the·.eh_frame_hdr·section: |
| 2 | ··Version:·················1 | 2 | ··Version:·················1 |
| 3 | ··Pointer·Encoding·Format:·0x1b·(sdata4,·pcrel) | 3 | ··Pointer·Encoding·Format:·0x1b·(sdata4,·pcrel) |
| 4 | ··Count·Encoding·Format:···0x3·(udata4,·absolute) | 4 | ··Count·Encoding·Format:···0x3·(udata4,·absolute) |
| 5 | ··Table·Encoding·Format:···0x3b·(sdata4,·datarel) | 5 | ··Table·Encoding·Format:···0x3b·(sdata4,·datarel) |
| 6 | ··Start·of·frame·section:··0xde08·(offset:·0x5e | 6 | ··Start·of·frame·section:··0xde08·(offset:·0x5e5104) | Diff chunk too large, falling back to line-by-line diff (7104 lines added, 7104 lines removed) |
| 7 | ··Entries·in·search·table:·0x1bc0 | 7 | ··Entries·in·search·table:·0x1bc0 |
| 8 | ··0xffffffffffaa | 8 | ··0xffffffffffaa8d28·(offset:·0x80020)·->·0xde50·fde=[····44] |
| 9 | ··0xffffffffffaa | 9 | ··0xffffffffffaa9f68·(offset:·0x81260)·->·0xde74·fde=[····68] |
| 10 | ··0xffffffffffaa | 10 | ··0xffffffffffaa9f88·(offset:·0x81280)·->·0xdef8·fde=[····ec] |
| 11 | ··0xffffffffffaa | 11 | ··0xffffffffffaaa03e·(offset:·0x81336)·->·0xe6e4·fde=[···8d8] |
| 12 | ··0xffffffffffaa | 12 | ··0xffffffffffaaa130·(offset:·0x81428)·->·0xe710·fde=[···904] |
| 13 | ··0xffffffffffaa | 13 | ··0xffffffffffaaa222·(offset:·0x8151a)·->·0xe73c·fde=[···930] |
| 14 | ··0xffffffffffaa | 14 | ··0xffffffffffaaa31a·(offset:·0x81612)·->·0xe768·fde=[···95c] |
| 15 | ··0xffffffffffaa | 15 | ··0xffffffffffaaa412·(offset:·0x8170a)·->·0xefe0·fde=[··11d4] |
| 16 | ··0xffffffffffaa | 16 | ··0xffffffffffaaa434·(offset:·0x8172c)·->·0xf050·fde=[··1244] |
| 17 | ··0xffffffffffaa | 17 | ··0xffffffffffaaa464·(offset:·0x8175c)·->·0xf070·fde=[··1264] |
| 18 | ··0xffffffffffaa | 18 | ··0xffffffffffaaa524·(offset:·0x8181c)·->·0xf1a8·fde=[··139c] |
| 19 | ··0xffffffffffaa | 19 | ··0xffffffffffaaa5a6·(offset:·0x8189e)·->·0xf280·fde=[··1474] |
| 20 | ··0xffffffffffaa | 20 | ··0xffffffffffaaa64e·(offset:·0x81946)·->·0xf7a0·fde=[··1994] |
| 21 | ··0xffffffffffaa | 21 | ··0xffffffffffaaa6ac·(offset:·0x819a4)·->·0xf9dc·fde=[··1bd0] |
| 22 | ··0xffffffffffaa | 22 | ··0xffffffffffaaa6b2·(offset:·0x819aa)·->·0xfa30·fde=[··1c24] |
| 23 | ··0xffffffffffaa | 23 | ··0xffffffffffaaa790·(offset:·0x81a88)·->·0xfaec·fde=[··1ce0] |
| 24 | ··0xffffffffffaa | 24 | ··0xffffffffffaaa7ac·(offset:·0x81aa4)·->·0xfe50·fde=[··2044] |
| 25 | ··0xffffffffffaa | 25 | ··0xffffffffffaaa84d·(offset:·0x81b45)·->·0xff28·fde=[··211c] |
| 26 | ··0xffffffffffaa | 26 | ··0xffffffffffaaa990·(offset:·0x81c88)·->·0x1019c·fde=[··2390] |
| 27 | ··0xffffffffffaa | 27 | ··0xffffffffffaaa996·(offset:·0x81c8e)·->·0x103c0·fde=[··25b4] |
| 28 | ··0xffffffffffaa | 28 | ··0xffffffffffaaaa1c·(offset:·0x81d14)·->·0x10430·fde=[··2624] |
| 29 | ··0xffffffffffaa | 29 | ··0xffffffffffaaab98·(offset:·0x81e90)·->·0x10494·fde=[··2688] |
| 30 | ··0xffffffffffaa | 30 | ··0xffffffffffaaabe6·(offset:·0x81ede)·->·0x10724·fde=[··2918] |
| 31 | ··0xffffffffffaa | 31 | ··0xffffffffffaaac06·(offset:·0x81efe)·->·0x10788·fde=[··297c] |
| 32 | ··0xffffffffffaa | 32 | ··0xffffffffffaaad36·(offset:·0x8202e)·->·0x10928·fde=[··2b1c] |
| 33 | ··0xffffffffffaa | 33 | ··0xffffffffffaaad3c·(offset:·0x82034)·->·0x10a48·fde=[··2c3c] |
| 34 | ··0xffffffffffaa | 34 | ··0xffffffffffaaad50·(offset:·0x82048)·->·0x10b98·fde=[··2d8c] |
| 35 | ··0xffffffffffaa | 35 | ··0xffffffffffaaad6c·(offset:·0x82064)·->·0x10eb0·fde=[··30a4] |
| 36 | ··0xffffffffffaa | 36 | ··0xffffffffffaaad76·(offset:·0x8206e)·->·0x10f84·fde=[··3178] |
| 37 | ··0xffffffffffaa | 37 | ··0xffffffffffaaad80·(offset:·0x82078)·->·0x11110·fde=[··3304] |
| 38 | ··0xffffffffffaa | 38 | ··0xffffffffffaaadc0·(offset:·0x820b8)·->·0x111d4·fde=[··33c8] |
| 39 | ··0xffffffffffaa | 39 | ··0xffffffffffaaade8·(offset:·0x820e0)·->·0x1126c·fde=[··3460] |
| 40 | ··0xffffffffffaa | 40 | ··0xffffffffffaaadf9·(offset:·0x820f1)·->·0x1131c·fde=[··3510] |
| 41 | ··0xffffffffffaa | 41 | ··0xffffffffffaab09e·(offset:·0x82396)·->·0x114e4·fde=[··36d8] |
| 42 | ··0xffffffffffaa | 42 | ··0xffffffffffaab182·(offset:·0x8247a)·->·0x11980·fde=[··3b74] |
| 43 | ··0xffffffffffaa | 43 | ··0xffffffffffaab39c·(offset:·0x82694)·->·0x119ec·fde=[··3be0] |
| 44 | ··0xffffffffffaa | 44 | ··0xffffffffffaab50c·(offset:·0x82804)·->·0x11a50·fde=[··3c44] |
| 45 | ··0xffffffffffaa | 45 | ··0xffffffffffaab69c·(offset:·0x82994)·->·0x11d00·fde=[··3ef4] |
| 46 | ··0xffffffffffaa | 46 | ··0xffffffffffaab6b4·(offset:·0x829ac)·->·0x11d54·fde=[··3f48] |
| 47 | ··0xffffffffffaa | 47 | ··0xffffffffffaab708·(offset:·0x82a00)·->·0x11db0·fde=[··3fa4] |
| 48 | ··0xffffffffffaa | 48 | ··0xffffffffffaab7ce·(offset:·0x82ac6)·->·0x11e10·fde=[··4004] |
| 49 | ··0xffffffffffaa | 49 | ··0xffffffffffaab896·(offset:·0x82b8e)·->·0x11e70·fde=[··4064] |
| 50 | ··0xffffffffffaa | 50 | ··0xffffffffffaabc82·(offset:·0x82f7a)·->·0x11edc·fde=[··40d0] |
| 51 | ··0xffffffffffaa | 51 | ··0xffffffffffaabd2c·(offset:·0x83024)·->·0x11f40·fde=[··4134] |
| 52 | ··0xffffffffffaa | 52 | ··0xffffffffffaabdd6·(offset:·0x830ce)·->·0x11fa4·fde=[··4198] |
| 53 | ··0xffffffffffaa | 53 | ··0xffffffffffaabf16·(offset:·0x8320e)·->·0x12150·fde=[··4344] |
| 54 | ··0xffffffffffaa | 54 | ··0xffffffffffaac280·(offset:·0x83578)·->·0x121cc·fde=[··43c0] |
| 55 | ··0xffffffffffaa | 55 | ··0xffffffffffaac418·(offset:·0x83710)·->·0x126ac·fde=[··48a0] |
| 56 | ··0xffffffffffaa | 56 | ··0xffffffffffaac780·(offset:·0x83a78)·->·0x12710·fde=[··4904] |
| 57 | ··0xffffffffffaa | 57 | ··0xffffffffffaaca78·(offset:·0x83d70)·->·0x12cb0·fde=[··4ea4] |
| 58 | ··0xffffffffffaa | 58 | ··0xffffffffffaacae6·(offset:·0x83dde)·->·0x12d4c·fde=[··4f40] |
| 59 | ··0xffffffffffaa | 59 | ··0xffffffffffaaccfa·(offset:·0x83ff2)·->·0x12f1c·fde=[··5110] |
| 60 | ··0xffffffffffaa | 60 | ··0xffffffffffaacd32·(offset:·0x8402a)·->·0x13d64·fde=[··5f58] |
| 61 | ··0xffffffffffaa | 61 | ··0xffffffffffaacd9c·(offset:·0x84094)·->·0x13f20·fde=[··6114] |
| 62 | ··0xffffffffffaa | 62 | ··0xffffffffffaacdfc·(offset:·0x840f4)·->·0x13ff4·fde=[··61e8] |
| 63 | ··0xffffffffffaa | 63 | ··0xffffffffffaace12·(offset:·0x8410a)·->·0x143d8·fde=[··65cc] |
| 64 | ··0xffffffffffaa | 64 | ··0xffffffffffaacf30·(offset:·0x84228)·->·0x145a4·fde=[··6798] |
| 65 | ··0xffffffffffaa | 65 | ··0xffffffffffaad064·(offset:·0x8435c)·->·0x14618·fde=[··680c] |
| 66 | ··0xffffffffffaa | 66 | ··0xffffffffffaad176·(offset:·0x8446e)·->·0x14674·fde=[··6868] |
| 67 | ··0xffffffffffaa | 67 | ··0xffffffffffaad35a·(offset:·0x84652)·->·0x146d0·fde=[··68c4] |
| 68 | ··0xffffffffffaa | 68 | ··0xffffffffffaad3c0·(offset:·0x846b8)·->·0x1472c·fde=[··6920] |
| 69 | ··0xffffffffffaa | 69 | ··0xffffffffffaad492·(offset:·0x8478a)·->·0x14788·fde=[··697c] |
| 70 | ··0xffffffffffaa | 70 | ··0xffffffffffaad4d6·(offset:·0x847ce)·->·0x147e4·fde=[··69d8] |
| 71 | ··0xffffffffffaa | 71 | ··0xffffffffffaad59e·(offset:·0x84896)·->·0x1483c·fde=[··6a30] |
| 72 | ··0xffffffffffaa | 72 | ··0xffffffffffaad63a·(offset:·0x84932)·->·0x1489c·fde=[··6a90] |
| 73 | ··0xffffffffffaa | 73 | ··0xffffffffffaad6ee·(offset:·0x849e6)·->·0x148f8·fde=[··6aec] |
| 74 | ··0xffffffffffaa | 74 | ··0xffffffffffaadc6a·(offset:·0x84f62)·->·0x14990·fde=[··6b84] |
| 75 | ··0xffffffffffaa | 75 | ··0xffffffffffaae1f4·(offset:·0x854ec)·->·0x14a34·fde=[··6c28] |
| 76 | ··0xffffffffffaa | 76 | ··0xffffffffffaae610·(offset:·0x85908)·->·0x14ab4·fde=[··6ca8] |
| 77 | ··0xffffffffffaa | 77 | ··0xffffffffffaaed54·(offset:·0x8604c)·->·0x14b48·fde=[··6d3c] |
| 78 | ··0xffffffffffa | 78 | ··0xffffffffffaaf198·(offset:·0x86490)·->·0x14bd4·fde=[··6dc8] |
| 79 | ··0xffffffffffa | 79 | ··0xffffffffffaaf7b4·(offset:·0x86aac)·->·0x14c64·fde=[··6e58] |
| 80 | ··0xffffffffffab | 80 | ··0xffffffffffab06e8·(offset:·0x879e0)·->·0x14ce0·fde=[··6ed4] |
| 81 | ··0xffffffffffab | 81 | ··0xffffffffffab17e4·(offset:·0x88adc)·->·0x14db8·fde=[··6fac] |
| 82 | ··0xffffffffffab | 82 | ··0xffffffffffab1b00·(offset:·0x88df8)·->·0x14e20·fde=[··7014] |
| 83 | ··0xffffffffffab | 83 | ··0xffffffffffab1b4c·(offset:·0x88e44)·->·0x14e80·fde=[··7074] |
| 84 | ··0xffffffffffab | 84 | ··0xffffffffffab1ba2·(offset:·0x88e9a)·->·0x14ef4·fde=[··70e8] |
| 85 | ··0xffffffffffab | 85 | ··0xffffffffffab1c4e·(offset:·0x88f46)·->·0x14f50·fde=[··7144] |
| 86 | ··0xffffffffffab | 86 | ··0xffffffffffab1cd8·(offset:·0x88fd0)·->·0x14fac·fde=[··71a0] |
| 87 | ··0xffffffffffab | 87 | ··0xffffffffffab1d24·(offset:·0x8901c)·->·0x15004·fde=[··71f8] |
| 88 | ··0xffffffffffab | 88 | ··0xffffffffffab1d9a·(offset:·0x89092)·->·0x1505c·fde=[··7250] |
| 89 | ··0xffffffffffab | 89 | ··0xffffffffffab1dce·(offset:·0x890c6)·->·0x150c8·fde=[··72bc] |
| 90 | ··0xffffffffffab | 90 | ··0xffffffffffab2014·(offset:·0x8930c)·->·0x1512c·fde=[··7320] |
| 91 | ··0xffffffffffab | 91 | ··0xffffffffffab20ae·(offset:·0x893a6)·->·0x15188·fde=[··737c] |
| 92 | ··0xffffffffffab | 92 | ··0xffffffffffab21ce·(offset:·0x894c6)·->·0x151ec·fde=[··73e0] |
| 93 | ··0xffffffffffab | 93 | ··0xffffffffffab24d0·(offset:·0x897c8)·->·0x1524c·fde=[··7440] |
| 94 | ··0xffffffffffab | 94 | ··0xffffffffffab24fe·(offset:·0x897f6)·->·0x152a8·fde=[··749c] |
| 95 | ··0xffffffffffab | 95 | ··0xffffffffffab25da·(offset:·0x898d2)·->·0x15308·fde=[··74fc] |
| 96 | ··0xffffffffffab | 96 | ··0xffffffffffab268a·(offset:·0x89982)·->·0x15364·fde=[··7558] |
| 97 | ··0xffffffffffab | 97 | ··0xffffffffffab26dc·(offset:·0x899d4)·->·0x153c4·fde=[··75b8] |
| 98 | ··0xffffffffffab | 98 | ··0xffffffffffab272c·(offset:·0x89a24)·->·0x1542c·fde=[··7620] |
| 99 | ··0xffffffffffab | 99 | ··0xffffffffffab28f8·(offset:·0x89bf0)·->·0x154c0·fde=[··76b4] |
| 100 | ··0xffffffffffab | 100 | ··0xffffffffffab2eeb·(offset:·0x8a1e3)·->·0xfb18·fde=[··1d0c] |
| 101 | ··0xffffffffffab | 101 | ··0xffffffffffab2f21·(offset:·0x8a219)·->·0x12944·fde=[··4b38] |
| 102 | ··0xffffffffffab | 102 | ··0xffffffffffab2fa8·(offset:·0x8a2a0)·->·0x129b8·fde=[··4bac] |
| 103 | ··0xffffffffffab | 103 | ··0xffffffffffab302f·(offset:·0x8a327)·->·0x13628·fde=[··581c] |
| 104 | ··0xffffffffffab | 104 | ··0xffffffffffab30b6·(offset:·0x8a3ae)·->·0x1561c·fde=[··7810] |
| 105 | ··0xffffffffffab | 105 | ··0xffffffffffab30c6·(offset:·0x8a3be)·->·0x15b0c·fde=[··7d00] |
| 106 | ··0xffffffffffab | 106 | ··0xffffffffffab30da·(offset:·0x8a3d2)·->·0x15b64·fde=[··7d58] |
| 107 | ··0xffffffffffab | 107 | ··0xffffffffffab30ee·(offset:·0x8a3e6)·->·0x15ec8·fde=[··80bc] |
| 108 | ··0xffffffffffab | 108 | ··0xffffffffffab3104·(offset:·0x8a3fc)·->·0x164bc·fde=[··86b0] |
| 109 | ··0xffffffffffab | 109 | ··0xffffffffffab312e·(offset:·0x8a426)·->·0x16514·fde=[··8708] |
| 110 | ··0xffffffffffab | 110 | ··0xffffffffffab3158·(offset:·0x8a450)·->·0x1699c·fde=[··8b90] |
| 111 | ··0xffffffffffab | 111 | ··0xffffffffffab3182·(offset:·0x8a47a)·->·0x16ccc·fde=[··8ec0] |
| 112 | ··0xffffffffffab | 112 | ··0xffffffffffab31e0·(offset:·0x8a4d8)·->·0x16df0·fde=[··8fe4] |
| 113 | ··0xffffffffffab | 113 | ··0xffffffffffab323e·(offset:·0x8a536)·->·0x16e64·fde=[··9058] |
| 114 | ··0xffffffffffab | 114 | ··0xffffffffffab343a·(offset:·0x8a732)·->·0x16f64·fde=[··9158] |
| 115 | ··0xffffffffffab | 115 | ··0xffffffffffab3444·(offset:·0x8a73c)·->·0x170e0·fde=[··92d4] |
| 116 | ··0xffffffffffab45 | 116 | ··0xffffffffffab345c·(offset:·0x8a754)·->·0x17754·fde=[··9948] |
| 117 | ··0xffffffffffab | 117 | ··0xffffffffffab356a·(offset:·0x8a862)·->·0x177b4·fde=[··99a8] |
| 118 | ··0xffffffffffab | 118 | ··0xffffffffffab35ce·(offset:·0x8a8c6)·->·0x17810·fde=[··9a04] |
| 119 | ··0xffffffffffab | 119 | ··0xffffffffffab3622·(offset:·0x8a91a)·->·0x1786c·fde=[··9a60] |
| 120 | ··0xffffffffffab | 120 | ··0xffffffffffab3686·(offset:·0x8a97e)·->·0x17ca8·fde=[··9e9c] |
| 121 | ··0xffffffffffab | 121 | ··0xffffffffffab3690·(offset:·0x8a988)·->·0x17d00·fde=[··9ef4] |
| 122 | ··0xffffffffffab | 122 | ··0xffffffffffab36da·(offset:·0x8a9d2)·->·0x17d58·fde=[··9f4c] |
| 123 | ··0xffffffffffab | 123 | ··0xffffffffffab3726·(offset:·0x8aa1e)·->·0x17dd8·fde=[··9fcc] |
| 124 | ··0xffffffffffab | 124 | ··0xffffffffffab372c·(offset:·0x8aa24)·->·0x17e68·fde=[··a05c] |
| 125 | ··0xffffffffffab | 125 | ··0xffffffffffab3740·(offset:·0x8aa38)·->·0x180a4·fde=[··a298] |
| Max diff block lines reached; 14661250/15581660 bytes (94.09%) of diff not shown. | |||
| Offset 6142, 15 lines modified | Offset 6142, 15 lines modified | ||
| 6142 | |$49|$$t | 6142 | |$49|$$t |
| 6143 | D$,9D$P~ | 6143 | D$,9D$P~ |
| 6144 | D$(9D$`~4 | 6144 | D$(9D$`~4 |
| 6145 | |$89T$<t| | 6145 | |$89T$<t| |
| 6146 | t$H+t$D) | 6146 | t$H+t$D) |
| 6147 | D$H9D$$uh | 6147 | D$H9D$$uh |
| 6148 | y<-t]<.u( | 6148 | y<-t]<.u( |
| 6149 | t | 6149 | tT9t$4sV |
| 6150 | l"Htotal·length:· | 6150 | l"Htotal·length:· |
| 6151 | mean·length:· | 6151 | mean·length:· |
| 6152 | Parsimony·score·is:· | 6152 | Parsimony·score·is:· |
| 6153 | Error·found·at·line· | 6153 | Error·found·at·line· |
| 6154 | ,·column· | 6154 | ,·column· |
| 6155 | ·(file·position· | 6155 | ·(file·position· |
| 6156 | shuffleAlignment | 6156 | shuffleAlignment |
| Offset 13843, 18 lines modified | Offset 13843, 14 lines modified | ||
| 13843 | i·<=·basic_bitvector<Alloc>::m_size | 13843 | i·<=·basic_bitvector<Alloc>::m_size |
| 13844 | bool·terraces::bitmatrix::get(terraces::index,·terraces::index)·const | 13844 | bool·terraces::bitmatrix::get(terraces::index,·terraces::index)·const |
| 13845 | ./terraphast/lib/bitmatrix.cpp | 13845 | ./terraphast/lib/bitmatrix.cpp |
| 13846 | void·terraces::bitmatrix::set(terraces::index,·terraces::index,·bool) | 13846 | void·terraces::bitmatrix::set(terraces::index,·terraces::index,·bool) |
| 13847 | terraces::bitmatrix·terraces::bitmatrix::get_cols(const·std::vector<unsigned·int>&)·const | 13847 | terraces::bitmatrix·terraces::bitmatrix::get_cols(const·std::vector<unsigned·int>&)·const |
| 13848 | bool·terraces::is_leaf(const·node&) | 13848 | bool·terraces::is_leaf(const·node&) |
| 13849 | (n.lchild()·==·n.rchild())·==·(n.lchild()·==·none) | 13849 | (n.lchild()·==·n.rchild())·==·(n.lchild()·==·none) |
| 13850 | Mismatching·parentheses·in·nwk·tree | ||
| 13851 | Only·bifurcating·trees·are·supported | ||
| 13852 | Mismatching·number·of·rows/columns·between·bitmatrix·header·and·content | ||
| 13853 | Mismatching·size·between·tree·and·bitmatrix | ||
| 13854 | std::ostream&·terraces::print_multitree_node(std::ostream&,·const·multitree_node*,·const·name_map&) | 13850 | std::ostream&·terraces::print_multitree_node(std::ostream&,·const·multitree_node*,·const·name_map&) |
| 13855 | ./terraphast/lib/multitree.cpp | 13851 | ./terraphast/lib/multitree.cpp |
| 13856 | static·terraces::small_bipartition·terraces::small_bipartition::full_set(terraces::index) | 13852 | static·terraces::small_bipartition·terraces::small_bipartition::full_set(terraces::index) |
| 13857 | ./terraphast/lib/small_bipartition.hpp | 13853 | ./terraphast/lib/small_bipartition.hpp |
| 13858 | void·terraces::multitree_iterator::init_subtree(terraces::index) | 13854 | void·terraces::multitree_iterator::init_subtree(terraces::index) |
| 13859 | ./terraphast/lib/multitree_iterator.cpp | 13855 | ./terraphast/lib/multitree_iterator.cpp |
| 13860 | false·&&·"Malformed·multitree:·Nested·alternative_arrays" | 13856 | false·&&·"Malformed·multitree:·Nested·alternative_arrays" |
| Offset 13987, 14 lines modified | Offset 13983, 15 lines modified | ||
| 13987 | ERROR:·FTOL·.LT.ERROR:·GTOL·.LT.ERROR:·XTOL·.LT.ERROR:·STPMIN·.LERROR:·STPMAX·.LMAX·.LT.·STPMIN | 13983 | ERROR:·FTOL·.LT.ERROR:·GTOL·.LT.ERROR:·XTOL·.LT.ERROR:·STPMIN·.LERROR:·STPMAX·.LMAX·.LT.·STPMIN |
| 13988 | WARNING:·ROUNDING·ERRORS·PREVENTREVENT·PROGRESS | 13984 | WARNING:·ROUNDING·ERRORS·PREVENTREVENT·PROGRESS |
| 13989 | WARNING:·XTOL·TE·TEST·SATISFIED | 13985 | WARNING:·XTOL·TE·TEST·SATISFIED |
| 13990 | WARNING:·STP·=·SCONVERGENCE:·NORM·OF·PROJECTED·GRADIENT·<=·PGTOLWARNING:·ABNORMAL_TERMINATION_INRESTART_FROM_LNSCONVERGENCE:·REL_REDUCTION_OF_F·<=·FACTR*EPSMCH | 13986 | WARNING:·STP·=·SCONVERGENCE:·NORM·OF·PROJECTED·GRADIENT·<=·PGTOLWARNING:·ABNORMAL_TERMINATION_INRESTART_FROM_LNSCONVERGENCE:·REL_REDUCTION_OF_F·<=·FACTR*EPSMCH |
| 13991 | PAACDEFGHIKLMNPQRS·among·stored·chcharacter·labels)·is·invalid;·must·be·greater·th0123456789ABCDEF()[]{}/\,;:=*'"`·block·contains··command,·but·fo]·is·not·a·valid·command·comment | 13987 | PAACDEFGHIKLMNPQRS·among·stored·chcharacter·labels)·is·invalid;·must·be·greater·th0123456789ABCDEF()[]{}/\,;:=*'"`·block·contains··command,·but·fo]·is·not·a·valid·command·comment |
| 13992 | The·number·of·TRANSLATE·entries·should·equal·the·number·of·taxa | 13988 | The·number·of·TRANSLATE·entries·should·equal·the·number·of·taxa |
| 13993 | Perhaps·there·were·fewer·taxa·in·the·tree·file·than·previously· | 13989 | Perhaps·there·were·fewer·taxa·in·the·tree·file·than·previously· |
| 13990 | Mismatching·quototes·in·nwk·treeUnknown·taxon·inaxon·in·nwk·treeDuplicate·taxon·Malformed·nwk·trLess·than·4·taxataxa·in·nwk·treeon·in·bitmatrix·Empty·taxon·nameame·in·bitmatrixMalformed·bitmatee·and·bitmatrixUnnamed·leaf·fouaf·found·in·treeUUU | ||
| 13994 | f?=UUUUU | 13991 | f?=UUUUU |
| 13995 | ?St12_Vector_baseIjSaIjEE | 13992 | ?St12_Vector_baseIjSaIjEE |
| 13996 | St6vectorIjSaIjEE | 13993 | St6vectorIjSaIjEE |
| 13997 | 7Pattern | 13994 | 7Pattern |
| 13998 | __root__ | 13995 | __root__ |
| 13999 | Number·of·taxa·must·be·greater·than·2. | 13996 | Number·of·taxa·must·be·greater·than·2. |
| 14000 | 9CkpStream | 13997 | 9CkpStream |
| Offset 14360, 14 lines modified | Offset 14357, 15 lines modified | ||
| 14360 | 12NxsTaxaBlock | 14357 | 12NxsTaxaBlock |
| 14361 | 8NxsToken | 14358 | 8NxsToken |
| 14362 | 13NxsTreesBlock | 14359 | 13NxsTreesBlock |
| 14363 | 16NxsDiscreteDatum | 14360 | 16NxsDiscreteDatum |
| 14364 | N8terraces15bad_input_errorE | 14361 | N8terraces15bad_input_errorE |
| 14365 | N8terraces20no_usable_root_errorE | 14362 | N8terraces20no_usable_root_errorE |
| 14366 | N8terraces25tree_count_overflow_errorE | 14363 | N8terraces25tree_count_overflow_errorE |
| 14364 | Mismatching·parentheses·in·nwk·tOnly·bifurcating·trees·are·suppoMismatching·number·of·rows/columns·between·bitmatrix·header·and·Mismatching·size·between·tree·an | ||
| 14367 | o.0z.·\. | 14365 | o.0z.·\. |
| 14368 | KNKNTTTTRSRSIIMIQHQHPPPPRRRRLLLLEDEDAAAAGGGGVVVV*Y*YSSSSGCWCLFLF | 14366 | KNKNTTTTRSRSIIMIQHQHPPPPRRRRLLLLEDEDAAAAGGGGVVVV*Y*YSSSSGCWCLFLF |
| 14369 | KNKNTTTTSSKSIIMIQHQHPPPPRRRRLLLLEDEDAAAAGGGGVVVV*Y*YSSSSWCWCLFLF | 14367 | KNKNTTTTSSKSIIMIQHQHPPPPRRRRLLLLEDEDAAAAGGGGVVVV*Y*YSSSSWCWCLFLF |
| 14370 | KNKNTTTTRSRSIIMIQHQHPPPPRRRRLLLLEDEDAAAAGGGGVVVV*Y*YSSSS*CWC*FLF | 14368 | KNKNTTTTRSRSIIMIQHQHPPPPRRRRLLLLEDEDAAAAGGGGVVVV*Y*YSSSS*CWC*FLF |
| 14371 | KNKNTTTTRSRSIIMIQHQHPPPPRRRRLLLLEDEDAAAAGGGGVVVV*YLY*SSS*CWCLFLF | 14369 | KNKNTTTTRSRSIIMIQHQHPPPPRRRRLLLLEDEDAAAAGGGGVVVV*YLY*SSS*CWCLFLF |
| 14372 | NNKNTTTTSSSSMIMIQHQHPPPPRRRRLLLLEDEDAAAAGGGGVVVV*Y*YSSSSWCWCLFLF | 14370 | NNKNTTTTSSSSMIMIQHQHPPPPRRRRLLLLEDEDAAAAGGGGVVVV*Y*YSSSSWCWCLFLF |
| 14373 | KNKNTTTTRSRSIIMIQHQHPPPPRRRRLLLLEDEDAAAAGGGGVVVV*YLYSSSS*CWCLFLF | 14371 | KNKNTTTTRSRSIIMIQHQHPPPPRRRRLLLLEDEDAAAAGGGGVVVV*YLYSSSS*CWCLFLF |
| Offset 3, 16 lines modified | Offset 3, 16 lines modified | ||
| 3 | Disassembly·of·section·.init: | 3 | Disassembly·of·section·.init: |
| 4 | 00080000·<.init>: | 4 | 00080000·<.init>: |
| 5 | _init(): | 5 | _init(): |
| 6 | » push···%ebx | 6 | » push···%ebx |
| 7 | » sub····$0x8,%esp | 7 | » sub····$0x8,%esp |
| 8 | » call···e7 | 8 | » call···e7e60·<_start@@Base+0x30> |
| 9 | » add····$0x61 | 9 | » add····$0x61aa5b,%ebx |
| 10 | » mov····0x56c(%ebx),%eax | 10 | » mov····0x56c(%ebx),%eax |
| 11 | » test···%eax,%eax | 11 | » test···%eax,%eax |
| 12 | » je·····8001b·<__printf_chk@plt-0x15> | 12 | » je·····8001b·<__printf_chk@plt-0x15> |
| 13 | » call···*%eax | 13 | » call···*%eax |
| 14 | » add····$0x8,%esp | 14 | » add····$0x8,%esp |
| 15 | » pop····%ebx | 15 | » pop····%ebx |
| 16 | » ret | 16 | » ret |
| Offset 10, 28 lines modified | Offset 10, 28 lines modified | ||
| 10 | » sub····%gs:0x14,%eax | 10 | » sub····%gs:0x14,%eax |
| 11 | » jne····812a2·<free@plt+0x32> | 11 | » jne····812a2·<free@plt+0x32> |
| 12 | » call···80b40·<std::__throw_bad_cast()@plt> | 12 | » call···80b40·<std::__throw_bad_cast()@plt> |
| 13 | » mov····-0x1c(%ebp),%eax | 13 | » mov····-0x1c(%ebp),%eax |
| 14 | » sub····%gs:0x14,%eax | 14 | » sub····%gs:0x14,%eax |
| 15 | » jne····812a7·<free@plt+0x37> | 15 | » jne····812a7·<free@plt+0x37> |
| 16 | » call···80b40·<std::__throw_bad_cast()@plt> | 16 | » call···80b40·<std::__throw_bad_cast()@plt> |
| 17 | » call···51 | 17 | » call···512e40·<terraces::basic_bitvector<std::allocator<unsigned·int>·>*·std::__do_uninit_fill_n<terraces::basic_bitvector<std::allocator<unsigned·int>·>*,·unsigned·int,·terraces::basic_bitvector<std::allocator<unsigned·int>·>·>(terraces::basic_bitvector<std::allocator<unsigned·int>·>*,·unsigned·int,·terraces::basic_bitvector<std::allocator<unsigned·int>·>·const&)@@Base+0x180> |
| 18 | » call···51 | 18 | » call···512e40·<terraces::basic_bitvector<std::allocator<unsigned·int>·>*·std::__do_uninit_fill_n<terraces::basic_bitvector<std::allocator<unsigned·int>·>*,·unsigned·int,·terraces::basic_bitvector<std::allocator<unsigned·int>·>·>(terraces::basic_bitvector<std::allocator<unsigned·int>·>*,·unsigned·int,·terraces::basic_bitvector<std::allocator<unsigned·int>·>·const&)@@Base+0x180> |
| 19 | ./build.omp/./obsolete/parsmultistate.cpp:48 | 19 | ./build.omp/./obsolete/parsmultistate.cpp:48 |
| 20 | » sub····$0xc,%esp | 20 | » sub····$0xc,%esp |
| 21 | » mov····%eax,-0xf9c(%ebp) | 21 | » mov····%eax,-0xf9c(%ebp) |
| 22 | » mov····%esi,%ebx | 22 | » mov····%esi,%ebx |
| 23 | » push···%edi | 23 | » push···%edi |
| 24 | » call···161 | 24 | » call···161c00·<ParsTree::~ParsTree()@@Base> |
| 25 | » mov····-0xf9c(%ebp),%edi | 25 | » mov····-0xf9c(%ebp),%edi |
| 26 | » add····$0x10,%esp | 26 | » add····$0x10,%esp |
| 27 | » sub····$0xc,%esp | 27 | » sub····$0xc,%esp |
| 28 | » push···-0xfa0(%ebp) | 28 | » push···-0xfa0(%ebp) |
| 29 | » mov····%esi,%ebx | 29 | » mov····%esi,%ebx |
| 30 | » call···f3 | 30 | » call···f3e70·<Alignment::~Alignment()@@Base> |
| 31 | » add····$0x10,%esp | 31 | » add····$0x10,%esp |
| 32 | » mov····-0x1c(%ebp),%eax | 32 | » mov····-0x1c(%ebp),%eax |
| 33 | » sub····%gs:0x14,%eax | 33 | » sub····%gs:0x14,%eax |
| 34 | » jne····81331·<free@plt+0xc1> | 34 | » jne····81331·<free@plt+0xc1> |
| 35 | » sub····$0xc,%esp | 35 | » sub····$0xc,%esp |
| 36 | » push···%edi | 36 | » push···%edi |
| 37 | » call···80fc0·<_Unwind_Resume@plt> | 37 | » call···80fc0·<_Unwind_Resume@plt> |
| Offset 50, 27 lines modified | Offset 50, 27 lines modified | ||
| 50 | » mov····-0x1c(%ebp),%eax | 50 | » mov····-0x1c(%ebp),%eax |
| 51 | » sub····%gs:0x14,%eax | 51 | » sub····%gs:0x14,%eax |
| 52 | » jne····8132c·<free@plt+0xbc> | 52 | » jne····8132c·<free@plt+0xbc> |
| 53 | » sub····$0xc,%esp | 53 | » sub····$0xc,%esp |
| 54 | » push···-0xf9c(%ebp) | 54 | » push···-0xf9c(%ebp) |
| 55 | » call···80fc0·<_Unwind_Resume@plt> | 55 | » call···80fc0·<_Unwind_Resume@plt> |
| 56 | /usr/include/c++/14/bits/basic_ios.h:50 | 56 | /usr/include/c++/14/bits/basic_ios.h:50 |
| 57 | » call···51 | 57 | » call···512e40·<terraces::basic_bitvector<std::allocator<unsigned·int>·>*·std::__do_uninit_fill_n<terraces::basic_bitvector<std::allocator<unsigned·int>·>*,·unsigned·int,·terraces::basic_bitvector<std::allocator<unsigned·int>·>·>(terraces::basic_bitvector<std::allocator<unsigned·int>·>*,·unsigned·int,·terraces::basic_bitvector<std::allocator<unsigned·int>·>·const&)@@Base+0x180> |
| 58 | » call···51 | 58 | » call···512e40·<terraces::basic_bitvector<std::allocator<unsigned·int>·>*·std::__do_uninit_fill_n<terraces::basic_bitvector<std::allocator<unsigned·int>·>*,·unsigned·int,·terraces::basic_bitvector<std::allocator<unsigned·int>·>·>(terraces::basic_bitvector<std::allocator<unsigned·int>·>*,·unsigned·int,·terraces::basic_bitvector<std::allocator<unsigned·int>·>·const&)@@Base+0x180> |
| 59 | » call···51 | 59 | » call···512e40·<terraces::basic_bitvector<std::allocator<unsigned·int>·>*·std::__do_uninit_fill_n<terraces::basic_bitvector<std::allocator<unsigned·int>·>*,·unsigned·int,·terraces::basic_bitvector<std::allocator<unsigned·int>·>·>(terraces::basic_bitvector<std::allocator<unsigned·int>·>*,·unsigned·int,·terraces::basic_bitvector<std::allocator<unsigned·int>·>·const&)@@Base+0x180> |
| 60 | 00081336·<boost::wrapexcept<std::overflow_error>::rethrow()·const@@Base>: | 60 | 00081336·<boost::wrapexcept<std::overflow_error>::rethrow()·const@@Base>: |
| 61 | boost::wrapexcept<std::overflow_error>::rethrow()·const: | 61 | boost::wrapexcept<std::overflow_error>::rethrow()·const: |
| 62 | /usr/include/boost/throw_exception.hpp:123 | 62 | /usr/include/boost/throw_exception.hpp:123 |
| 63 | » push···%ebp | 63 | » push···%ebp |
| 64 | » mov····%esp,%ebp | 64 | » mov····%esp,%ebp |
| 65 | » push···%edi | 65 | » push···%edi |
| 66 | » push···%esi | 66 | » push···%esi |
| 67 | » call···e8 | 67 | » call···e8366·<std::ctype<char>::do_widen(char)·const@@Base+0x6> |
| 68 | » add····$0x61 | 68 | » add····$0x619724,%esi |
| 69 | » push···%ebx | 69 | » push···%ebx |
| 70 | » sub····$0x28,%esp | 70 | » sub····$0x28,%esp |
| 71 | /usr/include/boost/throw_exception.hpp:131 | 71 | /usr/include/boost/throw_exception.hpp:131 |
| 72 | » push···$0x24 | 72 | » push···$0x24 |
| 73 | » lea····-0x6ca8(%esi),%eax | 73 | » lea····-0x6ca8(%esi),%eax |
| 74 | » mov····%esi,%ebx | 74 | » mov····%esi,%ebx |
| 75 | » lea····-0x18(%eax),%edx | 75 | » lea····-0x18(%eax),%edx |
| Offset 124, 15 lines modified | Offset 124, 15 lines modified | ||
| 124 | /usr/include/boost/throw_exception.hpp:71·(discriminator·2) | 124 | /usr/include/boost/throw_exception.hpp:71·(discriminator·2) |
| 125 | » lea····-0x6c94(%esi),%eax | 125 | » lea····-0x6c94(%esi),%eax |
| 126 | /usr/include/boost/throw_exception.hpp:131·(discriminator·2) | 126 | /usr/include/boost/throw_exception.hpp:131·(discriminator·2) |
| 127 | » push···%edx | 127 | » push···%edx |
| 128 | /usr/include/boost/throw_exception.hpp:71·(discriminator·2) | 128 | /usr/include/boost/throw_exception.hpp:71·(discriminator·2) |
| 129 | » mov····%eax,0xc(%edi) | 129 | » mov····%eax,0xc(%edi) |
| 130 | /usr/include/boost/throw_exception.hpp:131·(discriminator·2) | 130 | /usr/include/boost/throw_exception.hpp:131·(discriminator·2) |
| 131 | » lea····-0x57 | 131 | » lea····-0x579774(%esi),%eax |
| 132 | » push···%eax | 132 | » push···%eax |
| 133 | » lea····-0x6ec8(%esi),%eax | 133 | » lea····-0x6ec8(%esi),%eax |
| 134 | » push···%eax | 134 | » push···%eax |
| 135 | » push···%edi | 135 | » push···%edi |
| 136 | /usr/include/boost/exception/exception.hpp:250·(discriminator·1) | 136 | /usr/include/boost/exception/exception.hpp:250·(discriminator·1) |
| 137 | » movq···%xmm2,-0x20(%ebp) | 137 | » movq···%xmm2,-0x20(%ebp) |
| 138 | » movq···%xmm2,0x14(%edi) | 138 | » movq···%xmm2,0x14(%edi) |
| Offset 165, 16 lines modified | Offset 165, 16 lines modified | ||
| 165 | 00081428·<boost::wrapexcept<std::domain_error>::rethrow()·const@@Base>: | 165 | 00081428·<boost::wrapexcept<std::domain_error>::rethrow()·const@@Base>: |
| 166 | boost::wrapexcept<std::domain_error>::rethrow()·const: | 166 | boost::wrapexcept<std::domain_error>::rethrow()·const: |
| 167 | /usr/include/boost/throw_exception.hpp:123 | 167 | /usr/include/boost/throw_exception.hpp:123 |
| 168 | » push···%ebp | 168 | » push···%ebp |
| 169 | » mov····%esp,%ebp | 169 | » mov····%esp,%ebp |
| 170 | » push···%edi | 170 | » push···%edi |
| 171 | » push···%esi | 171 | » push···%esi |
| 172 | » call···e8 | 172 | » call···e8366·<std::ctype<char>::do_widen(char)·const@@Base+0x6> |
| 173 | » add····$0x61 | 173 | » add····$0x619632,%esi |
| 174 | » push···%ebx | 174 | » push···%ebx |
| 175 | » sub····$0x28,%esp | 175 | » sub····$0x28,%esp |
| 176 | /usr/include/boost/throw_exception.hpp:131 | 176 | /usr/include/boost/throw_exception.hpp:131 |
| 177 | » push···$0x24 | 177 | » push···$0x24 |
| 178 | » lea····-0x6ce4(%esi),%eax | 178 | » lea····-0x6ce4(%esi),%eax |
| 179 | » mov····%esi,%ebx | 179 | » mov····%esi,%ebx |
| 180 | » lea····-0x18(%eax),%edx | 180 | » lea····-0x18(%eax),%edx |
| Offset 228, 15 lines modified | Offset 228, 15 lines modified | ||
| 228 | /usr/include/boost/throw_exception.hpp:71·(discriminator·2) | 228 | /usr/include/boost/throw_exception.hpp:71·(discriminator·2) |
| 229 | » lea····-0x6cd0(%esi),%eax | 229 | » lea····-0x6cd0(%esi),%eax |
| 230 | /usr/include/boost/throw_exception.hpp:131·(discriminator·2) | 230 | /usr/include/boost/throw_exception.hpp:131·(discriminator·2) |
| 231 | » push···%edx | 231 | » push···%edx |
| 232 | /usr/include/boost/throw_exception.hpp:71·(discriminator·2) | 232 | /usr/include/boost/throw_exception.hpp:71·(discriminator·2) |
| 233 | » mov····%eax,0xc(%edi) | 233 | » mov····%eax,0xc(%edi) |
| 234 | /usr/include/boost/throw_exception.hpp:131·(discriminator·2) | 234 | /usr/include/boost/throw_exception.hpp:131·(discriminator·2) |
| 235 | » lea····-0x5789 | 235 | » lea····-0x579894(%esi),%eax |
| 236 | » push···%eax | 236 | » push···%eax |
| 237 | » lea····-0x6ef0(%esi),%eax | 237 | » lea····-0x6ef0(%esi),%eax |
| 238 | » push···%eax | 238 | » push···%eax |
| 239 | » push···%edi | 239 | » push···%edi |
| 240 | /usr/include/boost/exception/exception.hpp:250·(discriminator·1) | 240 | /usr/include/boost/exception/exception.hpp:250·(discriminator·1) |
| 241 | » movq···%xmm2,-0x20(%ebp) | 241 | » movq···%xmm2,-0x20(%ebp) |
| 242 | » movq···%xmm2,0x14(%edi) | 242 | » movq···%xmm2,0x14(%edi) |
| Offset 268, 16 lines modified | Offset 268, 16 lines modified | ||
| 268 | 0008151a·<boost::wrapexcept<boost::math::rounding_error>::rethrow()·const@@Base>: | 268 | 0008151a·<boost::wrapexcept<boost::math::rounding_error>::rethrow()·const@@Base>: |
| 269 | boost::wrapexcept<boost::math::rounding_error>::rethrow()·const: | 269 | boost::wrapexcept<boost::math::rounding_error>::rethrow()·const: |
| 270 | /usr/include/boost/throw_exception.hpp:123 | 270 | /usr/include/boost/throw_exception.hpp:123 |
| 271 | » push···%ebp | 271 | » push···%ebp |
| 272 | » mov····%esp,%ebp | 272 | » mov····%esp,%ebp |
| 273 | » push···%edi | 273 | » push···%edi |
| 274 | » call···12fb | 274 | » call···12fbed·<Eigen::ScalarBinaryOpTraits<double,·Eigen::internal::traits<Eigen::Block<Eigen::Inverse<Eigen::FullPivLU<Eigen::Matrix<double,·-1,·-1,·0,·-1,·-1>·>·>·const,·-1,·1,·true>·>::Scalar,·Eigen::internal::scalar_product_op<double,·Eigen::internal::traits<Eigen::Block<Eigen::Inverse<Eigen::FullPivLU<Eigen::Matrix<double,·-1,·-1,·0,·-1,·-1>·>·>·const,·-1,·1,·true>·>::Scalar>·>::ReturnType·Eigen::MatrixBase<Eigen::Block<Eigen::Transpose<Eigen::Matrix<double,·-1,·1,·0,·-1,·1>·>·const,·1,·-1,·true>·>::dot<Eigen::Block<Eigen::Inverse<Eigen::FullPivLU<Eigen::Matrix<double,·-1,·-1,·0,·-1,·-1>·>·>·const,·-1,·1,·true>·>(Eigen::MatrixBase<Eigen::Block<Eigen::Inverse<Eigen::FullPivLU<Eigen::Matrix<double,·-1,·-1,·0,·-1,·-1>·>·>·const,·-1,·1,·true>·>·const&)·const@@Base+0x76d> |
| 275 | » add····$0x61 | 275 | » add····$0x619541,%edi |
| 276 | » push···%esi | 276 | » push···%esi |
| 277 | » push···%ebx | 277 | » push···%ebx |
| 278 | » sub····$0x38,%esp | 278 | » sub····$0x38,%esp |
| 279 | /usr/include/boost/throw_exception.hpp:131 | 279 | /usr/include/boost/throw_exception.hpp:131 |
| 280 | » push···$0x24 | 280 | » push···$0x24 |
| 281 | » lea····-0x6c6c(%edi),%eax | 281 | » lea····-0x6c6c(%edi),%eax |
| 282 | » mov····%edi,%ebx | 282 | » mov····%edi,%ebx |
| Offset 332, 15 lines modified | Offset 332, 15 lines modified | ||
| 332 | /usr/include/boost/throw_exception.hpp:71·(discriminator·2) | 332 | /usr/include/boost/throw_exception.hpp:71·(discriminator·2) |
| 333 | » lea····-0x6c58(%edi),%eax | 333 | » lea····-0x6c58(%edi),%eax |
| 334 | /usr/include/boost/throw_exception.hpp:131·(discriminator·2) | 334 | /usr/include/boost/throw_exception.hpp:131·(discriminator·2) |
| 335 | » push···%edx | 335 | » push···%edx |
| Max diff block lines reached; 84358972/84368479 bytes (99.99%) of diff not shown. | |||
| Offset 1, 14 lines modified | Offset 1, 14 lines modified | ||
| 1 | Disassembly·of·section·.fini: | 1 | Disassembly·of·section·.fini: |
| 2 | 0051 | 2 | 00512e54·<.fini>: |
| 3 | _fini(): | 3 | _fini(): |
| 4 | » push···%ebx | 4 | » push···%ebx |
| 5 | » sub····$0x8,%esp | 5 | » sub····$0x8,%esp |
| 6 | » call···e7 | 6 | » call···e7e60·<_start@@Base+0x30> |
| 7 | » add····$0x187 | 7 | » add····$0x187c07,%ebx |
| 8 | » add····$0x8,%esp | 8 | » add····$0x8,%esp |
| 9 | » pop····%ebx | 9 | » pop····%ebx |
| 10 | » ret | 10 | » ret |
| Offset 1, 50213 lines modified | Offset 1, 50227 lines modified | ||
| Diff chunk too large, falling back to line-by-line diff (9717 lines added, 9973 lines removed) | |||
| 1 | Hex·dump·of·section·'.rodata': | 1 | Hex·dump·of·section·'.rodata': |
| 2 | ··0x0051 | 2 | ··0x00513000·03000000·01000200·0000805f·0000803f·..........._...? |
| 3 | ··0x0051 | 3 | ··0x00513010·00000040·00004040·60c7223e·0000c03f·...@..@@`.">...? |
| 4 | ··0x0051 | 4 | ··0x00513020·1035073f·d06ee73e·000000bf·0000003f·.5.?.n.>.......? |
| 5 | ··0x0051 | 5 | ··0x00513030·0000903f·e0c0853f·0000dc42·d0d6cf3e·...?...?...B...> |
| 6 | ··0x0051 | 6 | ··0x00513040·00002040·f0b8013f·00009040·00006040·..·@...?...@..`@ |
| 7 | ··0x0051 | 7 | ··0x00513050·20630a3f·d0e90e3f·00001041·0000c842··c.?...?...A...B |
| 8 | ··0x0051 | 8 | ··0x00513060·00004842·00703146·006c3146·006c31c6·..HB.p1F.l1F.l1. |
| 9 | ··0x0051 | 9 | ··0x00513070·f9021550·006ce63c·b099833f·0000a0c1·...P.l.<...?.... |
| 10 | ··0x0051 | 10 | ··0x00513080·00002a43·0000803e·00008040·00007041·..*C...>...@..pA |
| 11 | ··0x0051 | 11 | ··0x00513090·0000a041·00002041·00001643·00004041·...A..·A...C..@A |
| 12 | ··0x0051 | 12 | ··0x005130a0·00009043·0000f041·0000004f·000000cf·...C...A...O.... |
| 13 | ··0x0051 | 13 | ··0x005130b0·00007a44·0000403f·00004843·0000005f·..zD..@?..HC..._ |
| 14 | ··0x0051 | 14 | ··0x005130c0·00002042·00504347·00008025·0000c843·..·B.PCG...%...C |
| 15 | ··0x0051 | 15 | ··0x005130d0·0000c07f·00008035·000000c0·0000807f·.......5........ |
| 16 | ··0x0051 | 16 | ··0x005130e0·00000000·00401c46·002474c9·010e020d·.....@.F.$t..... |
| 17 | ··0x0051 | 17 | ··0x005130f0·0b0a0c02·0e05010f·13111612·00007042·..............pB |
| 18 | ··0x0051 | 18 | ··0x00513100·000080ff·00247449·0000803a·00008030·.....$tI...:...0 |
| 19 | ··0x0051 | 19 | ··0x00513110·0000a040·00007043·00003041·0000c040·...@..pC..0A...@ |
| 20 | ··0x0051 | 20 | ··0x00513120·0050c347·00007ac4·0000802f·000080ce·.P.G..z..../.... |
| 21 | ··0x0051 | 21 | ··0x00513130·000040bf·000080bf·0000e0be·00008032·..@............2 |
| 22 | ··0x0051 | 22 | ··0x00513140·000020c2·00009841·00008039·0000803b·..·....A...9...; |
| 23 | ··0x0051 | 23 | ··0x00513150·0000d841·00406244·0000a242·0000e040·...A.@bD...B...@ |
| 24 | ··0x0051 | 24 | ··0x00513160·00009041·0000b842·00007543·0000e041·...A...B..uC...A |
| 25 | ··0x0051 | 25 | ··0x00513170·00006842·00000444·0000ee42·00008041·..hB...D...B...A |
| 26 | ··0x0051 | 26 | ··0x00513180·00006041·00002c42·00808e43·00000842·..`A..,B...C...B |
| 27 | ··0x0051 | 27 | ··0x00513190·0000c043·00008c42·0000b841·00007743·...C...B...A..wC |
| 28 | ··0x0051 | 28 | ··0x005131a0·00000643·00006c42·0000d242·00988a45·...C..lB...B...E |
| 29 | ··0x0051 | 29 | ··0x005131b0·0080bd43·0000e841·00005a43·0080a343·...C...A..ZC...C |
| 30 | ··0x0051 | 30 | ··0x005131c0·00409644·00000042·00005844·0000b041·.@.D...B..XD...A |
| 31 | ··0x0051 | 31 | ··0x005131d0·00004a43·0000fa43·00003042·0000a143·..JC...C..0B...C |
| 32 | ··0x0051 | 32 | ··0x005131e0·0000ae42·00401a44·003c1cc6·0000a842·...B.@.D.<.....B |
| 33 | ··0x0051 | 33 | ··0x005131f0·00000c43·00005243·0000d243·00c09f44·...C..RC...C...D |
| 34 | ··0x0051 | 34 | ··0x00513200·00a08e44·00807144·00c03744·00801d45·...D..qD..7D...E |
| 35 | ··0x0051 | 35 | ··0x00513210·00006944·00c03044·0000e743·0080d944·..iD..0D...C...D |
| 36 | ··0x0051 | 36 | ··0x00513220·00405e44·00009343·00c09344·00002844·.@^D...C...D..(D |
| 37 | ··0x0051 | 37 | ··0x00513230·00007c43·00809d45·00801744·00002f43·..|C...E...D../C |
| 38 | ··0x0051 | 38 | ··0x00513240·00008443·0000fe42·0000ad43·0000f042·...C...B...C...B |
| 39 | ··0x0051 | 39 | ··0x00513250·0000c642·00406c46·0040ec46·00005245·...B.@lF.@.F..RE |
| 40 | ··0x0051 | 40 | ··0x00513260·0000bd44·005a8748·c0f7034b·00006042·...D.Z.H...K..`B |
| 41 | ··0x0051 | 41 | ··0x00513270·00e0c446·00a2f349·c0f7834b·00807745·...F...I...K..wE |
| 42 | ··0x0051 | 42 | ··0x00513280·c0f7034a·fa56904d·0000b442·0090d847·...J.V.M...B...G |
| 43 | ··0x0051 | 43 | ··0x00513290·90f1e64b·8870f74e·00f07f46·98cb1b4c·...K.p.N...F...L |
| 44 | ··0x0051 | 44 | ··0x005132a0·00003643·009c6a49·00000026·00008059·..6C..jI...&...Y |
| 45 | ··0x0051 | 45 | ··0x005132b0·0000800b·000080c0·000080be·00c07944·..............yD |
| 46 | ··0x0051 | 46 | ··0x005132c0·0000804e·00008049·00008034·0000801f·...N...I...4.... |
| 47 | ··0x0051 | 47 | ··0x005132d0·0000803d·0000a441·0000203f·00000443·...=...A..·?...C |
| 48 | ··0x0051 | 48 | ··0x005132e0·00905846·006c2248·746f7461·6c206c65·..XF.l"Htotal·le |
| 49 | ··0x0051 | 49 | ··0x005132f0·6e677468·3a20006d·65616e20·6c656e67·ngth:·.mean·leng |
| 50 | ··0x0051 | 50 | ··0x00513300·74683a20·00506172·73696d6f·6e792073·th:·.Parsimony·s |
| 51 | ··0x0051 | 51 | ··0x00513310·636f7265·2069733a·20004572·726f7220·core·is:·.Error· |
| 52 | ··0x0051 | 52 | ··0x00513320·666f756e·64206174·206c696e·6520002c·found·at·line·., |
| 53 | ··0x0051 | 53 | ··0x00513330·20636f6c·756d6e20·00202866·696c6520··column·.·(file· |
| 54 | ··0x0051 | 54 | ··0x00513340·706f7369·74696f6e·2000293a·00736875·position·.):.shu |
| 55 | ··0x0051 | 55 | ··0x00513350·66666c65·416c6967·6e6d656e·7400496e·ffleAlignment.In |
| 56 | ··0x0051 | 56 | ··0x00513360·7465726e·616c2065·72726f72·3a200062·ternal·error:·.b |
| 57 | ··0x0051 | 57 | ··0x00513370·61736963·5f737472·696e673a·3a617070·asic_string::app |
| 58 | ··0x0051 | 58 | ··0x00513380·656e6400·2e2f616c·69676e6d·656e742f·end../alignment/ |
| 59 | ··0x0051 | 59 | ··0x00513390·616c6967·6e6d656e·742e6370·7000416c·alignment.cpp.Al |
| 60 | ··0x0051 | 60 | ··0x005133a0·69676e6d·656e7420·66696c65·20697320·ignment·file·is· |
| 61 | ··0x0051 | 61 | ··0x005133b0·746f6f20·73686f72·742e0073·74617465·too·short..state |
| 62 | ··0x0051 | 62 | ··0x005133c0·3a202020·20202020·20202020·20202000·:··············. |
| 63 | ··0x0051 | 63 | ··0x005133d0·706f6d6f·5f73616d·706c6564·5f737461·pomo_sampled_sta |
| 64 | ··0x0051 | 64 | ··0x005133e0·7465732e·73697a65·28293a20·00737461·tes.size():·.sta |
| 65 | ··0x0051 | 65 | ··0x005133f0·7465203c·206e756d·5f737461·74657300·te·<·num_states. |
| 66 | ··0x0051 | 66 | ··0x00513400·70616972·5f667265·71007365·715f6964·pair_freq.seq_id |
| 67 | ··0x0051 | 67 | ··0x00513410·203c2067·65744e53·65712829·0067656e··<·getNSeq().gen |
| 68 | ··0x0051 | 68 | ··0x00513420·65746963·5f636f64·65002e2f·6e636c2f·etic_code../ncl/ |
| 69 | ··0x0051 | 69 | ··0x00513430·6e787363·68617261·63746572·73626c6f·nxscharactersblo |
| 70 | ··0x0051 | 70 | ··0x00513440·636b2e68·0073796d·626f6c73·0070203c·ck.h.symbols.p·< |
| 71 | ··0x0051 | 71 | ··0x00513450·20737472·6c656e28·73796d62·6f6c7329··strlen(symbols) |
| 72 | ··0x0051 | 72 | ··0x00513460·00206861·7320696e·76616c69·64207369·.·has·invalid·si |
| 73 | ··0x0051 | 73 | ··0x00513470·6e676c65·20737461·74652000·20617420·ngle·state·.·at· |
| 74 | ··0x0051 | 74 | ··0x00513480·73697465·20002320·416c6967·6e6d656e·site·.#·Alignmen |
| 75 | ··0x0051 | 75 | ··0x00513490·74207369·74652073·74617469·73746963·t·site·statistic |
| 76 | ··0x0051 | 76 | ··0x005134a0·73002320·20207461·623d7265·61642e74·s.#···tab=read.t |
| 77 | ··0x0051 | 77 | ··0x005134b0·61626c65·28270023·20202050·6172743a·able('.#···Part: |
| 78 | ··0x0051 | 78 | ··0x005134c0·20202050·61727469·74696f6e·20494400····Partition·ID. |
| 79 | ··0x0051 | 79 | ··0x005134d0·23202020·53697465·3a202020·53697465·#···Site:···Site |
| 80 | ··0x0051 | 80 | ··0x005134e0·20494400·50617274·09005369·74650953··ID.Part..Site.S |
| 81 | ··0x0051 | 81 | ··0x005134f0·74617400·53544154·455f554e·4b4e4f57·tat.STATE_UNKNOW |
| 82 | ··0x0051 | 82 | ··0x00513500·4e203c20·31323600·636f646f·6e5f7461·N·<·126.codon_ta |
| 83 | ··0x0051 | 83 | ··0x00513510·626c6500·4e4f5445·3a205374·61746528·ble.NOTE:·State( |
| 84 | ··0x0051 | 84 | ··0x00513520·73292000·206e6f74·20707265·73656e74·s)·.·not·present |
| 85 | ··0x0051 | 85 | ··0x00513530·20696e20·00574152·4e494e47·3a205374··in·.WARNING:·St |
| 86 | ··0x0051 | 86 | ··0x00513540·61746573·28732920·00207261·72656c79·ates(s)·.·rarely |
| 87 | ··0x0051 | 87 | ··0x00513550·20617070·65617220·696e2000·57726f6e··appear·in·.Wron |
| 88 | ··0x0051 | 88 | ··0x00513560·67206765·6e657469·6320636f·64652000·g·genetic·code·. |
| 89 | ··0x0051 | 89 | ··0x00513570·7374726c·656e2867·656e6574·69635f63·strlen(genetic_c |
| 90 | ··0x0051 | 90 | ··0x00513580·6f646529·203d3d20·36340042·494e0050·ode)·==·64.BIN.P |
| 91 | ··0x0051 | 91 | ··0x00513590·524f5400·4e543241·41004d4f·52504800·ROT.NT2AA.MORPH. |
| 92 | ··0x0051 | 92 | ··0x005135a0·54494e41·004d554c·54490043·4f444f4e·TINA.MULTI.CODON |
| 93 | ··0x0051 | 93 | ··0x005135b0·00222069·6e737465·61640073·74617465·."·instead.state |
| 94 | ··0x0051 | 94 | ··0x005135c0·3c323300·69735f69·6e766172·69616e74·<23.is_invariant |
| 95 | ··0x0051 | 95 | ··0x005135d0·203e3d20·69735f63·6f6e7374·00456d70··>=·is_const.Emp |
| 96 | ··0x0051 | 96 | ··0x005135e0·69726963·616c2073·74617465·20667265·irical·state·fre |
| 97 | ··0x0051 | 97 | ··0x005135f0·7175656e·63696573·3a200066·61627328·quencies:·.fabs( |
| 98 | ··0x0051 | 98 | ··0x00513600·73756d2d·312e3029·3c31652d·3500556e·sum-1.0)<1e-5.Un |
| 99 | ··0x0051 | 99 | ··0x00513610·73757070·6f727465·6420636f·646f6e20·supported·codon· |
| 100 | ··0x0051 | 100 | ··0x00513620·66726571·75656e63·79006e73·69746520·frequency.nsite· |
| 101 | ··0x0051 | 101 | ··0x00513630·3d3d2072·6566416c·69676e2e·6765744e·==·refAlign.getN |
| 102 | ··0x0051 | 102 | ··0x00513640·53697465·28290073·697a6528·29203d3d·Site().size()·== |
| 103 | ··0x0051 | 103 | ··0x00513650·20706174·7465726e·5f667265·712e7369··pattern_freq.si |
| 104 | ··0x0051 | 104 | ··0x00513660·7a652829·004e4f54·453a204c·696e6520·ze().NOTE:·Line· |
| 105 | ··0x0051 | 105 | ··0x00513670·00626173·69635f73·7472696e·673a3a73·.basic_string::s |
| 106 | ··0x0051 | 106 | ··0x00513680·75627374·72003a20·556e7265·636f676e·ubstr.:·Unrecogn |
| 107 | ··0x0051 | 107 | ··0x00513690·697a6564·20636861·72616374·65722000·ized·character·. |
| 108 | ··0x0051 | 108 | ··0x005136a0·53697465·5f476170·20200053·6974655f·Site_Gap··.Site_ |
| 109 | ··0x0051 | 109 | ··0x005136b0·416d6269·20005369·74652067·61702d63·Ambi·.Site·gap-c |
| 110 | ··0x0051 | 110 | ··0x005136c0·6f756e74·73207072·696e7465·6420746f·ounts·printed·to |
| 111 | ··0x0051 | 111 | ··0x005136d0·2000416c·69676e6d·656e7420·77617320··.Alignment·was· |
| 112 | ··0x0051 | 112 | ··0x005136e0·7072696e·74656420·746f2000·5741524e·printed·to·.WARN |
| 113 | ··0x0051 | 113 | ··0x005136f0·494e473a·20496465·6e746963·616c2073·ING:·Identical·s |
| 114 | ··0x0051 | 114 | ··0x00513700·65717565·6e636573·20006c6f·674c4c2e·equences·.logLL. |
| 115 | ··0x0051 | 115 | ··0x00513710·73697a65·2829203d·3d207061·744e756d·size()·==·patNum |
| 116 | ··0x0051 | 116 | ··0x00513720·00526561·64696e67·20736974·6520706f·.Reading·site·po |
| 117 | ··0x0051 | 117 | ··0x00513730·73697469·6f6e206c·69737420·0052616e·sition·list·.Ran |
| 118 | ··0x0051 | 118 | ··0x00513740·6765206d·75737420·62652070·6f736974·ge·must·be·posit |
| 119 | ··0x0051 | 119 | ··0x00513750·69766500·236e6578·75730062·6567696e·ive.#nexus.begin |
| 120 | ··0x0051 | 120 | ··0x00513760·20646174·613b0020·2064696d·656e7369··data;.··dimensi |
| 121 | ··0x0051 | 121 | ··0x00513770·6f6e7320·6e746178·3d00206e·63686172·ons·ntax=.·nchar |
| 122 | ··0x0051 | 122 | ··0x00513780·3d002020·666f726d·61742064·61746174·=.··format·datat |
| 123 | ··0x0051 | 123 | ··0x00513790·7970653d·006e7563·6c656f74·69646500·ype=.nucleotide. |
| 124 | ··0x0051 | 124 | ··0x005137a0·7374616e·64617264·0070726f·7465696e·standard.protein |
| 125 | ··0x0051 | 125 | ··0x005137b0·00206d69·7373696e·673d3f20·6761703d·.·missing=?·gap= |
| Max diff block lines reached; 5401187/6720542 bytes (80.37%) of diff not shown. | |||
| Offset 1, 3556 lines modified | Offset 1, 3556 lines modified | ||
| Diff chunk too large, falling back to line-by-line diff (3553 lines added, 3553 lines removed) | |||
| 1 | Hex·dump·of·section·'.eh_frame_hdr': | 1 | Hex·dump·of·section·'.eh_frame_hdr': |
| 2 | ··0x005d | 2 | ··0x005d72f8·011b033b·08de0000·c01b0000·288daaff·...;........(... |
| 3 | ··0x005d | 3 | ··0x005d7308·50de0000·689faaff·74de0000·889faaff·P...h...t....... |
| 4 | ··0x005d | 4 | ··0x005d7318·f8de0000·3ea0aaff·e4e60000·30a1aaff·....>.......0... |
| 5 | ··0x005d | 5 | ··0x005d7328·10e70000·22a2aaff·3ce70000·1aa3aaff·...."...<....... |
| 6 | ··0x005d | 6 | ··0x005d7338·68e70000·12a4aaff·e0ef0000·34a4aaff·h...........4... |
| 7 | ··0x005d | 7 | ··0x005d7348·50f00000·64a4aaff·70f00000·24a5aaff·P...d...p...$... |
| 8 | ··0x005d | 8 | ··0x005d7358·a8f10000·a6a5aaff·80f20000·4ea6aaff·............N... |
| 9 | ··0x005d | 9 | ··0x005d7368·a0f70000·aca6aaff·dcf90000·b2a6aaff·................ |
| 10 | ··0x005d | 10 | ··0x005d7378·30fa0000·90a7aaff·ecfa0000·aca7aaff·0............... |
| 11 | ··0x005d | 11 | ··0x005d7388·50fe0000·4da8aaff·28ff0000·90a9aaff·P...M...(....... |
| 12 | ··0x005d | 12 | ··0x005d7398·9c010100·96a9aaff·c0030100·1caaaaff·................ |
| 13 | ··0x005d | 13 | ··0x005d73a8·30040100·98abaaff·94040100·e6abaaff·0............... |
| 14 | ··0x005d | 14 | ··0x005d73b8·24070100·06acaaff·88070100·36adaaff·$...........6... |
| 15 | ··0x005d | 15 | ··0x005d73c8·28090100·3cadaaff·480a0100·50adaaff·(...<...H...P... |
| 16 | ··0x005d | 16 | ··0x005d73d8·980b0100·6cadaaff·b00e0100·76adaaff·....l.......v... |
| 17 | ··0x005d | 17 | ··0x005d73e8·840f0100·80adaaff·10110100·c0adaaff·................ |
| 18 | ··0x005d | 18 | ··0x005d73f8·d4110100·e8adaaff·6c120100·f9adaaff·........l....... |
| 19 | ··0x005d | 19 | ··0x005d7408·1c130100·9eb0aaff·e4140100·82b1aaff·................ |
| 20 | ··0x005d | 20 | ··0x005d7418·80190100·9cb3aaff·ec190100·0cb5aaff·................ |
| 21 | ··0x005d | 21 | ··0x005d7428·501a0100·9cb6aaff·001d0100·b4b6aaff·P............... |
| 22 | ··0x005d | 22 | ··0x005d7438·541d0100·08b7aaff·b01d0100·ceb7aaff·T............... |
| 23 | ··0x005d | 23 | ··0x005d7448·101e0100·96b8aaff·701e0100·82bcaaff·........p....... |
| 24 | ··0x005d | 24 | ··0x005d7458·dc1e0100·2cbdaaff·401f0100·d6bdaaff·....,...@....... |
| 25 | ··0x005d | 25 | ··0x005d7468·a41f0100·16bfaaff·50210100·80c2aaff·........P!...... |
| 26 | ··0x005d | 26 | ··0x005d7478·cc210100·18c4aaff·ac260100·80c7aaff·.!.......&...... |
| 27 | ··0x005d | 27 | ··0x005d7488·10270100·78caaaff·b02c0100·e6caaaff·.'..x....,...... |
| 28 | ··0x005d | 28 | ··0x005d7498·4c2d0100·faccaaff·1c2f0100·32cdaaff·L-......./..2... |
| 29 | ··0x005d | 29 | ··0x005d74a8·643d0100·9ccdaaff·203f0100·fccdaaff·d=......·?...... |
| 30 | ··0x005d | 30 | ··0x005d74b8·f43f0100·12ceaaff·d8430100·30cfaaff·.?.......C..0... |
| 31 | ··0x005d | 31 | ··0x005d74c8·a4450100·64d0aaff·18460100·76d1aaff·.E..d....F..v... |
| 32 | ··0x005d | 32 | ··0x005d74d8·74460100·5ad3aaff·d0460100·c0d3aaff·tF..Z....F...... |
| 33 | ··0x005d | 33 | ··0x005d74e8·2c470100·92d4aaff·88470100·d6d4aaff·,G.......G...... |
| 34 | ··0x005d | 34 | ··0x005d74f8·e4470100·9ed5aaff·3c480100·3ad6aaff·.G......<H..:... |
| 35 | ··0x005d | 35 | ··0x005d7508·9c480100·eed6aaff·f8480100·6adcaaff·.H.......H..j... |
| 36 | ··0x005d | 36 | ··0x005d7518·90490100·f4e1aaff·344a0100·10e6aaff·.I......4J...... |
| 37 | ··0x005d | 37 | ··0x005d7528·b44a0100·54edaaff·484b0100·98f1aaff·.J..T...HK...... |
| 38 | ··0x005d | 38 | ··0x005d7538·d44b0100·b4f7aaff·644c0100·e806abff·.K......dL...... |
| 39 | ··0x005d | 39 | ··0x005d7548·e04c0100·e417abff·b84d0100·001babff·.L.......M...... |
| 40 | ··0x005d | 40 | ··0x005d7558·204e0100·4c1babff·804e0100·a21babff··N..L....N...... |
| 41 | ··0x005d | 41 | ··0x005d7568·f44e0100·4e1cabff·504f0100·d81cabff·.N..N...PO...... |
| 42 | ··0x005d | 42 | ··0x005d7578·ac4f0100·241dabff·04500100·9a1dabff·.O..$....P...... |
| 43 | ··0x005d | 43 | ··0x005d7588·5c500100·ce1dabff·c8500100·1420abff·\P.......P...·.. |
| 44 | ··0x005d | 44 | ··0x005d7598·2c510100·ae20abff·88510100·ce21abff·,Q...·...Q...!.. |
| 45 | ··0x005d | 45 | ··0x005d75a8·ec510100·d024abff·4c520100·fe24abff·.Q...$..LR...$.. |
| 46 | ··0x005d | 46 | ··0x005d75b8·a8520100·da25abff·08530100·8a26abff·.R...%...S...&.. |
| 47 | ··0x005d | 47 | ··0x005d75c8·64530100·dc26abff·c4530100·2c27abff·dS...&...S..,'.. |
| 48 | ··0x005d | 48 | ··0x005d75d8·2c540100·f828abff·c0540100·eb2eabff·,T...(...T...... |
| 49 | ··0x005d | 49 | ··0x005d75e8·18fb0000·212fabff·44290100·a82fabff·....!/..D).../.. |
| 50 | ··0x005d | 50 | ··0x005d75f8·b8290100·2f30abff·28360100·b630abff·.)../0..(6...0.. |
| 51 | ··0x005d | 51 | ··0x005d7608·1c560100·c630abff·0c5b0100·da30abff·.V...0...[...0.. |
| 52 | ··0x005d | 52 | ··0x005d7618·645b0100·ee30abff·c85e0100·0431abff·d[...0...^...1.. |
| 53 | ··0x005d | 53 | ··0x005d7628·bc640100·2e31abff·14650100·5831abff·.d...1...e..X1.. |
| 54 | ··0x005d | 54 | ··0x005d7638·9c690100·8231abff·cc6c0100·e031abff·.i...1...l...1.. |
| 55 | ··0x005d | 55 | ··0x005d7648·f06d0100·3e32abff·646e0100·3a34abff·.m..>2..dn..:4.. |
| 56 | ··0x005d65 | 56 | ··0x005d7658·646f0100·4434abff·e0700100·5c34abff·do..D4...p..\4.. |
| 57 | ··0x005d6 | 57 | ··0x005d7668·54770100·6a35abff·b4770100·ce35abff·Tw..j5...w...5.. |
| 58 | ··0x005d | 58 | ··0x005d7678·10780100·2236abff·6c780100·8636abff·.x.."6..lx...6.. |
| 59 | ··0x005d | 59 | ··0x005d7688·a87c0100·9036abff·007d0100·da36abff·.|...6...}...6.. |
| 60 | ··0x005d | 60 | ··0x005d7698·587d0100·2637abff·d87d0100·2c37abff·X}..&7...}..,7.. |
| 61 | ··0x005d | 61 | ··0x005d76a8·687e0100·4037abff·a4800100·6637abff·h~..@7......f7.. |
| 62 | ··0x005d | 62 | ··0x005d76b8·30820100·f237abff·84830100·f837abff·0....7.......7.. |
| 63 | ··0x005d | 63 | ··0x005d76c8·e8830100·1e39abff·78870100·3639abff·.....9..x...69.. |
| 64 | ··0x005d | 64 | ··0x005d76d8·50880100·5239abff·44890100·6639abff·P...R9..D...f9.. |
| 65 | ··0x005d | 65 | ··0x005d76e8·608a0100·7a39abff·448c0100·9239abff·`...z9..D....9.. |
| 66 | ··0x005d | 66 | ··0x005d76f8·cc910100·dc39abff·3c920100·f039abff·.....9..<....9.. |
| 67 | ··0x005d | 67 | ··0x005d7708·88940100·403aabff·9c950100·5a3aabff·....@:......Z:.. |
| 68 | ··0x005d | 68 | ··0x005d7718·60980100·603aabff·f0990100·6a3aabff·`...`:......j:.. |
| 69 | ··0x005d | 69 | ··0x005d7728·489a0100·e83aabff·a89a0100·123babff·H....:.......;.. |
| 70 | ··0x005d | 70 | ··0x005d7738·c49b0100·5c3babff·c09c0100·863babff·....\;.......;.. |
| 71 | ··0x005d | 71 | ··0x005d7748·1c9d0100·0a3cabff·b49e0100·843cabff·.....<.......<.. |
| 72 | ··0x005d | 72 | ··0x005d7758·2c9f0100·bc3dabff·989f0100·8c3eabff·,....=.......>.. |
| 73 | ··0x005d | 73 | ··0x005d7768·fc9f0100·5c3fabff·58a00100·9640abff·....\?..X....@.. |
| 74 | ··0x005d | 74 | ··0x005d7778·c0a00100·a641abff·24a10100·0243abff·.....A..$....C.. |
| 75 | ··0x005d | 75 | ··0x005d7788·98a10100·0c44abff·3ca20100·5044abff·.....D..<...PD.. |
| 76 | ··0x005d | 76 | ··0x005d7798·e4a20100·9044abff·8ca40100·9644abff·.....D.......D.. |
| 77 | ··0x005d | 77 | ··0x005d77a8·40a80100·9c44abff·5ca90100·a645abff·@....D..\....E.. |
| 78 | ··0x005d | 78 | ··0x005d77b8·74aa0100·9846abff·f0ab0100·5a47abff·t....F......ZG.. |
| 79 | ··0x005d | 79 | ··0x005d77c8·68ad0100·1248abff·d8ad0100·d848abff·h....H.......H.. |
| 80 | ··0x005d | 80 | ··0x005d77d8·50ae0100·c24babff·20b10100·de4babff·P....K..·....K.. |
| 81 | ··0x005d | 81 | ··0x005d77e8·5cb20100·7c4cabff·b8b20100·924cabff·\...|L.......L.. |
| 82 | ··0x005d | 82 | ··0x005d77f8·c4b30100·764dabff·28b40100·aa4dabff·....vM..(....M.. |
| 83 | ··0x005d | 83 | ··0x005d7808·ecb40100·564eabff·60b50100·3a4fabff·....VN..`...:O.. |
| 84 | ··0x005d | 84 | ··0x005d7818·c4b70100·fa4fabff·3cb80100·1451abff·.....O..<....Q.. |
| 85 | ··0x005d | 85 | ··0x005d7828·18ba0100·a451abff·64bb0100·ac51abff·.....Q..d....Q.. |
| 86 | ··0x005d | 86 | ··0x005d7838·14bc0100·b251abff·68bc0100·5252abff·.....Q..h...RR.. |
| 87 | ··0x005d | 87 | ··0x005d7848·60bd0100·d252abff·bcbd0100·0a54abff·`....R.......T.. |
| 88 | ··0x005d | 88 | ··0x005d7858·18be0100·4255abff·74be0100·5e57abff·....BU..t...^W.. |
| 89 | ··0x005d | 89 | ··0x005d7868·0cc20100·ca57abff·78c20100·b858abff·.....W..x....X.. |
| 90 | ··0x005d | 90 | ··0x005d7878·f8c60100·c058abff·9cc80100·f858abff·.....X.......X.. |
| 91 | ··0x005d | 91 | ··0x005d7888·e8cd0100·e659abff·00cf0100·ec59abff·.....Y.......Y.. |
| 92 | ··0x005d | 92 | ··0x005d7898·74d10100·1e5aabff·54d30100·3c5babff·t....Z..T...<[.. |
| 93 | ··0x005d | 93 | ··0x005d78a8·c8d30100·9a5cabff·48d40100·cc5eabff·.....\..H....^.. |
| 94 | ··0x005d | 94 | ··0x005d78b8·7cd50100·f25eabff·f0d50100·0060abff·|....^.......`.. |
| 95 | ··0x005d | 95 | ··0x005d78c8·54d90100·4260abff·f8d90100·7c60abff·T...B`......|`.. |
| 96 | ··0x005d | 96 | ··0x005d78d8·f4da0100·8260abff·54de0100·0861abff·.....`..T....a.. |
| 97 | ··0x005d | 97 | ··0x005d78e8·3ce00100·2a61abff·e0e10100·8861abff·<...*a.......a.. |
| 98 | ··0x005d | 98 | ··0x005d78f8·64e20100·c461abff·f8e20100·bc63abff·d....a.......c.. |
| 99 | ··0x005d | 99 | ··0x005d7908·f8e50100·0c65abff·1ce70100·7c65abff·.....e......|e.. |
| 100 | ··0x005d | 100 | ··0x005d7918·f0e70100·de65abff·5ce80100·f867abff·.....e..\....g.. |
| 101 | ··0x005d | 101 | ··0x005d7928·fce80100·6e6dabff·38ea0100·a475abff·....nm..8....u.. |
| 102 | ··0x005d | 102 | ··0x005d7938·eceb0100·3276abff·44ec0100·9876abff·....2v..D....v.. |
| 103 | ··0x005d | 103 | ··0x005d7948·9cec0100·ca76abff·f8ec0100·fe76abff·.....v.......v.. |
| 104 | ··0x005d | 104 | ··0x005d7958·54ed0100·5c77abff·bced0100·d877abff·T...\w.......w.. |
| 105 | ··0x005d | 105 | ··0x005d7968·18ee0100·4078abff·b8ee0100·4678abff·....@x......Fx.. |
| 106 | ··0x005d | 106 | ··0x005d7978·c4f40100·6878abff·94f80100·c678abff·....hx.......x.. |
| 107 | ··0x005d | 107 | ··0x005d7988·94f90100·9279abff·08fa0100·6e7aabff·.....y......nz.. |
| 108 | ··0x005d | 108 | ··0x005d7998·b4fb0100·7e7aabff·1cfc0100·aa7aabff·....~z.......z.. |
| 109 | ··0x005d | 109 | ··0x005d79a8·00fd0100·b07aabff·8cff0100·b67aabff·.....z.......z.. |
| 110 | ··0x005d | 110 | ··0x005d79b8·10020200·bc7aabff·84030200·c27aabff·.....z.......z.. |
| 111 | ··0x005d | 111 | ··0x005d79c8·04050200·de7aabff·2c060200·547babff·.....z..,...T{.. |
| 112 | ··0x005d | 112 | ··0x005d79d8·a0060200·947babff·f8060200·e07babff·.....{.......{.. |
| 113 | ··0x005d | 113 | ··0x005d79e8·c4070200·2e7cabff·24080200·9a7cabff·.....|..$....|.. |
| 114 | ··0x005d | 114 | ··0x005d79f8·7c080200·c47cabff·fc0a0200·dc7cabff·|....|.......|.. |
| 115 | ··0x005d | 115 | ··0x005d7a08·540c0200·f67cabff·a80c0200·0a7dabff·T....|.......}.. |
| 116 | ··0x005d | 116 | ··0x005d7a18·240e0200·087eabff·f80e0200·b87eabff·$....~.......~.. |
| 117 | ··0x005d | 117 | ··0x005d7a28·640f0200·5080abff·bc0f0200·ac80abff·d...P........... |
| 118 | ··0x005d | 118 | ··0x005d7a38·1c100200·5682abff·d0100200·8a85abff·....V........... |
| 119 | ··0x005d | 119 | ··0x005d7a48·10120200·9386abff·68120200·de86abff·........h....... |
| 120 | ··0x005d | 120 | ··0x005d7a58·a4130200·268aabff·10140200·c48babff·....&........... |
| 121 | ··0x005d | 121 | ··0x005d7a68·84140200·588dabff·e8140200·968eabff·....X........... |
| 122 | ··0x005d | 122 | ··0x005d7a78·50170200·e08eabff·98170200·148fabff·P............... |
| 123 | ··0x005d | 123 | ··0x005d7a88·f0170200·568fabff·4c180200·1c90abff·....V...L....... |
| 124 | ··0x005d | 124 | ··0x005d7a98·44190200·ec90abff·e01a0200·1691abff·D............... |
| 125 | ··0x005d | 125 | ··0x005d7aa8·3c1b0200·4091abff·941b0200·6a91abff·<...@.......j... |
| Max diff block lines reached; 0/476158 bytes (0.00%) of diff not shown. | |||
| Offset 1, 36751 lines modified | Offset 1, 36750 lines modified | ||
| Diff chunk too large, falling back to line-by-line diff (36747 lines added, 36748 lines removed) | |||
| 1 | Hex·dump·of·section·'.eh_frame': | 1 | Hex·dump·of·section·'.eh_frame': |
| 2 | ··0x005e | 2 | ··0x005e5104·14000000·00000000·017a5200·017c0801·.........zR..|.. |
| 3 | ··0x005e | 3 | ··0x005e5114·1b0c0404·88010708·10000000·1c000000·................ |
| 4 | ··0x005e | 4 | ··0x005e5124·0c2db0ff·2c000000·00000000·14000000·.-..,........... |
| 5 | ··0x005e | 5 | ··0x005e5134·00000000·017a5200·017c0801·1b0c0404·.....zR..|...... |
| 6 | ··0x005e | 6 | ··0x005e5144·88010000·20000000·1c000000·d0aea9ff·....·........... |
| 7 | ··0x005e | 7 | ··0x005e5154·40120000·000e0846·0e0c4a0f·0b740478·@......F..J..t.x |
| 8 | ··0x005e | 8 | ··0x005e5164·003f1a3b·2a322422·10000000·40000000·.?.;*2$"....@... |
| 9 | ··0x005e | 9 | ··0x005e5174·ecc0a9ff·18000000·00000000·10000000·................ |
| 10 | ··0x005e | 10 | ··0x005e5184·54000000·d831b0ff·06000000·00000000·T....1.......... |
| 11 | ··0x005e | 11 | ··0x005e5194·1c000000·00000000·017a504c·5200017c·.........zPLR..| |
| 12 | ··0x005e | 12 | ··0x005e51a4·08079b61·5e0b001b·1b0c0404·88010000·...a^........... |
| 13 | ··0x005e | 13 | ··0x005e51b4·38000000·24000000·a42db0ff·f7030000·8...$....-...... |
| 14 | ··0x005e | 14 | ··0x005e51c4·04eff708·00410e08·8502420d·05488703·.....A....B..H.. |
| 15 | ··0x005e | 15 | ··0x005e51d4·86045283·0502592e·20712e10·0328020a·..R...Y.·q...(.. |
| 16 | ··0x005e | 16 | ··0x005e51e4·c341c641·c741c50c·0404460b·1c000000·.A.A.A....F..... |
| 17 | ··0x005e | 17 | ··0x005e51f4·60000000·88c0a9ff·b6000000·04c9f708·`............... |
| 18 | ··0x005e | 18 | ··0x005e5204·000c0508·83058502·86048703·10000000·................ |
| 19 | ··0x005e | 19 | ··0x005e5214·e4000000·4e31b0ff·04000000·00000000·....N1.......... |
| 20 | ··0x005e | 20 | ··0x005e5224·10000000·f8000000·64afb3ff·03000000·........d....... |
| 21 | ··0x005e | 21 | ··0x005e5234·00000000·10000000·0c010000·60afb3ff·............`... |
| 22 | ··0x005e | 22 | ··0x005e5244·0b000000·00000000·10000000·20010000·............·... |
| 23 | ··0x005e | 23 | ··0x005e5254·5cafb3ff·01000000·00000000·10000000·\............... |
| 24 | ··0x005e | 24 | ··0x005e5264·34010000·58afb3ff·01000000·00000000·4...X........... |
| 25 | ··0x005e | 25 | ··0x005e5274·10000000·48010000·54afb3ff·01000000·....H...T....... |
| 26 | ··0x005e | 26 | ··0x005e5284·00000000·10000000·5c010000·50afb3ff·........\...P... |
| 27 | ··0x005e | 27 | ··0x005e5294·01000000·00000000·3c000000·70010000·........<...p... |
| 28 | ··0x005e | 28 | ··0x005e52a4·dc30b0ff·d6000000·00410e08·8502410e·.0.......A....A. |
| 29 | ··0x005e | 29 | ··0x005e52b4·0c870341·0e108604·410e1483·05430e30·...A....A....C.0 |
| 30 | ··0x005e | 30 | ··0x005e52c4·02bf0a0e·1441c30e·1041c60e·0c41c70e·.....A...A...A.. |
| 31 | ··0x005e | 31 | ··0x005e52d4·0841c50e·04460b00·18000000·b0010000·.A...F.......... |
| 32 | ··0x005e | 32 | ··0x005e52e4·7c31b0ff·32000000·00410e08·830270c3·|1..2....A....p. |
| 33 | ··0x005e | 33 | ··0x005e52f4·0e040000·80000000·cc010000·f0aeb3ff·................ |
| 34 | ··0x005e | 34 | ··0x005e5304·ab000000·00410e08·8602410e·0c83034e·.....A....A....N |
| 35 | ··0x005e | 35 | ··0x005e5314·0e1c470e·20460e1c·470e1841·0e1c410e·..G.·F..G..A..A. |
| 36 | ··0x005e | 36 | ··0x005e5324·20460e1c·410e1844·0e1c410e·20460e1c··F..A..D..A.·F.. |
| 37 | ··0x005e | 37 | ··0x005e5334·410e1847·0e1c410e·20460e1c·410e1844·A..G..A.·F..A..D |
| 38 | ··0x005e | 38 | ··0x005e5344·0e1c410e·20460e1c·470e1841·0e1c410e·..A.·F..G..A..A. |
| 39 | ··0x005e | 39 | ··0x005e5354·20480e14·440e1844·0e1c410e·20460e1c··H..D..D..A.·F.. |
| 40 | ··0x005e | 40 | ··0x005e5364·410e1847·0e1c410e·204e0e1c·410e1846·A..G..A.·N..A..F |
| 41 | ··0x005e | 41 | ··0x005e5374·0e1c410e·20000000·20000000·50020000·..A.·...·...P... |
| 42 | ··0x005e | 42 | ··0x005e5384·1cafb3ff·26000000·00410e08·83024e0e·....&....A....N. |
| 43 | ··0x005e | 43 | ··0x005e5394·1c4d0e20·480e0841·c30e0400·28000000·.M.·H..A....(... |
| 44 | ··0x005e | 44 | ··0x005e53a4·74020000·28afb3ff·30000000·00410e08·t...(...0....A.. |
| 45 | ··0x005e | 45 | ··0x005e53b4·8602410e·0c83034e·0e1c4d0e·20500e0c·..A....N..M.·P.. |
| 46 | ··0x005e | 46 | ··0x005e53c4·41c30e08·41c60e04·2c000000·a0020000·A...A...,....... |
| 47 | ··0x005e | 47 | ··0x005e53d4·2cafb3ff·67000000·00410e08·8602410e·,...g....A....A. |
| 48 | ··0x005e | 48 | ··0x005e53e4·0c83034e·0e18720e·1c410e20·610e0c41·...N..r..A.·a..A |
| 49 | ··0x005e | 49 | ··0x005e53f4·c30e0841·c60e0400·20000000·d0020000·...A....·....... |
| 50 | ··0x005e | 50 | ··0x005e5404·4cb0b3ff·26000000·00410e08·83024e0e·L...&....A....N. |
| 51 | ··0x005e | 51 | ··0x005e5414·1c4d0e20·480e0841·c30e0400·28000000·.M.·H..A....(... |
| 52 | ··0x005e4 | 52 | ··0x005e5424·f4020000·58b0b3ff·30000000·00410e08·....X...0....A.. |
| 53 | ··0x005e43 | 53 | ··0x005e5434·8602410e·0c83034e·0e1c4d0e·20500e0c·..A....N..M.·P.. |
| 54 | ··0x005e | 54 | ··0x005e5444·41c30e08·41c60e04·20000000·20030000·A...A...·...·... |
| 55 | ··0x005e | 55 | ··0x005e5454·5cb0b3ff·26000000·00410e08·83024e0e·\...&....A....N. |
| 56 | ··0x005e | 56 | ··0x005e5464·1c4d0e20·480e0841·c30e0400·28000000·.M.·H..A....(... |
| 57 | ··0x005e | 57 | ··0x005e5474·44030000·68b0b3ff·30000000·00410e08·D...h...0....A.. |
| 58 | ··0x005e | 58 | ··0x005e5484·8602410e·0c83034e·0e1c4d0e·20500e0c·..A....N..M.·P.. |
| 59 | ··0x005e | 59 | ··0x005e5494·41c30e08·41c60e04·74000000·70030000·A...A...t...p... |
| 60 | ··0x005e | 60 | ··0x005e54a4·fc2fb0ff·a7010000·00410e08·8702410e·./.......A....A. |
| 61 | ··0x005e | 61 | ··0x005e54b4·0c860345·0e108304·024d0e18·4a0e1c41·...E.....M..J..A |
| 62 | ··0x005e | 62 | ··0x005e54c4·0e20480e·10520ac3·0e0c43c6·0e0841c7·.·H..R....C...A. |
| 63 | ··0x005e | 63 | ··0x005e54d4·0e04430b·530ac30e·0c44c60e·0841c70e·..C.S....D...A.. |
| 64 | ··0x005e | 64 | ··0x005e54e4·04480b5b·0e184a0e·1c410e20·480e1054·.H.[..J..A.·H..T |
| 65 | ··0x005e | 65 | ··0x005e54f4·0ac30e0c·41c60e08·41c70e04·4c0b460a·....A...A...L.F. |
| 66 | ··0x005e | 66 | ··0x005e5504·c30e0c41·c60e0843·c70e0446·0b000000·...A...C...F.... |
| 67 | ··0x005e | 67 | ··0x005e5514·20000000·e8030000·3431b0ff·38000000··.......41..8... |
| 68 | ··0x005e | 68 | ··0x005e5524·00410e08·8302630a·c30e044c·0b47c30e·.A....c....L.G.. |
| 69 | ··0x005e | 69 | ··0x005e5534·04000000·24000000·0c040000·5031b0ff·....$.......P1.. |
| 70 | ··0x005e | 70 | ··0x005e5544·2e000000·00410e08·83024e0e·10470e14·.....A....N..G.. |
| 71 | ··0x005e | 71 | ··0x005e5554·4b0e1841·0e1c470e·20000000·24000000·K..A..G.·...$... |
| 72 | ··0x005e | 72 | ··0x005e5564·34040000·5831b0ff·2e000000·00410e08·4...X1.......A.. |
| 73 | ··0x005e | 73 | ··0x005e5574·83024e0e·10470e14·4b0e1841·0e1c470e·..N..G..K..A..G. |
| 74 | ··0x005e | 74 | ··0x005e5584·20000000·24000000·5c040000·6031b0ff··...$...\...`1.. |
| 75 | ··0x005e | 75 | ··0x005e5594·2e000000·00410e08·83024e0e·10470e14·.....A....N..G.. |
| 76 | ··0x005e | 76 | ··0x005e55a4·4b0e1841·0e1c470e·20000000·24000000·K..A..G.·...$... |
| 77 | ··0x005e | 77 | ··0x005e55b4·84040000·6831b0ff·2e000000·00410e08·....h1.......A.. |
| 78 | ··0x005e | 78 | ··0x005e55c4·83024e0e·10470e14·4b0e1841·0e1c470e·..N..G..K..A..G. |
| 79 | ··0x005e | 79 | ··0x005e55d4·20000000·24000000·ac040000·7031b0ff··...$.......p1.. |
| 80 | ··0x005e | 80 | ··0x005e55e4·2e000000·00410e08·83024e0e·10470e14·.....A....N..G.. |
| 81 | ··0x005e | 81 | ··0x005e55f4·4b0e1841·0e1c470e·20000000·60000000·K..A..G.·...`... |
| 82 | ··0x005e | 82 | ··0x005e5604·d4040000·38afb3ff·34020000·00410e08·....8...4....A.. |
| 83 | ··0x005e | 83 | ··0x005e5614·8502410e·0c870341·0e108604·410e1483·..A....A....A... |
| 84 | ··0x005e | 84 | ··0x005e5624·054e0e60·03a9010a·0e1441c3·0e1041c6·.N.`......A...A. |
| 85 | ··0x005e | 85 | ··0x005e5634·0e0c41c7·0e0841c5·0e04410b·02500a0e·..A...A...A..P.. |
| 86 | ··0x005e | 86 | ··0x005e5644·1441c30e·1041c60e·0c41c70e·0841c50e·.A...A...A...A.. |
| 87 | ··0x005e | 87 | ··0x005e5654·04410b47·0e644b0e·68410e6c·470e7000·.A.G.dK.hA.lG.p. |
| 88 | ··0x005e | 88 | ··0x005e5664·58000000·38050000·14b1b3ff·b3080000·X...8........... |
| 89 | ··0x005e | 89 | ··0x005e5674·00410e08·8502410e·0c870341·0e108604·.A....A....A.... |
| 90 | ··0x005e | 90 | ··0x005e5684·4c0e1483·05460ee0·0103ca04·0a0e1441·L....F.........A |
| 91 | ··0x005e | 91 | ··0x005e5694·c30e1041·c60e0c41·c70e0841·c50e0445·...A...A...A...E |
| 92 | ··0x005e | 92 | ··0x005e56a4·0b038a03·0a0e1441·c30e1041·c60e0c41·.......A...A...A |
| 93 | ··0x005e | 93 | ··0x005e56b4·c70e0841·c50e0441·0b000000·60000000·...A...A....`... |
| 94 | ··0x005e | 94 | ··0x005e56c4·94050000·b830b0ff·6b010000·00410e08·.....0..k....A.. |
| 95 | ··0x005e | 95 | ··0x005e56d4·8502410e·0c870341·0e108604·4c0e1483·..A....A....L... |
| 96 | ··0x005e | 96 | ··0x005e56e4·05430e30·02b70a0e·1441c30e·1041c60e·.C.0.....A...A.. |
| 97 | ··0x005e | 97 | ··0x005e56f4·0c41c70e·0841c50e·04430b02·6e0a0e14·.A...A...C..n... |
| 98 | ··0x005e | 98 | ··0x005e5704·41c30e10·41c60e0c·41c70e08·41c50e04·A...A...A...A... |
| 99 | ··0x005e | 99 | ··0x005e5714·410b500e·344b0e38·410e3c47·0e400000·A.P.4K.8A.<G.@.. |
| 100 | ··0x005e | 100 | ··0x005e5724·4c000000·f8050000·c431b0ff·8c020000·L........1...... |
| 101 | ··0x005e | 101 | ··0x005e5734·00410e08·8502410e·0c870341·0e108604·.A....A....A.... |
| 102 | ··0x005e | 102 | ··0x005e5744·410e1483·054e0e70·03e5010a·0e1441c3·A....N.p......A. |
| 103 | ··0x005e | 103 | ··0x005e5754·0e1041c6·0e0c41c7·0e0841c5·0e04450b·..A...A...A...E. |
| 104 | ··0x005e | 104 | ··0x005e5764·02740e74·4b0e7841·0e7c470e·80010000·.t.tK.xA.|G..... |
| 105 | ··0x005e | 105 | ··0x005e5774·2c000000·48060000·0434b0ff·ca050000·,...H....4...... |
| 106 | ··0x005e | 106 | ··0x005e5784·00410e08·8302510e·e803035d·040a0e08·.A....Q....].... |
| 107 | ··0x005e | 107 | ··0x005e5794·41c30e04·500b033e·010e0841·c30e0400·A...P..>...A.... |
| 108 | ··0x005e | 108 | ··0x005e57a4·5c000000·78060000·a439b0ff·a7000000·\...x....9...... |
| 109 | ··0x005e | 109 | ··0x005e57b4·00410e08·8502430e·0c870343·0e108604·.A....C....C.... |
| 110 | ··0x005e | 110 | ··0x005e57c4·430e1483·054e0e30·02400a0e·1441c30e·C....N.0.@...A.. |
| 111 | ··0x005e | 111 | ··0x005e57d4·1041c60e·0c41c70e·0841c50e·04440b53·.A...A...A...D.S |
| 112 | ··0x005e | 112 | ··0x005e57e4·0e34420e·38450e3c·410e404c·0e30480e·.4B.8E.<A.@L.0H. |
| 113 | ··0x005e | 113 | ··0x005e57f4·34410e38·410e3c41·0e404e0e·30000000·4A.8A.<A.@N.0... |
| 114 | ··0x005e | 114 | ··0x005e5804·50000000·d8060000·f439b0ff·9a000000·P........9...... |
| 115 | ··0x005e | 115 | ··0x005e5814·00410e08·8702410e·0c860341·0e108304·.A....A....A.... |
| 116 | ··0x005e | 116 | ··0x005e5824·02400e18·420e1c41·0e204c0e·10540ac3·.@..B..A.·L..T.. |
| 117 | ··0x005e | 117 | ··0x005e5834·0e0c41c6·0e0841c7·0e04480b·430e1c41·..A...A...H.C..A |
| 118 | ··0x005e | 118 | ··0x005e5844·0e20450e·10470e14·480e1841·0e1c470e·.·E..G..H..A..G. |
| 119 | ··0x005e | 119 | ··0x005e5854·20480e10·40000000·2c070000·403ab0ff··H..@...,...@:.. |
| 120 | ··0x005e | 120 | ··0x005e5864·83090000·00410e08·8502410e·0c870341·.....A....A....A |
| 121 | ··0x005e | 121 | ··0x005e5874·0e108604·410e1483·05480ec0·03030609·....A....H...... |
| 122 | ··0x005e | 122 | ··0x005e5884·0a0e1441·c30e1041·c60e0c41·c70e0841·...A...A...A...A |
| 123 | ··0x005e | 123 | ··0x005e5894·c50e044a·0b000000·78000000·70070000·...J....x...p... |
| 124 | ··0x005e | 124 | ··0x005e58a4·8c43b0ff·44040000·00410e08·8502410e·.C..D....A....A. |
| 125 | ··0x005e | 125 | ··0x005e58b4·0c870341·0e108604·4c0e1483·05430e88·...A....L....C.. |
| Max diff block lines reached; 0/4924215 bytes (0.00%) of diff not shown. | |||
| Offset 1, 7763 lines modified | Offset 1, 7763 lines modified | ||
| Diff chunk too large, falling back to line-by-line diff (7760 lines added, 7760 lines removed) | |||
| 1 | Hex·dump·of·section·'.gcc_except_table': | 1 | Hex·dump·of·section·'.gcc_except_table': |
| 2 | ··0x0067 | 2 | ··0x006749b4·ffff0112·7605e007·00a7010d·f00700cb·....v........... |
| 3 | ··0x0067 | 3 | ··0x006749c4·01ff05eb·0700ffff·01110c16·2c006905·............,.i. |
| 4 | ··0x0067 | 4 | ··0x006749d4·00007a05·2c00a201·050000ff·ff0110bd·..z.,........... |
| 5 | ··0x0067 | 5 | ··0x006749e4·01050000·c80103d0·0100ec01·050000ff·................ |
| 6 | ··0x0067 | 6 | ··0x006749f4·ff0110bd·01050000·c80103d0·0100ec01·................ |
| 7 | ··0x0067 | 7 | ··0x00674a04·050000ff·ff0110bd·01050000·c80103d0·................ |
| 8 | ··0x0067 | 8 | ··0x00674a14·0100f201·050000ff·ff0110bd·01050000·................ |
| 9 | ··0x0067 | 9 | ··0x00674a24·c80103d0·0100f201·050000ff·ff0100ff·................ |
| 10 | ··0x0067 | 10 | ··0x00674a34·ff0100ff·ff0100ff·ff0100ff·ff0100ff·................ |
| 11 | ··0x0067 | 11 | ··0x00674a44·ff0100ff·ff0100ff·ff0100ff·ff0100ff·................ |
| 12 | ··0x0067 | 12 | ··0x00674a54·ff0100ff·ff0100ff·ff0100ff·ff0100ff·................ |
| 13 | ··0x0067 | 13 | ··0x00674a64·ff0100ff·ff0100ff·ff0100ff·ff0100ff·................ |
| 14 | ··0x0067 | 14 | ··0x00674a74·ff0100ff·ff0100ff·ff0100ff·ff0100ff·................ |
| 15 | ··0x0067 | 15 | ··0x00674a84·ff0100ff·ff0100ff·ff010000·ff9b1501·................ |
| 16 | ··0x0067 | 16 | ··0x00674a94·0dda01e2·010000f9·03c201bb·05010100·................ |
| 17 | ··0x0067 | 17 | ··0x00674aa4·00000000·ff9b1101·0818051d·002b0500·.............+.. |
| 18 | ··0x0067 | 18 | ··0x00674ab4·00010000·00000000·ffff010a·3e5ea901·............>^.. |
| 19 | ··0x0067 | 19 | ··0x00674ac4·00bb0105·00000000·ff9b0d01·05670589·.............g.. |
| 20 | ··0x0067 | 20 | ··0x00674ad4·02010100·00000000·ff9b0d01·05670591·.............g.. |
| 21 | ··0x0067 | 21 | ··0x00674ae4·02010100·00000000·ff9b2901·1c8d01a5·..........)..... |
| 22 | ··0x0067 | 22 | ··0x00674af4·010000fe·0205e704·01ad0305·0000de03·................ |
| 23 | ··0x0067 | 23 | ··0x00674b04·05e20401·dd040500·00010000·7d000000·............}... |
| 24 | ··0x0067 | 24 | ··0x00674b14·00000000·ff9b2501·18540559·03780584·......%..T.Y.x.. |
| 25 | ··0x0067 | 25 | ··0x00674b24·01007f05·96010091·01050000·a3010500·................ |
| 26 | ··0x0067 | 26 | ··0x00674b34·00010000·7d000000·00000000·ff9b1101·....}........... |
| 27 | ··0x0067 | 27 | ··0x00674b44·09310500·005405c0·07010100·00000000·.1...T.......... |
| 28 | ··0x0067 | 28 | ··0x00674b54·ff9b1101·08290533·00530500·00010000·.....).3.S...... |
| 29 | ··0x0067 | 29 | ··0x00674b64·00000000·ffff0121·5c200000·ae03539b·.......!\·....S. |
| 30 | ··0x0067 | 30 | ··0x00674b74·0800a704·05960800·8805058c·0800c905·................ |
| 31 | ··0x0067 | 31 | ··0x00674b84·05850800·80080500·00ffff01·13460500·.............F.. |
| 32 | ··0x0067 | 32 | ··0x00674b94·0068056d·00a10105·4b00bf01·17d60100·.h.m....K....... |
| 33 | ··0x0067 | 33 | ··0x00674ba4·ffff011d·83010500·00e40156·ff0500dc·...........V.... |
| 34 | ··0x0067 | 34 | ··0x00674bb4·02058b06·00af0305·84060097·04e30100·................ |
| 35 | ··0x0067 | 35 | ··0x00674bc4·00ffff01·1219055a·00440500·008a0105·.......Z.D...... |
| 36 | ··0x0067 | 36 | ··0x00674bd4·1e009c01·055a00ff·ff013081·02d60200·.....Z....0..... |
| 37 | ··0x0067 | 37 | ··0x00674be4·00f00405·c01600a3·0505bb16·00b40605·................ |
| 38 | ··0x0067 | 38 | ··0x00674bf4·b41600c0·0705af16·00970905·aa16008d·................ |
| 39 | ··0x0067 | 39 | ··0x00674c04·0a05c716·00d10c05·aa1600ff·ff011420·...............· |
| 40 | ··0x0067 | 40 | ··0x00674c14·05950200·4e058101·007c0591·02008c02·....N....|...... |
| 41 | ··0x0067 | 41 | ··0x00674c24·050000ff·ff0125a0·01b302ed·0e00ac04·......%......... |
| 42 | ··0x0067 | 42 | ··0x00674c34·05fb0e00·d60505ed·0e00eb05·05f40e00·................ |
| 43 | ··0x0067 | 43 | ··0x00674c44·fc0640ed·0e00f808·05fb0e00·ffff0108·..@............. |
| 44 | ··0x0067 | 44 | ··0x00674c54·3f050000·7b050100·ffff0135·49180000·?...{......5I... |
| 45 | ··0x0067 | 45 | ··0x00674c64·fa0117fa·0a00b502·05f50a00·840352fa·..............R. |
| 46 | ··0x0067 | 46 | ··0x00674c74·0a00fa03·05f00a00·e904ae03·fa0a00d4·................ |
| 47 | ··0x0067 | 47 | ··0x00674c84·0850e30a·00a90905·e80a00e6·096dfa0a·.P...........m.. |
| 48 | ··0x0067 | 48 | ··0x00674c94·00ffff01·2c162040·00840105·0000a101·....,.·@........ |
| 49 | ··0x0067 | 49 | ··0x00674ca4·05e30100·bc0105fa·0100d401·05000092·................ |
| 50 | ··0x0067 | 50 | ··0x00674cb4·0216fa01·00ca0205·f60200e7·0205fa01·................ |
| 51 | ··0x0067 | 51 | ··0x00674cc4·00000000·ff9b1901·11bd011f·0000e602·................ |
| 52 | ··0x0067 | 52 | ··0x00674cd4·05f30501·8f03e402·00000100·cc6a0200·.............j.. |
| 53 | ··0x0067 | 53 | ··0x00674ce4·ff9b1501·0c1f053c·00271500·00490500·.......<.'...I.. |
| 54 | ··0x0067 | 54 | ··0x00674cf4·00010000·b46a0200·ff9b3101·24800305·.....j....1.$... |
| 55 | ··0x0067 | 55 | ··0x00674d04·c30801d8·0372e508·03870505·c30801df·.....r.......... |
| 56 | ··0x0067 | 56 | ··0x00674d14·0572db08·03f80605·c30801d0·076ed108·.r...........n.. |
| 57 | ··0x0067 | 57 | ··0x00674d24·037f0000·7d000000·806a0200·01000000·....}....j...... |
| 58 | ··0x0067 | 58 | ··0x00674d34·ff9b2901·1d19051e·034b0500·006e051e·..)......K...n.. |
| 59 | ··0x0067 | 59 | ··0x00674d44·03860105·0000b301·23e00103·fe0123ab·........#.....#. |
| 60 | ··0x0067 | 60 | ··0x00674d54·02037f00·007d0000·506a0200·0100ffff·.....}..Pj...... |
| 61 | ··0x0067 | 61 | ··0x00674d64·01127add·020000e6·03ab01d2·0500c105·..z............. |
| 62 | ··0x0067 | 62 | ··0x00674d74·05cb0500·ffff0135·1f059405·00350590·.......5.....5.. |
| 63 | ··0x0067 | 63 | ··0x00674d84·05004705·98050075·05a40400·cc012d00·..G....u......-. |
| 64 | ··0x0067 | 64 | ··0x00674d94·00900205·f70200a7·0205b303·00ed0246·...............F |
| 65 | ··0x0067 | 65 | ··0x00674da4·0000e803·05ed0300·9a047100·00ffff01·..........q..... |
| 66 | ··0x0067 | 66 | ··0x00674db4·2ab50105·c8060095·0305d606·00f20405·*............... |
| 67 | ··0x0067 | 67 | ··0x00674dc4·cf0600aa·0605d606·00b90605·cf0600be·................ |
| 68 | ··0x0067 | 68 | ··0x00674dd4·0605d606·00c30605·cf0600ff·ff01058f·................ |
| 69 | ··0x0067 | 69 | ··0x00674de4·01050000·ffff0134·93060586·07009806·.......4........ |
| 70 | ··0x0067 | 70 | ··0x00674df4·0500009d·0605a706·00a20605·ab0600e8·................ |
| 71 | ··0x0067 | 71 | ··0x00674e04·06050000·ed0605ab·0600f206·05860700·................ |
| 72 | ··0x0067 | 72 | ··0x00674e14·f7060a8a·07008107·05a70600·ff9b3901·..............9. |
| 73 | ··0x0067 | 73 | ··0x00674e24·26ac0105·ea0d03e0·0105d40d·03ee0105·&............... |
| 74 | ··0x0067 | 74 | ··0x00674e34·fc0d0386·02a307e0·0d03c909·05db0d05·................ |
| 75 | ··0x0067 | 75 | ··0x00674e44·e20ae502·e00d0301·00007d02·00000000·..........}..... |
| 76 | ··0x0067 | 76 | ··0x00674e54·00000000·58690200·ff9b2901·1918335a·....Xi....)...3Z |
| 77 | ··0x0067 | 77 | ··0x00674e64·03df0105·e503008f·02055a03·a203225a·..........Z..."Z |
| 78 | ··0x0067 | 78 | ··0x00674e74·03d6033e·00000100·007d0200·00000000·...>.....}...... |
| 79 | ··0x0067 | 79 | ··0x00674e84·2c690200·ff9b3501·24b00105·ba0503dc·,i....5.$....... |
| 80 | ··0x0067 | 80 | ··0x00674e94·01059f05·03ea0105·8e050387·0264ad05·.............d.. |
| 81 | ··0x0067 | 81 | ··0x00674ea4·03b10305·a80505c3·0436ad05·03010000·.........6...... |
| 82 | ··0x0067 | 82 | ··0x00674eb4·7d020000·00000000·f4680200·ff9b1d01·}........h...... |
| 83 | ··0x0067 | 83 | ··0x00674ec4·0bcd0105·b70200b2·02340000·0100007d·.........4.....} |
| 84 | ··0x0067 | 84 | ··0x00674ed4·02000000·00000000·d4680200·ff9b3901·.........h....9. |
| 85 | ··0x0067 | 85 | ··0x00674ee4·26c20105·bb0803ee·0105b208·03fc0105·&............... |
| 86 | ··0x0067 | 86 | ··0x00674ef4·a1080399·02c602c8·08039705·059c0805·................ |
| 87 | ··0x0067 | 87 | ··0x00674f04·ac06e301·c8080301·00007d02·00000000·..........}..... |
| 88 | ··0x0067 | 88 | ··0x00674f14·00000000·98680200·ff9b2101·11e50105·.....h....!..... |
| 89 | ··0x0067 | 89 | ··0x00674f24·dc020091·02059b02·03d20239·00000100·...........9.... |
| 90 | ··0x0067 | 90 | ··0x00674f34·007d0200·00000000·74680200·ffff0115·.}......th...... |
| 91 | ··0x0067 | 91 | ··0x00674f44·3a03ec01·004d03e8·01008a01·16e10100·:....M.......... |
| 92 | ··0x0067 | 92 | ··0x00674f54·85020500·00ffff01·15320500·00810103·.........2...... |
| 93 | ··0x0067 | 93 | ··0x00674f64·d50100c3·0105d701·00ff0118·0000ffff·................ |
| 94 | ··0x0067 | 94 | ··0x00674f74·01153205·00008101·03d50100·c30105d7·..2............. |
| 95 | ··0x0067 | 95 | ··0x00674f84·0100ff01·180000ff·ff011532·05000081·...........2.... |
| 96 | ··0x0067 | 96 | ··0x00674f94·0103d501·00c30105·d70100f9·01180000·................ |
| 97 | ··0x0067 | 97 | ··0x00674fa4·ffff0115·32050000·810103d5·0100c301·....2........... |
| 98 | ··0x0067 | 98 | ··0x00674fb4·05d70100·f9011800·00ffff01·13e603f0·................ |
| 99 | ··0x0067 | 99 | ··0x00674fc4·03ad0900·fc0705a6·0900f608·30ad0900·............0... |
| 100 | ··0x0067 | 100 | ··0x00674fd4·ffff0108·0f054e00·44050000·ffff011e·......N.D....... |
| 101 | ··0x0067 | 101 | ··0x00674fe4·91010599·0900c201·05940900·950305a0·................ |
| 102 | ··0x0067 | 102 | ··0x00674ff4·0900c204·05ac0900·820732a7·0900ffff·..........2..... |
| 103 | ··0x0067 | 103 | ··0x00675004·010e3405·00005105·0a008201·05870100·..4...Q......... |
| 104 | ··0x0067 | 104 | ··0x00675014·ffff0124·c10205e5·0a00fc03·05d40a00·...$............ |
| 105 | ··0x0067 | 105 | ··0x00675024·b20635e0·0a00d708·05c60a00·860905db·..5............. |
| 106 | ··0x0067 | 106 | ··0x00675034·0a00810a·45cd0a00·ffff010f·20053700·....E.......·.7. |
| 107 | ··0x0067 | 107 | ··0x00675044·94010500·00b10105·c3010000·ff9b6901·..............i. |
| 108 | ··0x0067 | 108 | ··0x00675054·50a70272·0000e704·059b1405·990505a8·P..r............ |
| 109 | ··0x0067 | 109 | ··0x00675064·1405ac05·05af1405·c905aa04·c01405b4·................ |
| 110 | ··0x0067 | 110 | ··0x00675074·0a059614·07d30c05·0000860d·3ac01405·............:... |
| 111 | ··0x0067 | 111 | ··0x00675084·ad104a00·00901105·c01405c3·11050000·..J............. |
| 112 | ··0x0067 | 112 | ··0x00675094·ad12058f·1400ab13·05c01405·f0130500·................ |
| 113 | ··0x0067 | 113 | ··0x006750a4·00020001·7d007d03·00000000·00000000·....}.}......... |
| 114 | ··0x0067 | 114 | ··0x006750b4·00670200·f8660200·ff9b3d01·271c9a01·.g...f....=.'... |
| 115 | ··0x0067 | 115 | ··0x006750c4·00008b03·050000a2·0405d304·00860505·................ |
| 116 | ··0x0067 | 116 | ··0x006750d4·00009f05·05c80500·ef050500·008b06cd·................ |
| 117 | ··0x0067 | 117 | ··0x006750e4·01900305·0200017d·007d0300·00000000·.......}.}...... |
| 118 | ··0x0067 | 118 | ··0x006750f4·c0660200·b8660200·ffff0119·56059507·.f...f......V... |
| 119 | ··0x0067 | 119 | ··0x00675104·00910185·039c0700·a40405a6·0700fd04·................ |
| 120 | ··0x0067 | 120 | ··0x00675114·85029c07·00ffff01·0c0f054e·00440500·...........N.D.. |
| 121 | ··0x0067 | 121 | ··0x00675124·0070194e·00ffff01·194d05b7·05009f01·.p.N.....M...... |
| 122 | ··0x0067 | 122 | ··0x00675134·c701b205·00f40205·ab0500c9·03cd01b2·................ |
| 123 | ··0x0067 | 123 | ··0x00675144·0500ffff·010c0f05·59004f05·00007b19·........Y.O...{. |
| 124 | ··0x0067 | 124 | ··0x00675154·5900ffff·01195605·ba0f0089·01e806b5·Y.....V......... |
| 125 | ··0x0067 | 125 | ··0x00675164·0f00fd07·05c10f00·b608f506·b50f00ff·................ |
| Max diff block lines reached; 0/1039886 bytes (0.00%) of diff not shown. | |||
| Offset 1, 6 lines modified | Offset 1, 6 lines modified | ||
| 1 | Hex·dump·of·section·'.init_array': | 1 | Hex·dump·of·section·'.init_array': |
| 2 | ··0x0069 | 2 | ··0x0069316c·507f0e00·40400e00·d0410e00·a0670e00·P...@@...A...g.. |
| 3 | ··0x0069 | 3 | ··0x0069317c·c0690e00·e06b0e00·b06e0e00·d0700e00·.i...k...n...p.. |
| 4 | ··0x0069 | 4 | ··0x0069318c·a0730e00·10770e00·d0780e00·107d0e00·.s...w...x...}.. |
| Offset 1, 4 lines modified | Offset 1, 4 lines modified | ||
| 1 | Hex·dump·of·section·'.fini_array': | 1 | Hex·dump·of·section·'.fini_array': |
| 2 | ··0x0069 | 2 | ··0x0069319c·007f0e00····························.... |
| Offset 1, 1917 lines modified | Offset 1, 1917 lines modified | ||
| Diff chunk too large, falling back to line-by-line diff (915 lines added, 1171 lines removed) | |||
| 1 | Hex·dump·of·section·'.data.rel.ro': | 1 | Hex·dump·of·section·'.data.rel.ro': |
| 2 | ··0x0069 | 2 | ··0x006931a0·00000000·183b6900·a0021200·d0021200·.....;i......... |
| 3 | ··0x0069 | 3 | ··0x006931b0·e0011200·dc316900·7c3c6900·903c6900·.....1i.|<i..<i. |
| 4 | ··0x0069 | 4 | ··0x006931c0·543c6900·683c6900·04326900·f0316900·T<i.h<i..2i..1i. |
| 5 | ··0x0069 | 5 | ··0x006931d0·64010000·00000000·243b6900·00031200·d.......$;i..... |
| 6 | ··0x0069 | 6 | ··0x006931e0·60101200·08000000·a4feffff·243b6900·`...........$;i. |
| 7 | ··0x0069 | 7 | ··0x006931f0·e0031200·e0101200·9cfeffff·9cfeffff·................ |
| 8 | ··0x0069 | 8 | ··0x00693200·243b6900·70031200·50111200·00000000·$;i.p...P....... |
| 9 | ··0x0069 | 9 | ··0x00693210·703e6900·00fc1200·40fc1200·5c326900·p>i.....@...\2i. |
| 10 | ··0x0069 | 10 | ··0x00693220·603f6900·243f6900·fc3e6900·103f6900·`?i.$?i..>i..?i. |
| 11 | ··0x0069 | 11 | ··0x00693230·d43e6900·e83e6900·4c3f6900·383f6900·.>i..>i.L?i.8?i. |
| 12 | ··0x0069 | 12 | ··0x00693240·883f6900·743f6900·84326900·70326900·.?i.t?i..2i.p2i. |
| 13 | ··0x0069 | 13 | ··0x00693250·48000000·00000000·883e6900·a01c1500·H........>i..... |
| 14 | ··0x0069 | 14 | ··0x00693260·001e1500·40000000·f8ffffff·883e6900·....@........>i. |
| 15 | ··0x0069 | 15 | ··0x00693270·f01b1500·b01e1500·b8ffffff·b8ffffff·................ |
| 16 | ··0x0069 | 16 | ··0x00693280·883e6900·501d1500·601f1500·00000000·.>i.P...`....... |
| 17 | ··0x0069 | 17 | ··0x00693290·d0466900·d0ae1a00·709a1a00·e09a1a00·.Fi.....p....... |
| 18 | ··0x0069 | 18 | ··0x006932a0·009a1a00·009d1a00·109c1a00·109a1a00·................ |
| 19 | ··0x0069 | 19 | ··0x006932b0·e09b1a00·209a1a00·609b1a00·00000000·....·...`....... |
| 20 | ··0x0069 | 20 | ··0x006932c0·d8466900·a0a11900·d05e1a00·10711900·.Fi......^...q.. |
| 21 | ··0x0069 | 21 | ··0x006932d0·10721900·50481900·a0481900·70471900·.r..PH...H..pG.. |
| 22 | ··0x0069 | 22 | ··0x006932e0·30561900·c0521900·d0b51900·10db1900·0V...R.......... |
| 23 | ··0x0069 | 23 | ··0x006932f0·e04a1a00·10d71900·80451900·70191500·.J.......E..p... |
| 24 | ··0x0069 | 24 | ··0x00693300·10461900·40ca1900·80191500·80941900·.F..@........... |
| 25 | ··0x0069 | 25 | ··0x00693310·00000000·00476900·c0b31a00·50b41a00·.....Gi.....P... |
| 26 | ··0x0069 | 26 | ··0x00693320·50451b00·00000000·18476900·f0511b00·PE.......Gi..Q.. |
| 27 | ··0x0069 | 27 | ··0x00693330·60521b00·60511b00·a04f1b00·404f1b00·`R..`Q...O..@O.. |
| 28 | ··0x0069 | 28 | ··0x00693340·00000000·20476900·40691b00·20691b00·....·Gi.@i..·i.. |
| 29 | ··0x0069 | 29 | ··0x00693350·e0681b00·009a1a00·009d1a00·109c1a00·.h.............. |
| 30 | ··0x0069 | 30 | ··0x00693360·109a1a00·e09b1a00·209a1a00·609b1a00·........·...`... |
| 31 | ··0x0069 | 31 | ··0x00693370·00000000·bc496900·00c71c00·a0be1c00·.....Ii......... |
| 32 | ··0x0069 | 32 | ··0x00693380·f0be1c00·009a1a00·009d1a00·109c1a00·................ |
| 33 | ··0x0069 | 33 | ··0x00693390·109a1a00·e09b1a00·209a1a00·609b1a00·........·...`... |
| 34 | ··0x0069 | 34 | ··0x006933a0·00000000·9c4e6900·f0d71d00·50d71d00·.....Ni.....P... |
| 35 | ··0x0069 | 35 | ··0x006933b0·a0d71d00·70da1d00·10d91d00·60d91d00·....p.......`... |
| 36 | ··0x0069 | 36 | ··0x006933c0·00da1d00·20d91d00·30d91d00·d0da1d00·....·...0....... |
| 37 | ··0x0069 | 37 | ··0x006933d0·00000000·e44e6900·307f1e00·a07f1e00·.....Ni.0....... |
| 38 | ··0x0069 | 38 | ··0x006933e0·90801e00·c07f1e00·507f1e00·00000000·........P....... |
| 39 | ··0x0069 | 39 | ··0x006933f0·f04e6900·207f1e00·607f1e00·e07f1e00·.Ni.·...`....... |
| 40 | ··0x0069 | 40 | ··0x00693400·807f1e00·407f1e00·ac5c5100·b65c5100·....@....\Q..\Q. |
| 41 | ··0x0069 | 41 | ··0x00693410·00dd5100·bd5c5100·635c5100·c55c5100·..Q..\Q.c\Q..\Q. |
| 42 | ··0x0069 | 42 | ··0x00693420·00000000·e4516900·e0ad2200·10ae2200·.....Qi..."...". |
| 43 | ··0x0069 | 43 | ··0x00693430·00000000·90536900·40622d00·00632d00·.....Si.@b-..c-. |
| 44 | ··0x0069 | 44 | ··0x00693440·40632d00·20632d00·70622d00·00000000·@c-.·c-.pb-..... |
| 45 | ··0x0069 | 45 | ··0x00693450·9c536900·30622d00·c0622d00·f0632d00·.Si.0b-..b-..c-. |
| 46 | ··0x0069 | 46 | ··0x00693460·e0622d00·60622d00·00000000·a8536900·.b-.`b-......Si. |
| 47 | ··0x0069 | 47 | ··0x00693470·20622d00·80622d00·a0642d00·a0622d00··b-..b-..d-..b-. |
| 48 | ··0x0069 | 48 | ··0x00693480·50622d00·00000000·bc536900·e0192f00·Pb-......Si.../. |
| 49 | ··0x0069 | 49 | ··0x00693490·b01a2f00·e0172f00·f0172f00·80352f00·../.../.../..5/. |
| 50 | ··0x0069 | 50 | ··0x006934a0·c0302f00·50362f00·90312f00·002d2f00·.0/.P6/..1/..-/. |
| 51 | ··0x0069 | 51 | ··0x006934b0·80332f00·102d2f00·50fa2e00·00000000·.3/..-/.P....... |
| 52 | ··0x0069 | 52 | ··0x006934c0·b4546900·b06b3200·306c3200·00000000·.Ti..k2.0l2..... |
| 53 | ··0x0069 | 53 | ··0x006934d0·28566900·f0633400·40643400·00000000·(Vi..c4.@d4..... |
| 54 | ··0x0069 | 54 | ··0x006934e0·04000000·04000000·02000000·04000000·................ |
| 55 | ··0x0069 | 55 | ··0x006934f0·04000000·01000000·02000000·08000000·................ |
| 56 | ··0x0069 | 56 | ··0x00693500·02000000·02000000·00000000·00000000·................ |
| 57 | ··0x0069 | 57 | ··0x00693510·03000000·8c185d00·02000000·00000000·......]......... |
| 58 | ··0x0069 | 58 | ··0x00693520·00145d00·10000000·10000000·04000000·..]............. |
| 59 | ··0x0069 | 59 | ··0x00693530·10000000·10000000·06000000·04000000·................ |
| 60 | ··0x0069 | 60 | ··0x00693540·40000000·06000000·04000000·00000000·@............... |
| 61 | ··0x0069 | 61 | ··0x00693550·00000000·0f000000·7c185d00·04000000·........|.]..... |
| 62 | ··0x0069 | 62 | ··0x00693560·00000000·00145d00·90010000·90010000·......]......... |
| 63 | ··0x0069 | 63 | ··0x00693570·14000000·90010000·90010000·be000000·................ |
| 64 | ··0x0069 | 64 | ··0x00693580·14000000·cc010000·be000000·14000000·................ |
| 65 | ··0x0069 | 65 | ··0x00693590·00000000·00000000·16000000·64185d00·............d.]. |
| 66 | ··0x0069 | 66 | ··0x006935a0·14000000·01000000·a0135d00·00010000·..........]..... |
| 67 | ··0x0069 | 67 | ··0x006935b0·00010000·10000000·00010000·00010000·................ |
| 68 | ··0x0069 | 68 | ··0x006935c0·78000000·10000000·00100000·78000000·x...........x... |
| 69 | ··0x0069 | 69 | ··0x006935d0·10000000·00000000·00000000·ff000000·................ |
| 70 | ··0x0069 | 70 | ··0x006935e0·00000000·10000000·01000000·a00f5d00·..............]. |
| 71 | ··0x0069 | 71 | ··0x006935f0·24000000·24000000·06000000·24000000·$...$.......$... |
| 72 | ··0x0069 | 72 | ··0x00693600·24000000·0f000000·06000000·80010000·$............... |
| 73 | ··0x0069 | 73 | ··0x00693610·0f000000·06000000·00000000·00000000·................ |
| 74 | ··0x0069 | 74 | ··0x00693620·3f000000·00000000·06000000·01000000·?............... |
| 75 | ··0x0069 | 75 | ··0x00693630·00145d00·31000000·31000000·07000000·..].1...1....... |
| 76 | ··0x0069 | 76 | ··0x00693640·31000000·31000000·15000000·07000000·1...1........... |
| 77 | ··0x0069 | 77 | ··0x00693650·80030000·15000000·07000000·00000000·................ |
| 78 | ··0x0069 | 78 | ··0x00693660·00000000·7f000000·00000000·07000000·................ |
| 79 | ··0x0069 | 79 | ··0x00693670·01000000·00145d00·00040000·00040000·......]......... |
| 80 | ··0x0069 | 80 | ··0x00693680·20000000·00040000·00040000·f0010000··............... |
| 81 | ··0x0069 | 81 | ··0x00693690·20000000·20040000·f0010000·20000000··...·.......·... |
| 82 | ··0x0069 | 82 | ··0x006936a0·00000000·00000000·20000000·40185d00·........·...@.]. |
| 83 | ··0x0069 | 83 | ··0x006936b0·20000000·01000000·000f5d00·00100000··.........]..... |
| 84 | ··0x0069 | 84 | ··0x006936c0·00100000·40000000·00100000·00100000·....@........... |
| 85 | ··0x0069 | 85 | ··0x006936d0·e0070000·40000000·40100000·40000000·....@...@...@... |
| 86 | ··0x0069 | 86 | ··0x006936e0·e0070000·00000000·00000000·40000000·............@... |
| 87 | ··0x0069 | 87 | ··0x006936f0·00000000·40000000·01000000·00000000·....@........... |
| 88 | ··0x0069 | 88 | ··0x00693700·a85f6900·f0606900·c0616900·68666900·._i..`i..ai.hfi. |
| 89 | ··0x0069 | 89 | ··0x00693710·48646900·70656900·40666900·08626900·Hdi.pei.@fi..bi. |
| 90 | ··0x0069 | 90 | ··0x00693720·50636900·20646900·24686900·f4686900·Pci.·di.$hi..hi. |
| 91 | ··0x0069 | 91 | ··0x00693730·dc666900·486a6900·706b6900·406c6900·.fi.Hji.pki.@li. |
| 92 | ··0x0069 | 92 | ··0x00693740·bc6e6900·c46f6900·94706900·08736900·.ni..oi..pi..si. |
| 93 | ··0x0069 | 93 | ··0x00693750·c8706900·10726900·e0726900·5c746900·.pi..ri..ri.\ti. |
| 94 | ··0x0069 | 94 | ··0x00693760·2c756900·207c6900·007a6900·287b6900·,ui.·|i..zi.({i. |
| 95 | ··0x0069 | 95 | ··0x00693770·f87b6900·b4776900·74756900·bc766900·.{i..wi.tui..vi. |
| 96 | ··0x0069 | 96 | ··0x00693780·8c776900·08796900·d8796900·d87d6900·.wi..yi..yi..}i. |
| 97 | ··0x0069 | 97 | ··0x00693790·a87e6900·847c6900·e87e6900·0c806900·.~i..|i..~i...i. |
| 98 | ··0x0069 | 98 | ··0x006937a0·dc806900·60856900·40836900·68846900·..i.`.i.@.i.h.i. |
| 99 | ··0x0069 | 99 | ··0x006937b0·38856900·24816900·48826900·18836900·8.i.$.i.H.i...i. |
| 100 | ··0x0069 | 100 | ··0x006937c0·e8866900·b8876900·c4856900·00886900·..i...i...i...i. |
| 101 | ··0x0069 | 101 | ··0x006937d0·b8896900·ec8a6900·108b6900·388b6900·..i...i...i.8.i. |
| 102 | ··0x0069 | 102 | ··0x006937e0·d48c6900·088e6900·2c8e6900·80946900·..i...i.,.i...i. |
| 103 | ··0x0069 | 103 | ··0x006937f0·7c916900·18936900·4c946900·70946900·|.i...i.L.i.p.i. |
| 104 | ··0x0069 | 104 | ··0x00693800·5c8e6900·14906900·48916900·6c916900·\.i...i.H.i.l.i. |
| 105 | ··0x0069 | 105 | ··0x00693810·b0966900·e4976900·08986900·f8946900·..i...i...i...i. |
| 106 | ··0x0069 | 106 | ··0x00693820·40c06900·34c06900·28c06900·1cc06900·@.i.4.i.(.i...i. |
| 107 | ··0x0069 | 107 | ··0x00693830·10c06900·04c06900·f8bf6900·ecbf6900·..i...i...i...i. |
| 108 | ··0x0069 | 108 | ··0x00693840·e0bf6900·00000000·00000000·00000000·..i............. |
| 109 | ··0x0069 | 109 | ··0x00693850·00000000·00000000·00000000·00000000·................ |
| 110 | ··0x0069 | 110 | ··0x00693860·b4635d00·ac635d00·a0635d00·94635d00·.c]..c]..c]..c]. |
| 111 | ··0x0069 | 111 | ··0x00693870·88635d00·7c635d00·6c635d00·5c635d00·.c].|c].lc].\c]. |
| 112 | ··0x0069 | 112 | ··0x00693880·4c635d00·3c635d00·28635d00·14635d00·Lc].<c].(c]..c]. |
| 113 | ··0x0069 | 113 | ··0x00693890·00635d00·ec625d00·d8625d00·c4625d00·.c]..b]..b]..b]. |
| 114 | ··0x0069 | 114 | ··0x006938a0·b0625d00·9c625d00·88625d00·70625d00·.b]..b]..b].pb]. |
| 115 | ··0x0069 | 115 | ··0x006938b0·58625d00·40625d00·28625d00·10625d00·Xb].@b].(b]..b]. |
| 116 | ··0x0069 | 116 | ··0x006938c0·f8615d00·e0615d00·c0615d00·a0615d00·.a]..a]..a]..a]. |
| 117 | ··0x0069 | 117 | ··0x006938d0·80615d00·60615d00·40615d00·20615d00·.a].`a].@a].·a]. |
| 118 | ··0x0069 | 118 | ··0x006938e0·e0605d00·a0605d00·60605d00·20605d00·.`]..`].``].·`]. |
| 119 | ··0x0069 | 119 | ··0x006938f0·e05f5d00·70625d00·00000000·00000000·._].pb]......... |
| 120 | ··0x0069 | 120 | ··0x00693900·c0695d00·60695d00·00695d00·a0685d00·.i].`i]..i]..h]. |
| 121 | ··0x0069 | 121 | ··0x00693910·40685d00·e0645d00·80645d00·20645d00·@h]..d]..d].·d]. |
| 122 | ··0x0069 | 122 | ··0x00693920·c0635d00·e0675d00·20675d00·00665d00·.c]..g].·g]..f]. |
| 123 | ··0x0069 | 123 | ··0x00693930·00000000·c8a26900·c0cd4700·50396900·......i...G.P9i. |
| 124 | ··0x0069 | 124 | ··0x00693940·64396900·5c010000·00000000·dca26900·d9i.\.........i. |
| 125 | ··0x0069 | 125 | ··0x00693950·202e4800·502f4800·a4feffff·a4feffff··.H.P/H......... |
| Max diff block lines reached; 116440/256330 bytes (45.43%) of diff not shown. | |||
| Offset 1, 92 lines modified | Offset 1, 92 lines modified | ||
| 1 | Hex·dump·of·section·'.got': | 1 | Hex·dump·of·section·'.got': |
| 2 | ·NOTE:·This·section·has·relocations·against·it,·but·these·have·NOT·been·applied·to·this·dump. | 2 | ·NOTE:·This·section·has·relocations·against·it,·but·these·have·NOT·been·applied·to·this·dump. |
| 3 | ··0x0069 | 3 | ··0x0069aa64·3ca96900·00000000·00000000·36000800·<.i.........6... |
| 4 | ··0x0069 | 4 | ··0x0069aa74·46000800·56000800·66000800·76000800·F...V...f...v... |
| 5 | ··0x0069 | 5 | ··0x0069aa84·86000800·96000800·a6000800·b6000800·................ |
| 6 | ··0x0069 | 6 | ··0x0069aa94·c6000800·d6000800·e6000800·f6000800·................ |
| 7 | ··0x0069 | 7 | ··0x0069aaa4·06010800·16010800·26010800·36010800·........&...6... |
| 8 | ··0x0069 | 8 | ··0x0069aab4·46010800·56010800·66010800·76010800·F...V...f...v... |
| 9 | ··0x0069 | 9 | ··0x0069aac4·86010800·96010800·a6010800·b6010800·................ |
| 10 | ··0x0069 | 10 | ··0x0069aad4·c6010800·d6010800·e6010800·f6010800·................ |
| 11 | ··0x0069 | 11 | ··0x0069aae4·06020800·16020800·26020800·36020800·........&...6... |
| 12 | ··0x0069 | 12 | ··0x0069aaf4·46020800·56020800·66020800·76020800·F...V...f...v... |
| 13 | ··0x0069 | 13 | ··0x0069ab04·86020800·96020800·a6020800·b6020800·................ |
| 14 | ··0x0069 | 14 | ··0x0069ab14·c6020800·d6020800·e6020800·f6020800·................ |
| 15 | ··0x0069 | 15 | ··0x0069ab24·06030800·16030800·26030800·36030800·........&...6... |
| 16 | ··0x0069 | 16 | ··0x0069ab34·46030800·56030800·66030800·76030800·F...V...f...v... |
| 17 | ··0x0069 | 17 | ··0x0069ab44·86030800·96030800·a6030800·b6030800·................ |
| 18 | ··0x0069 | 18 | ··0x0069ab54·c6030800·d6030800·e6030800·f6030800·................ |
| 19 | ··0x0069 | 19 | ··0x0069ab64·06040800·16040800·26040800·36040800·........&...6... |
| 20 | ··0x0069 | 20 | ··0x0069ab74·46040800·56040800·66040800·76040800·F...V...f...v... |
| 21 | ··0x0069 | 21 | ··0x0069ab84·86040800·96040800·a6040800·b6040800·................ |
| 22 | ··0x0069 | 22 | ··0x0069ab94·c6040800·d6040800·e6040800·f6040800·................ |
| 23 | ··0x0069 | 23 | ··0x0069aba4·06050800·16050800·26050800·36050800·........&...6... |
| 24 | ··0x0069 | 24 | ··0x0069abb4·46050800·56050800·66050800·76050800·F...V...f...v... |
| 25 | ··0x0069 | 25 | ··0x0069abc4·86050800·96050800·a6050800·b6050800·................ |
| 26 | ··0x0069 | 26 | ··0x0069abd4·c6050800·d6050800·e6050800·f6050800·................ |
| 27 | ··0x0069 | 27 | ··0x0069abe4·06060800·16060800·26060800·36060800·........&...6... |
| 28 | ··0x0069 | 28 | ··0x0069abf4·46060800·56060800·66060800·76060800·F...V...f...v... |
| 29 | ··0x0069 | 29 | ··0x0069ac04·86060800·96060800·a6060800·b6060800·................ |
| 30 | ··0x0069 | 30 | ··0x0069ac14·c6060800·d6060800·e6060800·f6060800·................ |
| 31 | ··0x0069 | 31 | ··0x0069ac24·06070800·16070800·26070800·36070800·........&...6... |
| 32 | ··0x0069 | 32 | ··0x0069ac34·46070800·56070800·66070800·76070800·F...V...f...v... |
| 33 | ··0x0069 | 33 | ··0x0069ac44·86070800·96070800·a6070800·b6070800·................ |
| 34 | ··0x0069 | 34 | ··0x0069ac54·c6070800·d6070800·e6070800·f6070800·................ |
| 35 | ··0x0069 | 35 | ··0x0069ac64·06080800·16080800·26080800·36080800·........&...6... |
| 36 | ··0x0069 | 36 | ··0x0069ac74·46080800·56080800·66080800·76080800·F...V...f...v... |
| 37 | ··0x0069 | 37 | ··0x0069ac84·86080800·96080800·a6080800·b6080800·................ |
| 38 | ··0x0069 | 38 | ··0x0069ac94·c6080800·d6080800·e6080800·f6080800·................ |
| 39 | ··0x0069 | 39 | ··0x0069aca4·06090800·16090800·26090800·36090800·........&...6... |
| 40 | ··0x0069 | 40 | ··0x0069acb4·46090800·56090800·66090800·76090800·F...V...f...v... |
| 41 | ··0x0069 | 41 | ··0x0069acc4·86090800·96090800·a6090800·b6090800·................ |
| 42 | ··0x0069 | 42 | ··0x0069acd4·c6090800·d6090800·e6090800·f6090800·................ |
| 43 | ··0x0069 | 43 | ··0x0069ace4·060a0800·160a0800·260a0800·360a0800·........&...6... |
| 44 | ··0x0069 | 44 | ··0x0069acf4·460a0800·560a0800·660a0800·760a0800·F...V...f...v... |
| 45 | ··0x0069 | 45 | ··0x0069ad04·860a0800·960a0800·a60a0800·b60a0800·................ |
| 46 | ··0x0069 | 46 | ··0x0069ad14·c60a0800·d60a0800·e60a0800·f60a0800·................ |
| 47 | ··0x0069 | 47 | ··0x0069ad24·060b0800·160b0800·260b0800·360b0800·........&...6... |
| 48 | ··0x0069 | 48 | ··0x0069ad34·460b0800·560b0800·660b0800·760b0800·F...V...f...v... |
| 49 | ··0x0069 | 49 | ··0x0069ad44·860b0800·960b0800·a60b0800·b60b0800·................ |
| 50 | ··0x0069 | 50 | ··0x0069ad54·c60b0800·d60b0800·e60b0800·f60b0800·................ |
| 51 | ··0x0069 | 51 | ··0x0069ad64·060c0800·160c0800·260c0800·360c0800·........&...6... |
| 52 | ··0x0069 | 52 | ··0x0069ad74·460c0800·560c0800·660c0800·760c0800·F...V...f...v... |
| 53 | ··0x0069 | 53 | ··0x0069ad84·860c0800·960c0800·a60c0800·b60c0800·................ |
| 54 | ··0x0069 | 54 | ··0x0069ad94·c60c0800·d60c0800·e60c0800·f60c0800·................ |
| 55 | ··0x0069 | 55 | ··0x0069ada4·060d0800·160d0800·260d0800·360d0800·........&...6... |
| 56 | ··0x0069 | 56 | ··0x0069adb4·460d0800·560d0800·660d0800·760d0800·F...V...f...v... |
| 57 | ··0x0069 | 57 | ··0x0069adc4·860d0800·960d0800·a60d0800·b60d0800·................ |
| 58 | ··0x0069 | 58 | ··0x0069add4·c60d0800·d60d0800·e60d0800·f60d0800·................ |
| 59 | ··0x0069 | 59 | ··0x0069ade4·060e0800·160e0800·260e0800·360e0800·........&...6... |
| 60 | ··0x0069 | 60 | ··0x0069adf4·460e0800·560e0800·660e0800·760e0800·F...V...f...v... |
| 61 | ··0x0069 | 61 | ··0x0069ae04·860e0800·960e0800·a60e0800·b60e0800·................ |
| 62 | ··0x0069 | 62 | ··0x0069ae14·c60e0800·d60e0800·e60e0800·f60e0800·................ |
| 63 | ··0x0069 | 63 | ··0x0069ae24·060f0800·160f0800·260f0800·360f0800·........&...6... |
| 64 | ··0x0069 | 64 | ··0x0069ae34·460f0800·560f0800·660f0800·760f0800·F...V...f...v... |
| 65 | ··0x0069 | 65 | ··0x0069ae44·860f0800·960f0800·a60f0800·b60f0800·................ |
| 66 | ··0x0069 | 66 | ··0x0069ae54·c60f0800·d60f0800·e60f0800·f60f0800·................ |
| 67 | ··0x0069 | 67 | ··0x0069ae64·06100800·16100800·26100800·36100800·........&...6... |
| 68 | ··0x0069 | 68 | ··0x0069ae74·46100800·56100800·66100800·76100800·F...V...f...v... |
| 69 | ··0x0069 | 69 | ··0x0069ae84·86100800·96100800·a6100800·b6100800·................ |
| 70 | ··0x0069 | 70 | ··0x0069ae94·c6100800·d6100800·e6100800·f6100800·................ |
| 71 | ··0x0069 | 71 | ··0x0069aea4·06110800·16110800·26110800·36110800·........&...6... |
| 72 | ··0x0069 | 72 | ··0x0069aeb4·46110800·56110800·66110800·76110800·F...V...f...v... |
| 73 | ··0x0069 | 73 | ··0x0069aec4·86110800·96110800·a6110800·b6110800·................ |
| 74 | ··0x0069 | 74 | ··0x0069aed4·c6110800·d6110800·e6110800·f6110800·................ |
| 75 | ··0x0069 | 75 | ··0x0069aee4·06120800·16120800·26120800·36120800·........&...6... |
| 76 | ··0x0069 | 76 | ··0x0069aef4·46120800·56120800·f0516900·80526900·F...V....Qi..Ri. |
| 77 | ··0x0069 | 77 | ··0x0069af04·00000000·00000000·eccc6a00·00000000·..........j..... |
| 78 | ··0x0069 | 78 | ··0x0069af14·e8cc6a00·00000000·5c526900·80562d00·..j.....\Ri..V-. |
| 79 | ··0x0069 | 79 | ··0x0069af24·e0430e00·50526900·00000000·00000000·.C..PRi......... |
| 80 | ··0x0069 | 80 | ··0x0069af34·00000000·2c526900·00000000·00000000·....,Ri......... |
| 81 | ··0x0069 | 81 | ··0x0069af44·00000000·30562d00·00000000·00000000·....0V-......... |
| 82 | ··0x0069 | 82 | ··0x0069af54·00000000·00000000·00000000·00000000·................ |
| 83 | ··0x0069 | 83 | ··0x0069af64·00000000·00000000·00000000·00000000·................ |
| 84 | ··0x0069 | 84 | ··0x0069af74·00000000·00000000·00000000·00000000·................ |
| 85 | ··0x0069 | 85 | ··0x0069af84·00000000·00000000·60cb6a00·b0532d00·........`.j..S-. |
| 86 | ··0x0069 | 86 | ··0x0069af94·00542d00·00000000·00000000·00000000·.T-............. |
| 87 | ··0x0069 | 87 | ··0x0069afa4·00000000·00000000·70572d00·00000000·........pW-..... |
| 88 | ··0x0069 | 88 | ··0x0069afb4·00000000·fc516900·40552d00·00000000·.....Qi.@U-..... |
| 89 | ··0x0069 | 89 | ··0x0069afc4·00000000·00000000·00000000·00000000·................ |
| 90 | ··0x0069 | 90 | ··0x0069afd4·00000000·00000000·00000000·00000000·................ |
| Offset 1, 4173 lines modified | Offset 1, 4173 lines modified | ||
| Diff chunk too large, falling back to line-by-line diff (4170 lines added, 4170 lines removed) | |||
| 1 | Hex·dump·of·section·'.data': | 1 | Hex·dump·of·section·'.data': |
| 2 | ··0x0069 | 2 | ··0x0069b000·00000000·04b06900·00000000·00000000·......i......... |
| 3 | ··0x0069 | 3 | ··0x0069b010·00000000·00000000·00000000·00000000·................ |
| 4 | ··0x0069 | 4 | ··0x0069b020·4b4e4b4e·54545454·52535253·49494d49·KNKNTTTTRSRSIIMI |
| 5 | ··0x0069 | 5 | ··0x0069b030·51485148·50505050·52525252·4c4c4c4c·QHQHPPPPRRRRLLLL |
| 6 | ··0x0069 | 6 | ··0x0069b040·45444544·41414141·47474747·56565656·EDEDAAAAGGGGVVVV |
| 7 | ··0x0069 | 7 | ··0x0069b050·2a592a59·53535353·47435743·4c464c46·*Y*YSSSSGCWCLFLF |
| 8 | ··0x0069 | 8 | ··0x0069b060·00000000·00000000·00000000·00000000·................ |
| 9 | ··0x0069 | 9 | ··0x0069b070·00000000·00000000·00000000·00000000·................ |
| 10 | ··0x0069 | 10 | ··0x0069b080·4b4e4b4e·54545454·53534b53·49494d49·KNKNTTTTSSKSIIMI |
| 11 | ··0x0069 | 11 | ··0x0069b090·51485148·50505050·52525252·4c4c4c4c·QHQHPPPPRRRRLLLL |
| 12 | ··0x0069 | 12 | ··0x0069b0a0·45444544·41414141·47474747·56565656·EDEDAAAAGGGGVVVV |
| 13 | ··0x0069 | 13 | ··0x0069b0b0·2a592a59·53535353·57435743·4c464c46·*Y*YSSSSWCWCLFLF |
| 14 | ··0x0069 | 14 | ··0x0069b0c0·00000000·00000000·00000000·00000000·................ |
| 15 | ··0x0069 | 15 | ··0x0069b0d0·00000000·00000000·00000000·00000000·................ |
| 16 | ··0x0069 | 16 | ··0x0069b0e0·4b4e4b4e·54545454·52535253·49494d49·KNKNTTTTRSRSIIMI |
| 17 | ··0x0069 | 17 | ··0x0069b0f0·51485148·50505050·52525252·4c4c4c4c·QHQHPPPPRRRRLLLL |
| 18 | ··0x0069 | 18 | ··0x0069b100·45444544·41414141·47474747·56565656·EDEDAAAAGGGGVVVV |
| 19 | ··0x0069 | 19 | ··0x0069b110·2a592a59·53535353·2a435743·2a464c46·*Y*YSSSS*CWC*FLF |
| 20 | ··0x0069 | 20 | ··0x0069b120·00000000·00000000·00000000·00000000·................ |
| 21 | ··0x0069 | 21 | ··0x0069b130·00000000·00000000·00000000·00000000·................ |
| 22 | ··0x0069 | 22 | ··0x0069b140·4b4e4b4e·54545454·52535253·49494d49·KNKNTTTTRSRSIIMI |
| 23 | ··0x0069 | 23 | ··0x0069b150·51485148·50505050·52525252·4c4c4c4c·QHQHPPPPRRRRLLLL |
| 24 | ··0x0069 | 24 | ··0x0069b160·45444544·41414141·47474747·56565656·EDEDAAAAGGGGVVVV |
| 25 | ··0x0069 | 25 | ··0x0069b170·2a594c59·2a535353·2a435743·4c464c46·*YLY*SSS*CWCLFLF |
| 26 | ··0x0069 | 26 | ··0x0069b180·00000000·00000000·00000000·00000000·................ |
| 27 | ··0x0069 | 27 | ··0x0069b190·00000000·00000000·00000000·00000000·................ |
| 28 | ··0x0069 | 28 | ··0x0069b1a0·4e4e4b4e·54545454·53535353·4d494d49·NNKNTTTTSSSSMIMI |
| 29 | ··0x0069 | 29 | ··0x0069b1b0·51485148·50505050·52525252·4c4c4c4c·QHQHPPPPRRRRLLLL |
| 30 | ··0x0069 | 30 | ··0x0069b1c0·45444544·41414141·47474747·56565656·EDEDAAAAGGGGVVVV |
| 31 | ··0x0069 | 31 | ··0x0069b1d0·2a592a59·53535353·57435743·4c464c46·*Y*YSSSSWCWCLFLF |
| 32 | ··0x0069 | 32 | ··0x0069b1e0·00000000·00000000·00000000·00000000·................ |
| 33 | ··0x0069 | 33 | ··0x0069b1f0·00000000·00000000·00000000·00000000·................ |
| 34 | ··0x0069 | 34 | ··0x0069b200·4b4e4b4e·54545454·52535253·49494d49·KNKNTTTTRSRSIIMI |
| 35 | ··0x0069 | 35 | ··0x0069b210·51485148·50505050·52525252·4c4c4c4c·QHQHPPPPRRRRLLLL |
| 36 | ··0x0069 | 36 | ··0x0069b220·45444544·41414141·47474747·56565656·EDEDAAAAGGGGVVVV |
| 37 | ··0x0069 | 37 | ··0x0069b230·2a594c59·53535353·2a435743·4c464c46·*YLYSSSS*CWCLFLF |
| 38 | ··0x0069 | 38 | ··0x0069b240·00000000·00000000·00000000·00000000·................ |
| 39 | ··0x0069 | 39 | ··0x0069b250·00000000·00000000·00000000·00000000·................ |
| 40 | ··0x0069 | 40 | ··0x0069b260·4b4e4b4e·54545454·52535253·49494d49·KNKNTTTTRSRSIIMI |
| 41 | ··0x0069 | 41 | ··0x0069b270·51485148·50505050·52525252·4c4c4c4c·QHQHPPPPRRRRLLLL |
| 42 | ··0x0069 | 42 | ··0x0069b280·45444544·41414141·47474747·56565656·EDEDAAAAGGGGVVVV |
| 43 | ··0x0069 | 43 | ··0x0069b290·2a595159·53535353·2a435743·4c464c46·*YQYSSSS*CWCLFLF |
| 44 | ··0x0069 | 44 | ··0x0069b2a0·00000000·00000000·00000000·00000000·................ |
| 45 | ··0x0069 | 45 | ··0x0069b2b0·00000000·00000000·00000000·00000000·................ |
| 46 | ··0x0069 | 46 | ··0x0069b2c0·4e4e4b4e·54545454·53535353·49494d49·NNKNTTTTSSSSIIMI |
| 47 | ··0x0069 | 47 | ··0x0069b2d0·51485148·50505050·52525252·4c4c4c4c·QHQHPPPPRRRRLLLL |
| 48 | ··0x0069 | 48 | ··0x0069b2e0·45444544·41414141·47474747·56565656·EDEDAAAAGGGGVVVV |
| 49 | ··0x0069 | 49 | ··0x0069b2f0·59592a59·53535353·57435743·4c464c46·YY*YSSSSWCWCLFLF |
| 50 | ··0x0069 | 50 | ··0x0069b300·00000000·00000000·00000000·00000000·................ |
| 51 | ··0x0069 | 51 | ··0x0069b310·00000000·00000000·00000000·00000000·................ |
| 52 | ··0x0069 | 52 | ··0x0069b320·4b4e4b4e·54545454·47534753·4d494d49·KNKNTTTTGSGSMIMI |
| 53 | ··0x0069 | 53 | ··0x0069b330·51485148·50505050·52525252·4c4c4c4c·QHQHPPPPRRRRLLLL |
| 54 | ··0x0069 | 54 | ··0x0069b340·45444544·41414141·47474747·56565656·EDEDAAAAGGGGVVVV |
| 55 | ··0x0069 | 55 | ··0x0069b350·2a592a59·53535353·57435743·4c464c46·*Y*YSSSSWCWCLFLF |
| 56 | ··0x0069 | 56 | ··0x0069b360·00000000·00000000·00000000·00000000·................ |
| 57 | ··0x0069 | 57 | ··0x0069b370·00000000·00000000·00000000·00000000·................ |
| 58 | ··0x0069 | 58 | ··0x0069b380·4b4e4b4e·54545454·52535253·49494d49·KNKNTTTTRSRSIIMI |
| 59 | ··0x0069 | 59 | ··0x0069b390·51485148·50505050·52525252·4c4c534c·QHQHPPPPRRRRLLSL |
| 60 | ··0x0069 | 60 | ··0x0069b3a0·45444544·41414141·47474747·56565656·EDEDAAAAGGGGVVVV |
| 61 | ··0x0069 | 61 | ··0x0069b3b0·2a592a59·53535353·2a435743·4c464c46·*Y*YSSSS*CWCLFLF |
| 62 | ··0x0069 | 62 | ··0x0069b3c0·00000000·00000000·00000000·00000000·................ |
| 63 | ··0x0069 | 63 | ··0x0069b3d0·00000000·00000000·00000000·00000000·................ |
| 64 | ··0x0069 | 64 | ··0x0069b3e0·4b4e4b4e·54545454·52535253·49494d49·KNKNTTTTRSRSIIMI |
| 65 | ··0x0069 | 65 | ··0x0069b3f0·51485148·50505050·52525252·4c4c4c4c·QHQHPPPPRRRRLLLL |
| 66 | ··0x0069 | 66 | ··0x0069b400·45444544·41414141·47474747·56565656·EDEDAAAAGGGGVVVV |
| 67 | ··0x0069 | 67 | ··0x0069b410·2a592a59·53535353·2a435743·4c464c46·*Y*YSSSS*CWCLFLF |
| 68 | ··0x0069 | 68 | ··0x0069b420·00000000·00000000·00000000·00000000·................ |
| 69 | ··0x0069 | 69 | ··0x0069b430·00000000·00000000·00000000·00000000·................ |
| 70 | ··0x0069 | 70 | ··0x0069b440·4b4e4b4e·54545454·52535253·49494d49·KNKNTTTTRSRSIIMI |
| 71 | ··0x0069 | 71 | ··0x0069b450·51485148·50505050·52525252·4c4c4c4c·QHQHPPPPRRRRLLLL |
| 72 | ··0x0069 | 72 | ··0x0069b460·45444544·41414141·47474747·56565656·EDEDAAAAGGGGVVVV |
| 73 | ··0x0069 | 73 | ··0x0069b470·2a592a59·53535353·43435743·4c464c46·*Y*YSSSSCCWCLFLF |
| 74 | ··0x0069 | 74 | ··0x0069b480·00000000·00000000·00000000·00000000·................ |
| 75 | ··0x0069 | 75 | ··0x0069b490·00000000·00000000·00000000·00000000·................ |
| 76 | ··0x0069 | 76 | ··0x0069b4a0·4e4e4b4e·54545454·53535353·49494d49·NNKNTTTTSSSSIIMI |
| 77 | ··0x0069 | 77 | ··0x0069b4b0·51485148·50505050·52525252·4c4c4c4c·QHQHPPPPRRRRLLLL |
| 78 | ··0x0069 | 78 | ··0x0069b4c0·45444544·41414141·47474747·56565656·EDEDAAAAGGGGVVVV |
| 79 | ··0x0069 | 79 | ··0x0069b4d0·2a592a59·53535353·57435743·4c464c46·*Y*YSSSSWCWCLFLF |
| 80 | ··0x0069 | 80 | ··0x0069b4e0·00000000·00000000·00000000·00000000·................ |
| 81 | ··0x0069 | 81 | ··0x0069b4f0·00000000·00000000·00000000·00000000·................ |
| 82 | ··0x0069 | 82 | ··0x0069b500·4b4e4b4e·54545454·52535253·49494d49·KNKNTTTTRSRSIIMI |
| 83 | ··0x0069 | 83 | ··0x0069b510·51485148·50505050·52525252·4c4c4c4c·QHQHPPPPRRRRLLLL |
| 84 | ··0x0069 | 84 | ··0x0069b520·45444544·41414141·47474747·56565656·EDEDAAAAGGGGVVVV |
| 85 | ··0x0069 | 85 | ··0x0069b530·51595159·53535353·2a435743·4c464c46·QYQYSSSS*CWCLFLF |
| 86 | ··0x0069 | 86 | ··0x0069b540·00000000·00000000·00000000·00000000·................ |
| 87 | ··0x0069 | 87 | ··0x0069b550·00000000·00000000·00000000·00000000·................ |
| 88 | ··0x0069 | 88 | ··0x0069b560·4b4e4b4e·54545454·53535353·4d494d49·KNKNTTTTSSSSMIMI |
| 89 | ··0x0069 | 89 | ··0x0069b570·51485148·50505050·52525252·4c4c4c4c·QHQHPPPPRRRRLLLL |
| 90 | ··0x0069 | 90 | ··0x0069b580·45444544·41414141·47474747·56565656·EDEDAAAAGGGGVVVV |
| 91 | ··0x0069 | 91 | ··0x0069b590·2a592a59·53535353·57435743·4c464c46·*Y*YSSSSWCWCLFLF |
| 92 | ··0x0069 | 92 | ··0x0069b5a0·00000000·00000000·00000000·00000000·................ |
| 93 | ··0x0069 | 93 | ··0x0069b5b0·00000000·00000000·00000000·00000000·................ |
| 94 | ··0x0069 | 94 | ··0x0069b5c0·4b4e4b4e·54545454·52535253·49494d49·KNKNTTTTRSRSIIMI |
| 95 | ··0x0069 | 95 | ··0x0069b5d0·51485148·50505050·52525252·4c4c4c4c·QHQHPPPPRRRRLLLL |
| 96 | ··0x0069 | 96 | ··0x0069b5e0·45444544·41414141·47474747·56565656·EDEDAAAAGGGGVVVV |
| 97 | ··0x0069 | 97 | ··0x0069b5f0·2a592a59·53535353·57435743·4c464c46·*Y*YSSSSWCWCLFLF |
| 98 | ··0x0069 | 98 | ··0x0069b600·00000000·00000000·00000000·00000000·................ |
| 99 | ··0x0069 | 99 | ··0x0069b610·00000000·00000000·00000000·00000000·................ |
| 100 | ··0x0069 | 100 | ··0x0069b620·4b4e4b4e·54545454·52535253·4d494d49·KNKNTTTTRSRSMIMI |
| 101 | ··0x0069 | 101 | ··0x0069b630·51485148·50505050·52525252·54545454·QHQHPPPPRRRRTTTT |
| 102 | ··0x0069 | 102 | ··0x0069b640·45444544·41414141·47474747·56565656·EDEDAAAAGGGGVVVV |
| 103 | ··0x0069 | 103 | ··0x0069b650·2a592a59·53535353·57435743·4c464c46·*Y*YSSSSWCWCLFLF |
| 104 | ··0x0069 | 104 | ··0x0069b660·00000000·00000000·00000000·00000000·................ |
| 105 | ··0x0069 | 105 | ··0x0069b670·00000000·00000000·00000000·00000000·................ |
| 106 | ··0x0069 | 106 | ··0x0069b680·4b4e4b4e·54545454·2a532a53·4d494d49·KNKNTTTT*S*SMIMI |
| 107 | ··0x0069 | 107 | ··0x0069b690·51485148·50505050·52525252·4c4c4c4c·QHQHPPPPRRRRLLLL |
| 108 | ··0x0069 | 108 | ··0x0069b6a0·45444544·41414141·47474747·56565656·EDEDAAAAGGGGVVVV |
| 109 | ··0x0069 | 109 | ··0x0069b6b0·2a592a59·53535353·57435743·4c464c46·*Y*YSSSSWCWCLFLF |
| 110 | ··0x0069 | 110 | ··0x0069b6c0·00000000·00000000·00000000·00000000·................ |
| 111 | ··0x0069 | 111 | ··0x0069b6d0·00000000·00000000·00000000·00000000·................ |
| 112 | ··0x0069 | 112 | ··0x0069b6e0·4b4e4b4e·54545454·52535253·49494d49·KNKNTTTTRSRSIIMI |
| 113 | ··0x0069 | 113 | ··0x0069b6f0·51485148·50505050·52525252·4c4c4c4c·QHQHPPPPRRRRLLLL |
| 114 | ··0x0069 | 114 | ··0x0069b700·45444544·41414141·47474747·56565656·EDEDAAAAGGGGVVVV |
| 115 | ··0x0069 | 115 | ··0x0069b710·2a592a59·53535353·2a435743·4c464c46·*Y*YSSSS*CWCLFLF |
| 116 | ··0x0069 | 116 | ··0x0069b720·00000000·00000000·00000000·00000000·................ |
| 117 | ··0x0069 | 117 | ··0x0069b730·00000000·00000000·00000000·00000000·................ |
| 118 | ··0x0069 | 118 | ··0x0069b740·30313233·34353637·38394142·43444546·0123456789ABCDEF |
| 119 | ··0x0069 | 119 | ··0x0069b750·4748494a·4b4c4d4e·4f505152·53545556·GHIJKLMNOPQRSTUV |
| 120 | ··0x0069 | 120 | ··0x0069b760·00000000·41434755·00000000·41434754·....ACGU....ACGT |
| 121 | ··0x0069 | 121 | ··0x0069b770·00000000·41524e44·43514547·48494c4b·....ARNDCQEGHILK |
| 122 | ··0x0069 | 122 | ··0x0069b780·4d465053·54575956·58000000·5c595200·MFPSTWYVX...\YR. |
| 123 | ··0x0069 | 123 | ··0x0069b790·80595200·9a395100·7c395100·a0595200·.YR..9Q.|9Q..YR. |
| 124 | ··0x0069 | 124 | ··0x0069b7a0·dc595200·50205200·ffffffff·6c3b6900·.YR.P·R.....l;i. |
| 125 | ··0x0069 | 125 | ··0x0069b7b0·00000000·00000000·00000000·00000000·................ |
| Max diff block lines reached; 0/558828 bytes (0.00%) of diff not shown. | |||
| Offset 1, 8 lines modified | Offset 1, 8 lines modified | ||
| 1 | Hex·dump·of·section·'.gnu_debugaltlink': | 1 | Hex·dump·of·section·'.gnu_debugaltlink': |
| 2 | ··0x00000000·2f757372·2f6c6962·2f646562·75672f2e·/usr/lib/debug/. | 2 | ··0x00000000·2f757372·2f6c6962·2f646562·75672f2e·/usr/lib/debug/. |
| 3 | ··0x00000010·64777a2f·69333836·2d6c696e·75782d67·dwz/i386-linux-g | 3 | ··0x00000010·64777a2f·69333836·2d6c696e·75782d67·dwz/i386-linux-g |
| 4 | ··0x00000020·6e752f69·71747265·652e6465·62756700·nu/iqtree.debug. | 4 | ··0x00000020·6e752f69·71747265·652e6465·62756700·nu/iqtree.debug. |
| 5 | ··0x00000030· | 5 | ··0x00000030·6b572d48·6c5a52d6·d5a227cc·ab12a58e·kW-HlZR...'..... |
| 6 | ··0x00000040· | 6 | ··0x00000040·b8e8e5e8····························.... |
| Offset 1, 7 lines modified | Offset 1, 7 lines modified | ||
| 1 | Hex·dump·of·section·'.gnu_debuglink': | 1 | Hex·dump·of·section·'.gnu_debuglink': |
| 2 | ··0x00000000·30336564·37393033·32623031·61653133·03ed79032b01ae13 | ||
| 3 | ··0x000000 | 2 | ··0x00000000·30353066·36303237·38643263·30613262·050f60278d2c0a2b |
| 3 | ··0x00000010·32636532·36373737·39636436·64613332·2ce267779cd6da32 | ||
| 4 | ··0x00000020· | 4 | ··0x00000020·66623330·31342e64·65627567·00000000·fb3014.debug.... |
| 5 | ··0x00000030· | 5 | ··0x00000030·537c0ba4····························S|.. |
| Offset 1, 3 lines modified | Offset 1, 3 lines modified | ||
| 1 | -rw-r--r--···0········0········0········4·2022-01-21·11:05:21.000000·debian-binary | 1 | -rw-r--r--···0········0········0········4·2022-01-21·11:05:21.000000·debian-binary |
| 2 | -rw-r--r--···0········0········0······696·2022-01-21·11:05:21.000000·control.tar.xz | 2 | -rw-r--r--···0········0········0······696·2022-01-21·11:05:21.000000·control.tar.xz |
| 3 | -rw-r--r--···0········0········0·760 | 3 | -rw-r--r--···0········0········0·76069064·2022-01-21·11:05:21.000000·data.tar.xz |
| Offset 1, 12 lines modified | Offset 1, 12 lines modified | ||
| 1 | Package:·iqtree-dbgsym | 1 | Package:·iqtree-dbgsym |
| 2 | Source:·iqtree | 2 | Source:·iqtree |
| 3 | Version:·2.0.7+dfsg-1 | 3 | Version:·2.0.7+dfsg-1 |
| 4 | Auto-Built-Package:·debug-symbols | 4 | Auto-Built-Package:·debug-symbols |
| 5 | Architecture:·i386 | 5 | Architecture:·i386 |
| 6 | Maintainer:·Debian·Med·Packaging·Team·<debian-med-packaging@lists.alioth.debian.org> | 6 | Maintainer:·Debian·Med·Packaging·Team·<debian-med-packaging@lists.alioth.debian.org> |
| 7 | Installed-Size:·80 | 7 | Installed-Size:·80687 |
| 8 | Depends:·iqtree·(=·2.0.7+dfsg-1) | 8 | Depends:·iqtree·(=·2.0.7+dfsg-1) |
| 9 | Section:·debug | 9 | Section:·debug |
| 10 | Priority:·optional | 10 | Priority:·optional |
| 11 | Description:·debug·symbols·for·iqtree | 11 | Description:·debug·symbols·for·iqtree |
| 12 | Build-Ids:· | 12 | Build-Ids:·235fee460a3080e8cc20829326b4b50a3516b56b·24050f60278d2c0a2b2ce267779cd6da32fb3014·af6a21c80fc63827ad9ba4fb14784f02c16f66ae |
| Offset 1, 4 lines modified | Offset 1, 4 lines modified | ||
| 1 | usr/lib/debug/.build-id/60/c9691be7d5788f1a260fe04b2e14dd6507ce33.debug | ||
| 2 | usr/lib/debug/.build-id/74/2a4fd5b19c6c30271efde095a9d2bf6eb0534c.debug | ||
| 3 | usr/lib/debug/.build-id/ | 1 | usr/lib/debug/.build-id/23/5fee460a3080e8cc20829326b4b50a3516b56b.debug |
| 2 | usr/lib/debug/.build-id/24/050f60278d2c0a2b2ce267779cd6da32fb3014.debug | ||
| 3 | usr/lib/debug/.build-id/af/6a21c80fc63827ad9ba4fb14784f02c16f66ae.debug | ||
| 4 | usr/lib/debug/.dwz/i386-linux-gnu/iqtree.debug | 4 | usr/lib/debug/.dwz/i386-linux-gnu/iqtree.debug |
| Offset 1, 17 lines modified | Offset 1, 17 lines modified | ||
| 1 | drwxr-xr-x···0·root·········(0)·root·········(0)········0·2022-01-21·11:05:21.000000·./ | 1 | drwxr-xr-x···0·root·········(0)·root·········(0)········0·2022-01-21·11:05:21.000000·./ |
| 2 | drwxr-xr-x···0·root·········(0)·root·········(0)········0·2022-01-21·11:05:21.000000·./usr/ | 2 | drwxr-xr-x···0·root·········(0)·root·········(0)········0·2022-01-21·11:05:21.000000·./usr/ |
| 3 | drwxr-xr-x···0·root·········(0)·root·········(0)········0·2022-01-21·11:05:21.000000·./usr/lib/ | 3 | drwxr-xr-x···0·root·········(0)·root·········(0)········0·2022-01-21·11:05:21.000000·./usr/lib/ |
| 4 | drwxr-xr-x···0·root·········(0)·root·········(0)········0·2022-01-21·11:05:21.000000·./usr/lib/debug/ | 4 | drwxr-xr-x···0·root·········(0)·root·········(0)········0·2022-01-21·11:05:21.000000·./usr/lib/debug/ |
| 5 | drwxr-xr-x···0·root·········(0)·root·········(0)········0·2022-01-21·11:05:21.000000·./usr/lib/debug/.build-id/ | 5 | drwxr-xr-x···0·root·········(0)·root·········(0)········0·2022-01-21·11:05:21.000000·./usr/lib/debug/.build-id/ |
| 6 | drwxr-xr-x···0·root·········(0)·root·········(0)········0·2022-01-21·11:05:21.000000·./usr/lib/debug/.build-id/ | 6 | drwxr-xr-x···0·root·········(0)·root·········(0)········0·2022-01-21·11:05:21.000000·./usr/lib/debug/.build-id/23/ |
| 7 | -rw-r--r--···0·root·········(0)·root·········(0)·23 | 7 | -rw-r--r--···0·root·········(0)·root·········(0)·23144548·2022-01-21·11:05:21.000000·./usr/lib/debug/.build-id/23/5fee460a3080e8cc20829326b4b50a3516b56b.debug |
| 8 | drwxr-xr-x···0·root·········(0)·root·········(0)········0·2022-01-21·11:05:21.000000·./usr/lib/debug/.build-id/ | 8 | drwxr-xr-x···0·root·········(0)·root·········(0)········0·2022-01-21·11:05:21.000000·./usr/lib/debug/.build-id/24/ |
| 9 | -rw-r--r--···0·root·········(0)·root·········(0)·23 | 9 | -rw-r--r--···0·root·········(0)·root·········(0)·23035176·2022-01-21·11:05:21.000000·./usr/lib/debug/.build-id/24/050f60278d2c0a2b2ce267779cd6da32fb3014.debug |
| 10 | drwxr-xr-x···0·root·········(0)·root·········(0)········0·2022-01-21·11:05:21.000000·./usr/lib/debug/.build-id/ | 10 | drwxr-xr-x···0·root·········(0)·root·········(0)········0·2022-01-21·11:05:21.000000·./usr/lib/debug/.build-id/af/ |
| 11 | -rw-r--r--···0·root·········(0)·root·········(0)·230 | 11 | -rw-r--r--···0·root·········(0)·root·········(0)·23035136·2022-01-21·11:05:21.000000·./usr/lib/debug/.build-id/af/6a21c80fc63827ad9ba4fb14784f02c16f66ae.debug |
| 12 | drwxr-xr-x···0·root·········(0)·root·········(0)········0·2022-01-21·11:05:21.000000·./usr/lib/debug/.dwz/ | 12 | drwxr-xr-x···0·root·········(0)·root·········(0)········0·2022-01-21·11:05:21.000000·./usr/lib/debug/.dwz/ |
| 13 | drwxr-xr-x···0·root·········(0)·root·········(0)········0·2022-01-21·11:05:21.000000·./usr/lib/debug/.dwz/i386-linux-gnu/ | 13 | drwxr-xr-x···0·root·········(0)·root·········(0)········0·2022-01-21·11:05:21.000000·./usr/lib/debug/.dwz/i386-linux-gnu/ |
| 14 | -rw-r--r--···0·root·········(0)·root·········(0)·1339 | 14 | -rw-r--r--···0·root·········(0)·root·········(0)·13391212·2022-01-21·11:05:21.000000·./usr/lib/debug/.dwz/i386-linux-gnu/iqtree.debug |
| 15 | drwxr-xr-x···0·root·········(0)·root·········(0)········0·2022-01-21·11:05:21.000000·./usr/share/ | 15 | drwxr-xr-x···0·root·········(0)·root·········(0)········0·2022-01-21·11:05:21.000000·./usr/share/ |
| 16 | drwxr-xr-x···0·root·········(0)·root·········(0)········0·2022-01-21·11:05:21.000000·./usr/share/doc/ | 16 | drwxr-xr-x···0·root·········(0)·root·········(0)········0·2022-01-21·11:05:21.000000·./usr/share/doc/ |
| 17 | lrwxrwxrwx···0·root·········(0)·root·········(0)········0·2022-01-21·11:05:21.000000·./usr/share/doc/iqtree-dbgsym·->·iqtree | 17 | lrwxrwxrwx···0·root·········(0)·root·········(0)········0·2022-01-21·11:05:21.000000·./usr/share/doc/iqtree-dbgsym·->·iqtree |
| Offset 6, 15 lines modified | Offset 6, 15 lines modified | ||
| 6 | ··OS/ABI:····························UNIX·-·GNU | 6 | ··OS/ABI:····························UNIX·-·GNU |
| 7 | ··ABI·Version:·······················0 | 7 | ··ABI·Version:·······················0 |
| 8 | ··Type:······························REL·(Relocatable·file) | 8 | ··Type:······························REL·(Relocatable·file) |
| 9 | ··Machine:···························Intel·80386 | 9 | ··Machine:···························Intel·80386 |
| 10 | ··Version:···························0x1 | 10 | ··Version:···························0x1 |
| 11 | ··Entry·point·address:···············0x0 | 11 | ··Entry·point·address:···············0x0 |
| 12 | ··Start·of·program·headers:··········0·(bytes·into·file) | 12 | ··Start·of·program·headers:··········0·(bytes·into·file) |
| 13 | ··Start·of·section·headers:··········13390 | 13 | ··Start·of·section·headers:··········13390932·(bytes·into·file) |
| 14 | ··Flags:·····························0x0 | 14 | ··Flags:·····························0x0 |
| 15 | ··Size·of·this·header:···············52·(bytes) | 15 | ··Size·of·this·header:···············52·(bytes) |
| 16 | ··Size·of·program·headers:···········0·(bytes) | 16 | ··Size·of·program·headers:···········0·(bytes) |
| 17 | ··Number·of·program·headers:·········0 | 17 | ··Number·of·program·headers:·········0 |
| 18 | ··Size·of·section·headers:···········40·(bytes) | 18 | ··Size·of·section·headers:···········40·(bytes) |
| 19 | ··Number·of·section·headers:·········7 | 19 | ··Number·of·section·headers:·········7 |
| 20 | ··Section·header·string·table·index:·6 | 20 | ··Section·header·string·table·index:·6 |
| Offset 1, 16 lines modified | Offset 1, 16 lines modified | ||
| 1 | There·are·7·section·headers,·starting·at·offset·0xcc5 | 1 | There·are·7·section·headers,·starting·at·offset·0xcc5454: |
| 2 | Section·Headers: | 2 | Section·Headers: |
| 3 | ··[Nr]·Name··············Type············Addr·····Off····Size···ES·Flg·Lk·Inf·Al | 3 | ··[Nr]·Name··············Type············Addr·····Off····Size···ES·Flg·Lk·Inf·Al |
| 4 | ··[·0]···················NULL············00000000·000000·000000·00······0···0··0 | 4 | ··[·0]···················NULL············00000000·000000·000000·00······0···0··0 |
| 5 | ··[·1]·.note.gnu.build-id·NOTE············00000000·000034·000024·00······0···0··4 | 5 | ··[·1]·.note.gnu.build-id·NOTE············00000000·000034·000024·00······0···0··4 |
| 6 | ··[·2]·.debug_info·······PROGBITS········00000000·000058·a06 | 6 | ··[·2]·.debug_info·······PROGBITS········00000000·000058·a06876·00···C··0···0··4 |
| 7 | ··[·3]·.debug_abbrev·····PROGBITS········00000000·a06 | 7 | ··[·3]·.debug_abbrev·····PROGBITS········00000000·a068ce·01df26·00···C··0···0··4 |
| 8 | ··[·4]·.debug_line·······PROGBITS········00000000·a24 | 8 | ··[·4]·.debug_line·······PROGBITS········00000000·a247f4·00131a·00···C··0···0··4 |
| 9 | ··[·5]·.debug_str········PROGBITS········00000000·a25 | 9 | ··[·5]·.debug_str········PROGBITS········00000000·a25b0e·29f8f5·01·MSC··0···0··4 |
| 10 | ··[·6]·.shstrtab·········STRTAB··········00000000·cc5 | 10 | ··[·6]·.shstrtab·········STRTAB··········00000000·cc5403·00004f·00······0···0··1 |
| 11 | Key·to·Flags: | 11 | Key·to·Flags: |
| 12 | ··W·(write),·A·(alloc),·X·(execute),·M·(merge),·S·(strings),·I·(info), | 12 | ··W·(write),·A·(alloc),·X·(execute),·M·(merge),·S·(strings),·I·(info), |
| 13 | ··L·(link·order),·O·(extra·OS·processing·required),·G·(group),·T·(TLS), | 13 | ··L·(link·order),·O·(extra·OS·processing·required),·G·(group),·T·(TLS), |
| 14 | ··C·(compressed),·x·(unknown),·o·(OS·specific),·E·(exclude), | 14 | ··C·(compressed),·x·(unknown),·o·(OS·specific),·E·(exclude), |
| 15 | ··R·(retain),·D·(mbind),·p·(processor·specific) | 15 | ··R·(retain),·D·(mbind),·p·(processor·specific) |
| Offset 1, 4 lines modified | Offset 1, 4 lines modified | ||
| 1 | Displaying·notes·found·in:·.note.gnu.build-id | 1 | Displaying·notes·found·in:·.note.gnu.build-id |
| 2 | ··Owner················Data·size·» Description | 2 | ··Owner················Data·size·» Description |
| 3 | ··GNU··················0x00000014» NT_GNU_BUILD_ID·(unique·build·ID·bitstring)» ····Build·ID:· | 3 | ··GNU··················0x00000014» NT_GNU_BUILD_ID·(unique·build·ID·bitstring)» ····Build·ID:·6b572d486c5a52d6d5a227ccab12a58eb8e8e5e8 |
| Offset 7, 47 lines modified | Offset 7, 47 lines modified | ||
| 7 | ···Abbrev·Offset:·0x1003 | 7 | ···Abbrev·Offset:·0x1003 |
| 8 | ···Pointer·Size:··4 | 8 | ···Pointer·Size:··4 |
| 9 | ·<0><c>:·Abbrev·Number:·1·(DW_TAG_partial_unit) | 9 | ·<0><c>:·Abbrev·Number:·1·(DW_TAG_partial_unit) |
| 10 | ····<d>···DW_AT_stmt_list···:·(sec_offset)·0 | 10 | ····<d>···DW_AT_stmt_list···:·(sec_offset)·0 |
| 11 | ·<1><11>:·Abbrev·Number:·11·(DW_TAG_base_type) | 11 | ·<1><11>:·Abbrev·Number:·11·(DW_TAG_base_type) |
| 12 | ····<12>···DW_AT_byte_size···:·(data1)·4 | 12 | ····<12>···DW_AT_byte_size···:·(data1)·4 |
| 13 | ····<13>···DW_AT_encoding····:·(data1)·7» (unsigned) | 13 | ····<13>···DW_AT_encoding····:·(data1)·7» (unsigned) |
| 14 | ····<14>···DW_AT_name········:·(strp)·(offset:·0x23c90 | 14 | ····<14>···DW_AT_name········:·(strp)·(offset:·0x23c907d):·unsigned·int |
| 15 | ·<1><18>:·Abbrev·Number:·11·(DW_TAG_base_type) | 15 | ·<1><18>:·Abbrev·Number:·11·(DW_TAG_base_type) |
| 16 | ····<19>···DW_AT_byte_size···:·(data1)·1 | 16 | ····<19>···DW_AT_byte_size···:·(data1)·1 |
| 17 | ····<1a>···DW_AT_encoding····:·(data1)·8» (unsigned·char) | 17 | ····<1a>···DW_AT_encoding····:·(data1)·8» (unsigned·char) |
| 18 | ····<1b>···DW_AT_name········:·(strp)·(offset:·0x23ba2dc):·unsigned·char | 18 | ····<1b>···DW_AT_name········:·(strp)·(offset:·0x23ba2dc):·unsigned·char |
| 19 | ·<1><1f>:·Abbrev·Number:·11·(DW_TAG_base_type) | 19 | ·<1><1f>:·Abbrev·Number:·11·(DW_TAG_base_type) |
| 20 | ····<20>···DW_AT_byte_size···:·(data1)·2 | 20 | ····<20>···DW_AT_byte_size···:·(data1)·2 |
| 21 | ····<21>···DW_AT_encoding····:·(data1)·7» (unsigned) | 21 | ····<21>···DW_AT_encoding····:·(data1)·7» (unsigned) |
| 22 | ····<22>···DW_AT_name········:·(strp)·(offset:·0x23c90 | 22 | ····<22>···DW_AT_name········:·(strp)·(offset:·0x23c9077):·short·unsigned·int |
| 23 | ·<1><26>:·Abbrev·Number:·11·(DW_TAG_base_type) | 23 | ·<1><26>:·Abbrev·Number:·11·(DW_TAG_base_type) |
| 24 | ····<27>···DW_AT_byte_size···:·(data1)·4 | 24 | ····<27>···DW_AT_byte_size···:·(data1)·4 |
| 25 | ····<28>···DW_AT_encoding····:·(data1)·7» (unsigned) | 25 | ····<28>···DW_AT_encoding····:·(data1)·7» (unsigned) |
| 26 | ····<29>···DW_AT_name········:·(strp)·(offset:·0x23c90 | 26 | ····<29>···DW_AT_name········:·(strp)·(offset:·0x23c9065):·long·unsigned·int |
| 27 | ·<1><2d>:·Abbrev·Number:·11·(DW_TAG_base_type) | 27 | ·<1><2d>:·Abbrev·Number:·11·(DW_TAG_base_type) |
| 28 | ····<2e>···DW_AT_byte_size···:·(data1)·8 | 28 | ····<2e>···DW_AT_byte_size···:·(data1)·8 |
| 29 | ····<2f>···DW_AT_encoding····:·(data1)·7» (unsigned) | 29 | ····<2f>···DW_AT_encoding····:·(data1)·7» (unsigned) |
| 30 | ····<30>···DW_AT_name········:·(strp)·(offset:·0x23c90 | 30 | ····<30>···DW_AT_name········:·(strp)·(offset:·0x23c9060):·long·long·unsigned·int |
| 31 | ·<1><34>:·Abbrev·Number:·11·(DW_TAG_base_type) | 31 | ·<1><34>:·Abbrev·Number:·11·(DW_TAG_base_type) |
| 32 | ····<35>···DW_AT_byte_size···:·(data1)·1 | 32 | ····<35>···DW_AT_byte_size···:·(data1)·1 |
| 33 | ····<36>···DW_AT_encoding····:·(data1)·6» (signed·char) | 33 | ····<36>···DW_AT_encoding····:·(data1)·6» (signed·char) |
| 34 | ····<37>···DW_AT_name········:·(strp)·(offset:·0x23ba2de):·signed·char | 34 | ····<37>···DW_AT_name········:·(strp)·(offset:·0x23ba2de):·signed·char |
| 35 | ·<1><3b>:·Abbrev·Number:·11·(DW_TAG_base_type) | 35 | ·<1><3b>:·Abbrev·Number:·11·(DW_TAG_base_type) |
| 36 | ····<3c>···DW_AT_byte_size···:·(data1)·2 | 36 | ····<3c>···DW_AT_byte_size···:·(data1)·2 |
| 37 | ····<3d>···DW_AT_encoding····:·(data1)·5» (signed) | 37 | ····<3d>···DW_AT_encoding····:·(data1)·5» (signed) |
| 38 | ····<3e>···DW_AT_name········:·(strp)·(offset:·0x23c90 | 38 | ····<3e>···DW_AT_name········:·(strp)·(offset:·0x23c90a5):·short·int |
| 39 | ·<1><42>:·Abbrev·Number:·11·(DW_TAG_base_type) | 39 | ·<1><42>:·Abbrev·Number:·11·(DW_TAG_base_type) |
| 40 | ····<43>···DW_AT_byte_size···:·(data1)·4 | 40 | ····<43>···DW_AT_byte_size···:·(data1)·4 |
| 41 | ····<44>···DW_AT_encoding····:·(data1)·5» (signed) | 41 | ····<44>···DW_AT_encoding····:·(data1)·5» (signed) |
| 42 | ····<45>···DW_AT_name········:·(strp)·(offset:·0x23c90 | 42 | ····<45>···DW_AT_name········:·(strp)·(offset:·0x23c908f):·long·int |
| 43 | ·<1><49>:·Abbrev·Number:·11·(DW_TAG_base_type) | 43 | ·<1><49>:·Abbrev·Number:·11·(DW_TAG_base_type) |
| 44 | ····<4a>···DW_AT_byte_size···:·(data1)·8 | 44 | ····<4a>···DW_AT_byte_size···:·(data1)·8 |
| 45 | ····<4b>···DW_AT_encoding····:·(data1)·5» (signed) | 45 | ····<4b>···DW_AT_encoding····:·(data1)·5» (signed) |
| 46 | ····<4c>···DW_AT_name········:·(strp)·(offset:·0x23c90 | 46 | ····<4c>···DW_AT_name········:·(strp)·(offset:·0x23c908a):·long·long·int |
| 47 | ·<1><50>:·Abbrev·Number:·0 | 47 | ·<1><50>:·Abbrev·Number:·0 |
| 48 | ··Compilation·Unit·@·offset·0x51: | 48 | ··Compilation·Unit·@·offset·0x51: |
| 49 | ···Length:········0x1e5·(32-bit) | 49 | ···Length:········0x1e5·(32-bit) |
| 50 | ···Version:·······5 | 50 | ···Version:·······5 |
| 51 | ···Unit·Type:·····DW_UT_partial·(3) | 51 | ···Unit·Type:·····DW_UT_partial·(3) |
| 52 | ···Abbrev·Offset:·0x15a2 | 52 | ···Abbrev·Offset:·0x15a2 |
| 53 | ···Pointer·Size:··4 | 53 | ···Pointer·Size:··4 |
| Offset 57, 15 lines modified | Offset 57, 15 lines modified | ||
| 57 | ····<63>···DW_AT_name········:·(strp)·(offset:·0x130b36a):·_IO_FILE | 57 | ····<63>···DW_AT_name········:·(strp)·(offset:·0x130b36a):·_IO_FILE |
| 58 | ····<67>···DW_AT_byte_size···:·(data1)·148 | 58 | ····<67>···DW_AT_byte_size···:·(data1)·148 |
| 59 | ····<68>···DW_AT_decl_file···:·(data1)·1 | 59 | ····<68>···DW_AT_decl_file···:·(data1)·1 |
| 60 | ····<69>···DW_AT_decl_line···:·(data1)·49 | 60 | ····<69>···DW_AT_decl_line···:·(data1)·49 |
| 61 | ····<6a>···DW_AT_decl_column·:·(data1)·8 | 61 | ····<6a>···DW_AT_decl_column·:·(data1)·8 |
| 62 | ····<6b>···DW_AT_sibling·····:·(ref_udata)·<0x1d1> | 62 | ····<6b>···DW_AT_sibling·····:·(ref_udata)·<0x1d1> |
| 63 | ·<2><6d>:·Abbrev·Number:·10·(DW_TAG_member) | 63 | ·<2><6d>:·Abbrev·Number:·10·(DW_TAG_member) |
| 64 | ····<6e>···DW_AT_name········:·(strp)·(offset:·0x23c09 | 64 | ····<6e>···DW_AT_name········:·(strp)·(offset:·0x23c09c9):·_flags |
| 65 | ····<72>···DW_AT_decl_file···:·(data1)·1 | 65 | ····<72>···DW_AT_decl_file···:·(data1)·1 |
| 66 | ····<73>···DW_AT_decl_line···:·(data1)·51 | 66 | ····<73>···DW_AT_decl_line···:·(data1)·51 |
| 67 | ····<74>···DW_AT_decl_column·:·(data1)·7 | 67 | ····<74>···DW_AT_decl_column·:·(data1)·7 |
| 68 | ····<75>···DW_AT_type········:·(ref_addr)·<0x145333d> | 68 | ····<75>···DW_AT_type········:·(ref_addr)·<0x145333d> |
| 69 | ····<79>···DW_AT_data_member_location:·(data1)·0 | 69 | ····<79>···DW_AT_data_member_location:·(data1)·0 |
| 70 | ·<2><7a>:·Abbrev·Number:·10·(DW_TAG_member) | 70 | ·<2><7a>:·Abbrev·Number:·10·(DW_TAG_member) |
| 71 | ····<7b>···DW_AT_name········:·(strp)·(offset:·0x23bd5f3):·_IO_read_ptr | 71 | ····<7b>···DW_AT_name········:·(strp)·(offset:·0x23bd5f3):·_IO_read_ptr |
| Offset 141, 15 lines modified | Offset 141, 15 lines modified | ||
| 141 | ····<fd>···DW_AT_name········:·(strp)·(offset:·0x1c19929):·_IO_save_end | 141 | ····<fd>···DW_AT_name········:·(strp)·(offset:·0x1c19929):·_IO_save_end |
| 142 | ····<101>···DW_AT_decl_file···:·(data1)·1 | 142 | ····<101>···DW_AT_decl_file···:·(data1)·1 |
| 143 | ····<102>···DW_AT_decl_line···:·(data1)·66 | 143 | ····<102>···DW_AT_decl_line···:·(data1)·66 |
| 144 | ····<103>···DW_AT_decl_column·:·(data1)·9 | 144 | ····<103>···DW_AT_decl_column·:·(data1)·9 |
| 145 | ····<104>···DW_AT_type········:·(ref_addr)·<0x1454c63> | 145 | ····<104>···DW_AT_type········:·(ref_addr)·<0x1454c63> |
| 146 | ····<108>···DW_AT_data_member_location:·(data1)·44 | 146 | ····<108>···DW_AT_data_member_location:·(data1)·44 |
| 147 | ·<2><109>:·Abbrev·Number:·8·(DW_TAG_member) | 147 | ·<2><109>:·Abbrev·Number:·8·(DW_TAG_member) |
| 148 | ····<10a>···DW_AT_name········:·(strp)·(offset:·0x23c30 | 148 | ····<10a>···DW_AT_name········:·(strp)·(offset:·0x23c3084):·_markers |
| 149 | ····<10e>···DW_AT_decl_file···:·(data1)·1 | 149 | ····<10e>···DW_AT_decl_file···:·(data1)·1 |
| 150 | ····<10f>···DW_AT_decl_line···:·(data1)·68 | 150 | ····<10f>···DW_AT_decl_line···:·(data1)·68 |
| 151 | ····<110>···DW_AT_decl_column·:·(data1)·22 | 151 | ····<110>···DW_AT_decl_column·:·(data1)·22 |
| 152 | ····<111>···DW_AT_type········:·(ref_udata)·<0x1ff> | 152 | ····<111>···DW_AT_type········:·(ref_udata)·<0x1ff> |
| 153 | ····<113>···DW_AT_data_member_location:·(data1)·48 | 153 | ····<113>···DW_AT_data_member_location:·(data1)·48 |
| 154 | ·<2><114>:·Abbrev·Number:·8·(DW_TAG_member) | 154 | ·<2><114>:·Abbrev·Number:·8·(DW_TAG_member) |
| 155 | ····<115>···DW_AT_name········:·(strp)·(offset:·0x23b594d):·_chain | 155 | ····<115>···DW_AT_name········:·(strp)·(offset:·0x23b594d):·_chain |
| Offset 169, 29 lines modified | Offset 169, 29 lines modified | ||
| 169 | ····<12d>···DW_AT_name········:·(strp)·(offset:·0x6b8f):·_flags2 | 169 | ····<12d>···DW_AT_name········:·(strp)·(offset:·0x6b8f):·_flags2 |
| 170 | ····<131>···DW_AT_decl_file···:·(data1)·1 | 170 | ····<131>···DW_AT_decl_file···:·(data1)·1 |
| 171 | ····<132>···DW_AT_decl_line···:·(data1)·73 | 171 | ····<132>···DW_AT_decl_line···:·(data1)·73 |
| 172 | ····<133>···DW_AT_decl_column·:·(data1)·7 | 172 | ····<133>···DW_AT_decl_column·:·(data1)·7 |
| 173 | ····<134>···DW_AT_type········:·(ref_addr)·<0x145333d> | 173 | ····<134>···DW_AT_type········:·(ref_addr)·<0x145333d> |
| 174 | ····<138>···DW_AT_data_member_location:·(data1)·60 | 174 | ····<138>···DW_AT_data_member_location:·(data1)·60 |
| 175 | ·<2><139>:·Abbrev·Number:·8·(DW_TAG_member) | 175 | ·<2><139>:·Abbrev·Number:·8·(DW_TAG_member) |
| 176 | ····<13a>···DW_AT_name········:·(strp)·(offset:·0x23c74 | 176 | ····<13a>···DW_AT_name········:·(strp)·(offset:·0x23c7436):·_old_offset |
| 177 | ····<13e>···DW_AT_decl_file···:·(data1)·1 | 177 | ····<13e>···DW_AT_decl_file···:·(data1)·1 |
| 178 | ····<13f>···DW_AT_decl_line···:·(data1)·74 | 178 | ····<13f>···DW_AT_decl_line···:·(data1)·74 |
| 179 | ····<140>···DW_AT_decl_column·:·(data1)·11 | 179 | ····<140>···DW_AT_decl_column·:·(data1)·11 |
| 180 | ····<141>···DW_AT_type········:·(ref_udata)·<0x1da>,·__off_t,·long·int | 180 | ····<141>···DW_AT_type········:·(ref_udata)·<0x1da>,·__off_t,·long·int |
| 181 | ····<143>···DW_AT_data_member_location:·(data1)·64 | 181 | ····<143>···DW_AT_data_member_location:·(data1)·64 |
| 182 | ·<2><144>:·Abbrev·Number:·10·(DW_TAG_member) | 182 | ·<2><144>:·Abbrev·Number:·10·(DW_TAG_member) |
| 183 | ····<145>···DW_AT_name········:·(strp)·(offset:·0x23b5d24):·_cur_column | 183 | ····<145>···DW_AT_name········:·(strp)·(offset:·0x23b5d24):·_cur_column |
| 184 | ····<149>···DW_AT_decl_file···:·(data1)·1 | 184 | ····<149>···DW_AT_decl_file···:·(data1)·1 |
| 185 | ····<14a>···DW_AT_decl_line···:·(data1)·77 | 185 | ····<14a>···DW_AT_decl_line···:·(data1)·77 |
| 186 | ····<14b>···DW_AT_decl_column·:·(data1)·18 | 186 | ····<14b>···DW_AT_decl_column·:·(data1)·18 |
| 187 | ····<14c>···DW_AT_type········:·(ref_addr)·<0x1f>,·short·unsigned·int | 187 | ····<14c>···DW_AT_type········:·(ref_addr)·<0x1f>,·short·unsigned·int |
| 188 | ····<150>···DW_AT_data_member_location:·(data1)·68 | 188 | ····<150>···DW_AT_data_member_location:·(data1)·68 |
| 189 | ·<2><151>:·Abbrev·Number:·10·(DW_TAG_member) | 189 | ·<2><151>:·Abbrev·Number:·10·(DW_TAG_member) |
| 190 | ····<152>···DW_AT_name········:·(strp)·(offset:·0x23c74 | 190 | ····<152>···DW_AT_name········:·(strp)·(offset:·0x23c7466):·_vtable_offset |
| 191 | ····<156>···DW_AT_decl_file···:·(data1)·1 | 191 | ····<156>···DW_AT_decl_file···:·(data1)·1 |
| 192 | ····<157>···DW_AT_decl_line···:·(data1)·78 | 192 | ····<157>···DW_AT_decl_line···:·(data1)·78 |
| 193 | ····<158>···DW_AT_decl_column·:·(data1)·15 | 193 | ····<158>···DW_AT_decl_column·:·(data1)·15 |
| 194 | ····<159>···DW_AT_type········:·(ref_addr)·<0x34>,·signed·char | 194 | ····<159>···DW_AT_type········:·(ref_addr)·<0x34>,·signed·char |
| 195 | ····<15d>···DW_AT_data_member_location:·(data1)·70 | 195 | ····<15d>···DW_AT_data_member_location:·(data1)·70 |
| 196 | ·<2><15e>:·Abbrev·Number:·8·(DW_TAG_member) | 196 | ·<2><15e>:·Abbrev·Number:·8·(DW_TAG_member) |
| 197 | ····<15f>···DW_AT_name········:·(strp)·(offset:·0x1c30992):·_shortbuf | 197 | ····<15f>···DW_AT_name········:·(strp)·(offset:·0x1c30992):·_shortbuf |
| Offset 204, 36 lines modified | Offset 204, 36 lines modified | ||
| 204 | ····<16a>···DW_AT_name········:·(strp)·(offset:·0x23b0b14):·_lock | 204 | ····<16a>···DW_AT_name········:·(strp)·(offset:·0x23b0b14):·_lock |
| 205 | ····<16e>···DW_AT_decl_file···:·(data1)·1 | 205 | ····<16e>···DW_AT_decl_file···:·(data1)·1 |
| 206 | ····<16f>···DW_AT_decl_line···:·(data1)·81 | 206 | ····<16f>···DW_AT_decl_line···:·(data1)·81 |
| 207 | ····<170>···DW_AT_decl_column·:·(data1)·15 | 207 | ····<170>···DW_AT_decl_column·:·(data1)·15 |
| 208 | ····<171>···DW_AT_type········:·(ref_udata)·<0x212> | 208 | ····<171>···DW_AT_type········:·(ref_udata)·<0x212> |
| 209 | ····<173>···DW_AT_data_member_location:·(data1)·72 | 209 | ····<173>···DW_AT_data_member_location:·(data1)·72 |
| 210 | ·<2><174>:·Abbrev·Number:·8·(DW_TAG_member) | 210 | ·<2><174>:·Abbrev·Number:·8·(DW_TAG_member) |
| 211 | ····<175>···DW_AT_name········:·(strp)·(offset:·0x23c7 | 211 | ····<175>···DW_AT_name········:·(strp)·(offset:·0x23c74f6):·_offset |
| 212 | ····<179>···DW_AT_decl_file···:·(data1)·1 | 212 | ····<179>···DW_AT_decl_file···:·(data1)·1 |
| 213 | ····<17a>···DW_AT_decl_line···:·(data1)·89 | 213 | ····<17a>···DW_AT_decl_line···:·(data1)·89 |
| 214 | ····<17b>···DW_AT_decl_column·:·(data1)·13 | 214 | ····<17b>···DW_AT_decl_column·:·(data1)·13 |
| 215 | ····<17c>···DW_AT_type········:·(ref_udata)·<0x1e6>,·__off64_t,·__int64_t,·long·long·int | 215 | ····<17c>···DW_AT_type········:·(ref_udata)·<0x1e6>,·__off64_t,·__int64_t,·long·long·int |
| 216 | ····<17e>···DW_AT_data_member_location:·(data1)·76 | 216 | ····<17e>···DW_AT_data_member_location:·(data1)·76 |
| 217 | ·<2><17f>:·Abbrev·Number:·8·(DW_TAG_member) | 217 | ·<2><17f>:·Abbrev·Number:·8·(DW_TAG_member) |
| 218 | ····<180>···DW_AT_name········:·(strp)·(offset:·0x23cb2 | 218 | ····<180>···DW_AT_name········:·(strp)·(offset:·0x23cb21d):·_codecvt |
| 219 | ····<184>···DW_AT_decl_file···:·(data1)·1 | 219 | ····<184>···DW_AT_decl_file···:·(data1)·1 |
| 220 | ····<185>···DW_AT_decl_line···:·(data1)·91 | 220 | ····<185>···DW_AT_decl_line···:·(data1)·91 |
| Max diff block lines reached; 125923881/125931241 bytes (99.99%) of diff not shown. | |||
| Offset 1, 2450 lines modified | Offset 1, 2413 lines modified | ||
| 1 | 3nd.s4rD | ||
| 2 | -b-m%|&z | ||
| 3 | -e$;cjk· | ||
| 4 | 6K'>D&k}c | ||
| 5 | T9VHNZ^! | ||
| 6 | =pNB=-/i | ||
| 7 | zQo<.E\o | ||
| 8 | 8>?(%#i3 | ||
| 9 | CVuymPuQmb | ||
| 10 | 0<z4)vV,· | ||
| 11 | o'3[,?NfC7C | ||
| 12 | ]ADA;H>v | ||
| 13 | ^k,?G06<G | ||
| 14 | @WU]W5xq7 | ||
| 15 | U_'daOqEO | ||
| 16 | PX}YT_'5| | ||
| 17 | _\?brJ&0~ | ||
| 18 | }{|q5r._ | ||
| 19 | VPMXA5yN | ||
| 20 | QBA]m^8} | ||
| 21 | SnYj+[\@ | ||
| 22 | yr^prapD^p | ||
| 23 | ;xBO~FO9 | ||
| 24 | |oxD?7D-(m | ||
| 25 | ^Kn9/h1> | ||
| 26 | SL^FGX5d8O | ||
| 1 | %$yGo(Oo | ||
| 2 | P@Q`;l^\ | ||
| 3 | tXs0eC1Z | ||
| 4 | S!)EJpHJ | ||
| 5 | gwh#cp54· | ||
| 6 | dM+mb@j" | ||
| 7 | qN/>SUM\ | ||
| 8 | (=G/HD8O | ||
| 9 | f{?]|.1x | ||
| 10 | ThOs!c]\ | ||
| 11 | f.o» S@bx | ||
| 12 | Wx7» B_9O | ||
| 13 | }B·L7B<# | ||
| 14 | LH`xb&FY | ||
| 15 | UPnYn+_R@ | ||
| 16 | BE]xKs9$G | ||
| 17 | <QpvRPy52u | ||
| 18 | NoMI2":c | ||
| 19 | ,(%\)?5g5 | ||
| 20 | |BL4$6J; | ||
| 21 | w3a3lW<2 | ||
| 22 | a?JFkI3F/ | ||
| 23 | =l1::03N | ||
| 24 | w.L:J3R3 | ||
| 25 | MUH,Zkiu> | ||
| 26 | *y4&<_,4 | ||
| 27 | \A~Is:2P | ||
| 28 | ]z- | 27 | ]z-q,ate |
| 28 | y» so1@%? | ||
| 29 | @\6yf[z& | ||
| 30 | I@WT"3KD | ||
| 31 | _cHMkKz{d | ||
| 32 | 7)(n» v"= | ||
| 33 | PDfydvED | ||
| 34 | ;~lxCX6p=k4p= | ||
| 29 | N:ifTYz=$K | ||
| 30 | Xz9^h)K]D | ||
| 31 | IP8D-V9m | ||
| 32 | 0~T2*K^ND9^ | ||
| 33 | ;#aXzGt- | ||
| 34 | [ZZ*ZJ,O | ||
| 35 | Ccy`&gf7_ | ||
| 36 | %q!/A-4. | ||
| 37 | ks'>@hak | ||
| 38 | -WIC6av!z | ||
| 39 | E?=7lVx9 | ||
| 40 | u | 35 | u"RV\.<5F |
| 36 | >/]{>M{5M | ||
| 37 | J^S>d» mS | ||
| 41 | 6$]{.M{% | ||
| 42 | ymNzNS|$ | ||
| 43 | `I4wkP"N | ||
| 44 | BqAF/ | 38 | BqAF/!"e |
| 39 | |n-_|4» w | ||
| 40 | T20M2$!bTY | ||
| 41 | _3z1cu(XDY | ||
| 42 | `\A|Fv9;j | ||
| 43 | GsY"P$.w | ||
| 44 | "NQ8^zun | ||
| 45 | T*>BN)&( | ||
| 45 | H&&2q3Mq | ||
| 46 | BlSqjDw& | ||
| 47 | ~#g,Jl#s0 | ||
| 48 | x?c~`U0] | ||
| 49 | 9B<g]jY6 | ||
| 50 | eMks{2-u | ||
| 51 | zWt_)DM1 | ||
| 52 | E3i7l"qNKJcqi | ||
| 53 | Q4 | 46 | Q4P>AKa1 |
| 47 | 19g1jdg1br | ||
| 48 | z-MXAra2 | ||
| 49 | bXb7iu2$ht | ||
| 50 | jZ9an9%{O< | ||
| 51 | K;]>]U>j | ||
| 52 | -dZW<n)Z | ||
| 53 | ZV`!we$C | ||
| 54 | hJA2s_)L | ||
| 55 | aG:FWMwd | ||
| 56 | b>yl7TlNx | ||
| 57 | 9/;rq6cY | ||
| 58 | rg>ERo2cz | ||
| 59 | dN]\G'_D | ||
| 60 | J-5_!)zv | ||
| 61 | h0GjNw(oe» FPj0OjN» | ||
| 62 | I2Z|gOOg | ||
| 63 | QzR.'@rsv | ||
| 64 | EP{&@k#Ju1q | ||
| 65 | +yk8.yk8.yk8.yk8.yk8NP | ||
| 66 | Uy\tsqoU | ||
| 67 | |*YeZg*= | ||
| 68 | D"T>2ehJd | ||
| 69 | zy}6>h(X» V | ||
| 70 | c·?v]S@c%u* | ||
| 71 | » C\drjQ. | ||
| 72 | \rI&weo3h» DS | ||
| 73 | tfqr3-+uBB | ||
| 74 | sX7FZoGU | ||
| 75 | .$^gy1W1 | ||
| 76 | DXyZ~n>V | ||
| 77 | 5<Gn~e75 | ||
| 78 | e^@ws#sk | ||
| Max diff block lines reached; 54125/57489 bytes (94.15%) of diff not shown. | |||
| Offset 205263, 151227 lines modified | Offset 205263, 151227 lines modified | ||
| 205263 | ··[23befd9]··ParseProperties | 205263 | ··[23befd9]··ParseProperties |
| 205264 | ··[23befe9]··nscales | 205264 | ··[23befe9]··nscales |
| 205265 | ··[23beff1]··getVariables | 205265 | ··[23beff1]··getVariables |
| 205266 | ··[23beffe]··setVariables | 205266 | ··[23beffe]··setVariables |
| 205267 | ··[23bf00b]··variables | 205267 | ··[23bf00b]··variables |
| 205268 | ··[23bf015]··GNU·C17·14.2.0·-m32·-msse3·-mtune=generic·-march=i686·-g·-O2·-fstack-protector-strong·-fasynchronous-unwind-tables | 205268 | ··[23bf015]··GNU·C17·14.2.0·-m32·-msse3·-mtune=generic·-march=i686·-g·-O2·-fstack-protector-strong·-fasynchronous-unwind-tables | Diff chunk too large, falling back to line-by-line diff (151219 lines added, 151219 lines removed) |
| 205269 | ··[23bf088]··GNU·C++11·14.2.0·-m32·-msse3·-mtune=generic·-march=i686·-g·-O2·-std=c++11·-fstack-protector-strong·-fopenmp·-fasynchronous-unwind-tables | 205269 | ··[23bf088]··GNU·C++11·14.2.0·-m32·-msse3·-mtune=generic·-march=i686·-g·-O2·-std=c++11·-fstack-protector-strong·-fopenmp·-fasynchronous-unwind-tables |
| 205270 | ··[23bf111]··GNU·C++11·14.2.0·-march= | 205270 | ··[23bf111]··GNU·C++11·14.2.0·-march=haswell·-mmmx·-mpopcnt·-msse·-msse2·-mssse3·-msse4.1·-msse4.2·-mavx·-mavx2·-mno-sse4a·-mno-fma4·-mno-xop·-mfma·-mno-avx512f·-mbmi·-mbmi2·-maes·-mpclmul·-mno-avx512vl·-mno-avx512bw·-mno-avx512dq·-mno-avx512cd·-mno-avx512vbmi·-mno-avx512ifma·-mno-avx512vpopc[·...·truncated·by·diffoscope;·len:·955,·SHA:·66ab133dc211696828a76a2097bc43e87a530da80e340054a3696e72b046f882·...·]·-m32·-msse3·-g·-O2·-std=c++11·-std=gnu++11·-fstack-protector-strong·-fopenmp·-fasynchronous-unwind-tables |
| 205271 | ··[23bf6 | 205271 | ··[23bf64f]··GNU·C++11·14.2.0·-m32·-msse3·-mtune=generic·-march=i686·-g·-O2·-std=c++11·-std=gnu++11·-fstack-protector-strong·-fopenmp·-fasynchronous-unwind-tables |
| 205272 | ··[23bf6 | 205272 | ··[23bf6e5]··equal_id_hashtables |
| 205273 | ··[23bf | 205273 | ··[23bf6f9]··equal_or_complement_id_hashtables |
| 205274 | ··[23bf7 | 205274 | ··[23bf71b]··length_hashtables |
| 205275 | ··[23bf7 | 205275 | ··[23bf72d]··update_all_topo_depths_from_hashtables |
| 205276 | ··[23bf7 | 205276 | ··[23bf754]··swap_doubles |
| 205277 | ··[23bf7 | 205277 | ··[23bf761]··n_alleles |
| 205278 | ··[23bf7 | 205278 | ··[23bf76b]··eulerAngles |
| 205279 | ··[23bf7 | 205279 | ··[23bf777]··pllLogBootSamples |
| 205280 | ··[23bf7 | 205280 | ··[23bf789]··refined_samples |
| 205281 | ··[23bf7 | 205281 | ··[23bf799]··num_samples |
| 205282 | ··[23bf7 | 205282 | ··[23bf7a5]··orig_num_bootstrap_samples |
| 205283 | ··[23bf7 | 205283 | ··[23bf7c0]··pll_boot_samples |
| 205284 | ··[23bf7 | 205284 | ··[23bf7d1]··nsamples |
| 205285 | ··[23bf7 | 205285 | ··[23bf7da]··readNCBINames |
| 205286 | ··[23bf | 205286 | ··[23bf7e8]··taxaNames |
| 205287 | ··[23bf | 205287 | ··[23bf7f2]··findNodeNames |
| 205288 | ··[23bf8 | 205288 | ··[23bf800]··writeInternalNodeNames |
| 205289 | ··[23bf8 | 205289 | ··[23bf817]··dnaStateNames |
| 205290 | ··[23bf8 | 205290 | ··[23bf825]··protStateNames |
| 205291 | ··[23bf8 | 205291 | ··[23bf834]··binaryStateNames |
| 205292 | ··[23bf8 | 205292 | ··[23bf845]··assignLeafNames |
| 205293 | ··[23bf8 | 205293 | ··[23bf855]··dagNames |
| 205294 | ··[23bf8 | 205294 | ··[23bf85e]··TokenNames |
| 205295 | ··[23bf8 | 205295 | ··[23bf869]··taxonNames |
| 205296 | ··[23bf8 | 205296 | ··[23bf874]··phyloNames |
| 205297 | ··[23bf8 | 205297 | ··[23bf87f]··tipNames |
| 205298 | ··[23bf8 | 205298 | ··[23bf888]··getSeqNames |
| 205299 | ··[23bf8 | 205299 | ··[23bf894]··speciesNames |
| 205300 | ··[23bf8 | 205300 | ··[23bf8a1]··GetCharSetNames |
| 205301 | ··[23bf8 | 205301 | ··[23bf8b1]··GetExSetNames |
| 205302 | ··[23bf8 | 205302 | ··[23bf8bf]··GetTaxSetNames |
| 205303 | ··[23bf8 | 205303 | ··[23bf8ce]··printNames |
| 205304 | ··[23bf8 | 205304 | ··[23bf8d9]··_M_names |
| 205305 | ··[23bf8 | 205305 | ··[23bf8e2]··__names |
| 205306 | ··[23bf | 205306 | ··[23bf8ea]··area_names |
| 205307 | ··[23bf | 205307 | ··[23bf8f5]··new_taxa_names |
| 205308 | ··[23bf9 | 205308 | ··[23bf904]··sequence_names |
| 205309 | ··[23bf9 | 205309 | ··[23bf913]··update_bootstrap_supports_from_node_names |
| 205310 | ··[23bf9 | 205310 | ··[23bf93d]··rate_names |
| 205311 | ··[23bf9 | 205311 | ··[23bf948]··aa_model_names |
| 205312 | ··[23bf9 | 205312 | ··[23bf957]··dna_model_names |
| 205313 | ··[23bf9 | 205313 | ··[23bf967]··extra_model_names |
| 205314 | ··[23bf9 | 205314 | ··[23bf979]··saved_model_names |
| 205315 | ··[23bf9 | 205315 | ··[23bf98b]··orig_model_names |
| 205316 | ··[23bf9 | 205316 | ··[23bf99c]··morph_model_names |
| 205317 | ··[23bf9 | 205317 | ··[23bf9ae]··bin_model_names |
| 205318 | ··[23bf9 | 205318 | ··[23bf9be]··codon_model_names |
| 205319 | ··[23bf9 | 205319 | ··[23bf9d0]··this_model_names |
| 205320 | ··[23bf9 | 205320 | ··[23bf9e1]··init_model_names |
| 205321 | ··[23bf | 205321 | ··[23bf9f2]··destroy_model_names |
| 205322 | ··[23bfa | 205322 | ··[23bfa06]··submodel_names |
| 205323 | ··[23bfa | 205323 | ··[23bfa15]··all_names |
| 205324 | ··[23bfa | 205324 | ··[23bfa1f]··outgroup_names |
| 205325 | ··[23bfa | 205325 | ··[23bfa2e]··aa_freq_names |
| 205326 | ··[23bfa | 205326 | ··[23bfa3c]··codon_freq_names |
| 205327 | ··[23bfa | 205327 | ··[23bfa4d]··remain_seq_names |
| 205328 | ··[23bfa | 205328 | ··[23bfa5e]··new_seq_names |
| 205329 | ··[23bfa | 205329 | ··[23bfa6c]··part_names |
| 205330 | ··[23bfa | 205330 | ··[23bfa77]··subst_names |
| 205331 | ··[23bfa | 205331 | ··[23bfa83]··nodenames |
| 205332 | ··[23bfa | 205332 | ··[23bfa8d]··filenames |
| 205333 | ··[23bfa | 205333 | ··[23bfa97]··taxnames |
| 205334 | ··[23bfa | 205334 | ··[23bfaa0]··max_frames |
| 205335 | ··[23bfa | 205335 | ··[23bfaab]··runTimes |
| 205336 | ··[23bfa | 205336 | ··[23bfab4]··_S_n_primes |
| 205337 | ··[23bfa | 205337 | ··[23bfac0]··check_times |
| 205338 | ··[23bfa | 205338 | ··[23bfacc]··maxtimes |
| 205339 | ··[23bfa | 205339 | ··[23bfad5]··isOnes |
| 205340 | ··[23bfa | 205340 | ··[23bfadc]··setOnes |
| 205341 | ··[23bfa | 205341 | ··[23bfae4]··lines |
| 205342 | ··[23bf | 205342 | ··[23bfaea]··_Types |
| 205343 | ··[23bf | 205343 | ··[23bfaf1]··_TrivialValueTypes |
| 205344 | ··[23bfb | 205344 | ··[23bfb04]··_ArgTypes |
| 205345 | ··[23bfb | 205345 | ··[23bfb0e]··seq_types |
| 205346 | ··[23bfb | 205346 | ··[23bfb18]··_Nocopy_types |
| 205347 | ··[23bfb | 205347 | ··[23bfb26]··__res |
| 205348 | ··[23bfb | 205348 | ··[23bfb2c]··bad_res |
| 205349 | ··[23bfb | 205349 | ··[23bfb34]··lh_res |
| 205350 | ··[23bfb | 205350 | ··[23bfb3b]··index_res |
| 205351 | ··[23bfb | 205351 | ··[23bfb45]··score_diff_thres |
| 205352 | ··[23bfb | 205352 | ··[23bfb56]··_Requires |
| 205353 | ··[23bfb | 205353 | ··[23bfb60]··unres |
| 205354 | ··[23bfb | 205354 | ··[23bfb66]··countPhysicalCPUCores |
| 205355 | ··[23bfb | 205355 | ··[23bfb7c]··computeICScores |
| 205356 | ··[23bfb | 205356 | ··[23bfb8c]··computeInformationScores |
| 205357 | ··[23bfb | 205357 | ··[23bfba5]··perSiteParsScores |
| 205358 | ··[23bfb | 205358 | ··[23bfbb7]··getBestScores |
| 205359 | ··[23bfb | 205359 | ··[23bfbc5]··printBestScores |
| 205360 | ··[23bfb | 205360 | ··[23bfbd5]··bestScores |
| 205361 | ··[23bfb | 205361 | ··[23bfbe0]··lh_scores |
| 205362 | ··[23bf | 205362 | ··[23bfbea]··nni_scores |
| 205363 | ··[23bf | 205363 | ··[23bfbf5]··model_scores |
| 205364 | ··[23bfc | 205364 | ··[23bfc02]··pars_scores |
| 205365 | ··[23bfc | 205365 | ··[23bfc0e]··preserveUnderscores |
| 205366 | ··[23bfc | 205366 | ··[23bfc22]··BlanksToUnderscores |
| 205367 | ··[23bfc | 205367 | ··[23bfc36]··_ZN6PDTree9computePDER6ParamsRSt6vectorI9PDTaxaSetSaIS3_EER17PDRelatedMeasures |
| 205368 | ··[23bfc | 205368 | ··[23bfc85]··_Z13summarizeTreeR6ParamsR6PDTreeRSt6vectorI9PDTaxaSetSaIS4_EER17PDRelatedMeasures |
| 205369 | ··[23bfc | 205369 | ··[23bfcd8]··_Z11printPDUserRSoR6ParamsR17PDRelatedMeasures |
| 205370 | ··[23bfd | 205370 | ··[23bfd07]··_ZN9PDNetwork9computePDER6ParamsR8SplitSetR17PDRelatedMeasures |
| 205371 | ··[23bfd | 205371 | ··[23bfd46]··~PDRelatedMeasures |
| 205372 | ··[23bfd | 205372 | ··[23bfd59]··pllFreeParsimonyDataStructures |
| 205373 | ··[23bfd | 205373 | ··[23bfd78]··allocateParsimonyDataStructures |
| 205374 | ··[23bfd | 205374 | ··[23bfd98]··getNMixtures |
| 205375 | ··[23bfd | 205375 | ··[23bfda5]··nmixtures |
| 205376 | ··[23bfd | 205376 | ··[23bfdaf]··nwk_mismatched_parentheses |
| 205377 | ··[23bfd | 205377 | ··[23bfdca]··strip_toplevel_parentheses |
| 205378 | ··[23bfd | 205378 | ··[23bfde5]··getNumProcesses |
| 205379 | ··[23bf | 205379 | ··[23bfdf5]··setNumProcesses |
| 205380 | ··[23bfe | 205380 | ··[23bfe05]··numProcesses |
| 205381 | ··[23bfe | 205381 | ··[23bfe12]··pllGetGammaRates |
| 205382 | ··[23bfe | 205382 | ··[23bfe23]··gammaRates |
| 205383 | ··[23bfe | 205383 | ··[23bfe2e]··readRates |
| 205384 | ··[23bfe | 205384 | ··[23bfe38]··oldCategorizedRates |
| 205385 | ··[23bfe | 205385 | ··[23bfe4c]··rescaleRates |
| 205386 | ··[23bfe | 205386 | ··[23bfe59]··writeSiteRates |
| 205387 | ··[23bfe | 205387 | ··[23bfe68]··updatePerSiteRates |
| 205388 | ··[23bfe | 205388 | ··[23bfe7b]··perSiteRates |
| Max diff block lines reached; 0/52234772 bytes (0.00%) of diff not shown. | |||
| Offset 4, 17 lines modified | Offset 4, 17 lines modified | ||
| 4 | ··Data:······························2's·complement,·little·endian | 4 | ··Data:······························2's·complement,·little·endian |
| 5 | ··Version:···························1·(current) | 5 | ··Version:···························1·(current) |
| 6 | ··OS/ABI:····························UNIX·-·GNU | 6 | ··OS/ABI:····························UNIX·-·GNU |
| 7 | ··ABI·Version:·······················0 | 7 | ··ABI·Version:·······················0 |
| 8 | ··Type:······························DYN·(Shared·object·file) | 8 | ··Type:······························DYN·(Shared·object·file) |
| 9 | ··Machine:···························Intel·80386 | 9 | ··Machine:···························Intel·80386 |
| 10 | ··Version:···························0x1 | 10 | ··Version:···························0x1 |
| 11 | ··Entry·point·address:···············0xe | 11 | ··Entry·point·address:···············0xe84e0 |
| 12 | ··Start·of·program·headers:··········52·(bytes·into·file) | 12 | ··Start·of·program·headers:··········52·(bytes·into·file) |
| 13 | ··Start·of·section·headers:··········23 | 13 | ··Start·of·section·headers:··········23142948·(bytes·into·file) |
| 14 | ··Flags:·····························0x0 | 14 | ··Flags:·····························0x0 |
| 15 | ··Size·of·this·header:···············52·(bytes) | 15 | ··Size·of·this·header:···············52·(bytes) |
| 16 | ··Size·of·program·headers:···········32·(bytes) | 16 | ··Size·of·program·headers:···········32·(bytes) |
| 17 | ··Number·of·program·headers:·········12 | 17 | ··Number·of·program·headers:·········12 |
| 18 | ··Size·of·section·headers:···········40·(bytes) | 18 | ··Size·of·section·headers:···········40·(bytes) |
| 19 | ··Number·of·section·headers:········· | 19 | ··Number·of·section·headers:·········40 |
| 20 | ··Section·header·string·table·index:·3 | 20 | ··Section·header·string·table·index:·39 |
| Offset 1, 26 lines modified | Offset 1, 26 lines modified | ||
| 1 | Elf·file·type·is·DYN·(Shared·object·file) | 1 | Elf·file·type·is·DYN·(Shared·object·file) |
| 2 | Entry·point·0xe | 2 | Entry·point·0xe84e0 |
| 3 | There·are·12·program·headers,·starting·at·offset·52 | 3 | There·are·12·program·headers,·starting·at·offset·52 |
| 4 | Program·Headers: | 4 | Program·Headers: |
| 5 | ··Type···········Offset···VirtAddr···PhysAddr···FileSiz·MemSiz··Flg·Align | 5 | ··Type···········Offset···VirtAddr···PhysAddr···FileSiz·MemSiz··Flg·Align |
| 6 | ··PHDR···········0x000034·0x00000034·0x00000034·0x00180·0x00180·R···0x4 | 6 | ··PHDR···········0x000034·0x00000034·0x00000034·0x00180·0x00180·R···0x4 |
| 7 | ··INTERP·········0x0001d8·0x000001d8·0x000001d8·0x00000·0x00013·R···0x1 | 7 | ··INTERP·········0x0001d8·0x000001d8·0x000001d8·0x00000·0x00013·R···0x1 |
| 8 | ··LOAD···········0x000000·0x00000000·0x00000000·0x001d8·0x7f | 8 | ··LOAD···········0x000000·0x00000000·0x00000000·0x001d8·0x7fff0·R···0x1000 |
| 9 | ··LOAD···········0x000000·0x00080000·0x00080000·0x00000·0x49 | 9 | ··LOAD···········0x000000·0x00080000·0x00080000·0x00000·0x4965a8·R·E·0x1000 |
| 10 | ··LOAD···········0x001000·0x0051 | 10 | ··LOAD···········0x001000·0x00517000·0x00517000·0x180a6c·0x180a6c·R···0x1000 |
| 11 | ··LOAD···········0x0001 | 11 | ··LOAD···········0x00012c·0x0069812c·0x0069812c·0x00000·0x24654·RW··0x1000 |
| 12 | ··DYNAMIC········0x18 | 12 | ··DYNAMIC········0x18212c·0x0069f8fc·0x0069f8fc·0x00000·0x00130·RW··0x4 |
| 13 | ··NOTE···········0x0001b4·0x000001b4·0x000001b4·0x00024·0x00024·R···0x4 | 13 | ··NOTE···········0x0001b4·0x000001b4·0x000001b4·0x00024·0x00024·R···0x4 |
| 14 | ··NOTE···········0x18 | 14 | ··NOTE···········0x181a4c·0x00697a4c·0x00697a4c·0x00020·0x00020·R···0x4 |
| 15 | ··GNU_EH_FRAME···0x001000·0x005d | 15 | ··GNU_EH_FRAME···0x001000·0x005db498·0x005db498·0x00000·0x0de8c·R···0x4 |
| 16 | ··GNU_STACK······0x000000·0x00000000·0x00000000·0x00000·0x00000·RW··0x10 | 16 | ··GNU_STACK······0x000000·0x00000000·0x00000000·0x00000·0x00000·RW··0x10 |
| 17 | ··GNU_RELRO······0x18 | 17 | ··GNU_RELRO······0x18212c·0x0069812c·0x0069812c·0x00000·0x07ed4·R···0x1 |
| 18 | ·Section·to·Segment·mapping: | 18 | ·Section·to·Segment·mapping: |
| 19 | ··Segment·Sections... | 19 | ··Segment·Sections... |
| 20 | ···00····· | 20 | ···00····· |
| 21 | ···01·····.interp· | 21 | ···01·····.interp· |
| 22 | ···02·····.note.gnu.build-id·.interp·.gnu.hash·.dynsym·.dynstr·.gnu.version·.gnu.version_r·.rel.dyn·.rel.plt· | 22 | ···02·····.note.gnu.build-id·.interp·.gnu.hash·.dynsym·.dynstr·.gnu.version·.gnu.version_r·.rel.dyn·.rel.plt· |
| 23 | ···03·····.init·.plt·.plt.got·.text·.fini· | 23 | ···03·····.init·.plt·.plt.got·.text·.fini· |
| Offset 1, 48 lines modified | Offset 1, 49 lines modified | ||
| 1 | There·are· | 1 | There·are·40·section·headers,·starting·at·offset·0x1612224: |
| 2 | Section·Headers: | 2 | Section·Headers: |
| 3 | ··[Nr]·Name··············Type············Addr·····Off····Size···ES·Flg·Lk·Inf·Al | 3 | ··[Nr]·Name··············Type············Addr·····Off····Size···ES·Flg·Lk·Inf·Al |
| 4 | ··[·0]···················NULL············00000000·000000·000000·00······0···0··0 | 4 | ··[·0]···················NULL············00000000·000000·000000·00······0···0··0 |
| 5 | ··[·1]·.note.gnu.build-id·NOTE············000001b4·0001b4·000024·00···A··0···0··4 | 5 | ··[·1]·.note.gnu.build-id·NOTE············000001b4·0001b4·000024·00···A··0···0··4 |
| 6 | ··[·2]·.interp···········NOBITS··········000001d8·0001d8·000013·00···A··0···0··1 | 6 | ··[·2]·.interp···········NOBITS··········000001d8·0001d8·000013·00···A··0···0··1 |
| 7 | ··[·3]·.gnu.hash·········NOBITS··········000001ec·0001d8·00ab | 7 | ··[·3]·.gnu.hash·········NOBITS··········000001ec·0001d8·00abd0·04···A··4···0··4 |
| 8 | ··[·4]·.dynsym···········NOBITS··········0000ad | 8 | ··[·4]·.dynsym···········NOBITS··········0000adbc·0001d8·018670·10···A··5···1··4 |
| 9 | ··[·5]·.dynstr···········NOBITS··········000232c | 9 | ··[·5]·.dynstr···········NOBITS··········0002342c·0001d8·04ce3b·00···A··0···0··1 |
| 10 | ··[·6]·.gnu.version······NOBITS··········000 | 10 | ··[·6]·.gnu.version······NOBITS··········00070268·0001d8·0030ce·02···A··4···0··2 |
| 11 | ··[·7]·.gnu.version_r····NOBITS··········0007 | 11 | ··[·7]·.gnu.version_r····NOBITS··········00073338·0001d8·0002e0·00···A··5···5··4 |
| 12 | ··[·8]·.rel.dyn··········NOBITS··········00073 | 12 | ··[·8]·.rel.dyn··········NOBITS··········00073618·0001d8·00c048·08···A··4···0··4 |
| 13 | ··[·9]·.rel.plt··········NOBITS··········0007f | 13 | ··[·9]·.rel.plt··········NOBITS··········0007f660·0001d8·000990·08···A··4··24··4 |
| 14 | ··[10]·.init·············NOBITS··········00080000·001000·000020·00··AX··0···0··4 | 14 | ··[10]·.init·············NOBITS··········00080000·001000·000020·00··AX··0···0··4 |
| 15 | ··[11]·.plt··············NOBITS··········00080020·001000·001 | 15 | ··[11]·.plt··············NOBITS··········00080020·001000·001330·04··AX··0···0·16 |
| 16 | ··[12]·.plt.got··········NOBITS··········00081 | 16 | ··[12]·.plt.got··········NOBITS··········00081350·001000·000018·08··AX··0···0··8 |
| 17 | ··[13]·.text·············NOBITS··········00081 | 17 | ··[13]·.text·············NOBITS··········00081380·001000·495214·00··AX··0···0·64 |
| 18 | ··[14]·.fini·············NOBITS··········0051 | 18 | ··[14]·.fini·············NOBITS··········00516594·001000·000014·00··AX··0···0··4 |
| 19 | ··[15]·.rodata···········NOBITS··········0051 | 19 | ··[15]·.rodata···········NOBITS··········00517000·001000·0c4498·00···A··0···0·32 |
| 20 | ··[16]·.eh_frame_hdr·····NOBITS··········005d | 20 | ··[16]·.eh_frame_hdr·····NOBITS··········005db498·001000·00de8c·00···A··0···0··4 |
| 21 | ··[17]·.eh_frame·········NOBITS··········005e | 21 | ··[17]·.eh_frame·········NOBITS··········005e9324·001000·08ffe4·00···A··0···0··4 |
| 22 | ··[18]·.gcc_except_table·NOBITS··········0067 | 22 | ··[18]·.gcc_except_table·NOBITS··········00679308·001000·01e741·00···A··0···0··4 |
| 23 | ··[19]·.note.ABI-tag·····NOTE············0069 | 23 | ··[19]·.note.ABI-tag·····NOTE············00697a4c·181a4c·000020·00···A··0···0··4 |
| 24 | ··[20]·.init_array·······NOBITS··········0069 | 24 | ··[20]·.init_array·······NOBITS··········0069812c·18212c·000030·04··WA··0···0··4 |
| 25 | ··[21]·.fini_array·······NOBITS··········0069 | 25 | ··[21]·.fini_array·······NOBITS··········0069815c·18212c·000004·04··WA··0···0··4 |
| 26 | ··[22]·.data.rel.ro······NOBITS··········0069 | 26 | ··[22]·.data.rel.ro······NOBITS··········00698160·18212c·00779c·00··WA··0···0·32 |
| 27 | ··[23]·.dynamic··········NOBITS··········0069 | 27 | ··[23]·.dynamic··········NOBITS··········0069f8fc·18212c·000130·08··WA··5···0··4 |
| 28 | ··[24]·.got··············NOBITS··········0069 | 28 | ··[24]·.got··············NOBITS··········0069fa2c·18212c·0005bc·04··WA··0···0··4 |
| 29 | ··[25]·.data·············NOBITS··········006 | 29 | ··[25]·.data·············NOBITS··········006a0000·18212c·01049c·00··WA··0···0·32 |
| 30 | ··[26]·.bss··············NOBITS··········006 | 30 | ··[26]·.bss··············NOBITS··········006b04a0·18212c·00c2e0·00··WA··0···0·32 |
| 31 | ··[27]·.comment··········PROGBITS········00000000·18 | 31 | ··[27]·.comment··········PROGBITS········00000000·181a6c·00001e·01··MS··0···0··1 |
| 32 | ··[28]·.debug_aranges····PROGBITS········00000000·18 | 32 | ··[28]·.debug_aranges····PROGBITS········00000000·181a8c·002fe6·00···C··0···0··4 |
| 33 | ··[29]·.debug_info·······PROGBITS········00000000·18 | 33 | ··[29]·.debug_info·······PROGBITS········00000000·184a74·c5b4c8·00···C··0···0··4 |
| 34 | ··[30]·.debug_abbrev·····PROGBITS········00000000·d | 34 | ··[30]·.debug_abbrev·····PROGBITS········00000000·ddff3c·0226bb·00···C··0···0··4 |
| 35 | ··[31]·.debug_line·······PROGBITS········00000000· | 35 | ··[31]·.debug_line·······PROGBITS········00000000·e025f8·2282fc·00···C··0···0··4 |
| 36 | ··[32]·.debug_str········PROGBITS········00000000·102a8f4·00041e·01·MSC··0···0··4 | ||
| 36 | ··[3 | 37 | ··[33]·.debug_line_str···PROGBITS········00000000·102ad14·0012cf·01·MSC··0···0··4 |
| 37 | ··[3 | 38 | ··[34]·.debug_loclists···PROGBITS········00000000·102bfe4·449fcb·00···C··0···0··4 |
| 38 | ··[3 | 39 | ··[35]·.debug_rnglists···PROGBITS········00000000·1475fb0·0ff488·00···C··0···0··4 |
| 39 | ··[3 | 40 | ··[36]·.gnu_debugaltlink·PROGBITS········00000000·1575438·000044·00······0···0··1 |
| 40 | ··[3 | 41 | ··[37]·.symtab···········SYMTAB··········00000000·157547c·0262e0·10·····38·3528··4 |
| 41 | ··[3 | 42 | ··[38]·.strtab···········STRTAB··········00000000·159b75c·07692b·00······0···0··1 |
| 42 | ··[3 | 43 | ··[39]·.shstrtab·········STRTAB··········00000000·1612087·00019d·00······0···0··1 |
| 43 | Key·to·Flags: | 44 | Key·to·Flags: |
| 44 | ··W·(write),·A·(alloc),·X·(execute),·M·(merge),·S·(strings),·I·(info), | 45 | ··W·(write),·A·(alloc),·X·(execute),·M·(merge),·S·(strings),·I·(info), |
| 45 | ··L·(link·order),·O·(extra·OS·processing·required),·G·(group),·T·(TLS), | 46 | ··L·(link·order),·O·(extra·OS·processing·required),·G·(group),·T·(TLS), |
| 46 | ··C·(compressed),·x·(unknown),·o·(OS·specific),·E·(exclude), | 47 | ··C·(compressed),·x·(unknown),·o·(OS·specific),·E·(exclude), |
| 47 | ··R·(retain),·D·(mbind),·p·(processor·specific) | 48 | ··R·(retain),·D·(mbind),·p·(processor·specific) |
| Offset 1, 9746 lines modified | Offset 1, 9777 lines modified | ||
| 1 | Symbol·table·'.symtab'·contains·97 | 1 | Symbol·table·'.symtab'·contains·9774·entries: |
| 2 | ···Num:····Value··Size·Type····Bind···Vis······Ndx·Name | 2 | ···Num:····Value··Size·Type····Bind···Vis······Ndx·Name |
| 3 | ·····0:·00000000·····0·NOTYPE··LOCAL··DEFAULT··UND· | 3 | ·····0:·00000000·····0·NOTYPE··LOCAL··DEFAULT··UND· |
| 4 | ·····1:·00000000·····0·FILE····LOCAL··DEFAULT··ABS·Scrt1.o | 4 | ·····1:·00000000·····0·FILE····LOCAL··DEFAULT··ABS·Scrt1.o |
| 5 | ·····2:·0069 | 5 | ·····2:·00697a4c····32·OBJECT··LOCAL··DEFAULT···19·__abi_tag |
| 6 | ·····3:·00000000·····0·FILE····LOCAL··DEFAULT··ABS·parsmultistate.cpp | 6 | ·····3:·00000000·····0·FILE····LOCAL··DEFAULT··ABS·parsmultistate.cpp |
| 7 | ·····4:·00081 | 7 | ·····4:·00081380···182·FUNC····LOCAL··DEFAULT···13·_Z16doParsMultiStateR6Params.cold |
| 8 | ·····5:·00000000·····0·FILE····LOCAL··DEFAULT··ABS·alignment.cpp | 8 | ·····5:·00000000·····0·FILE····LOCAL··DEFAULT··ABS·alignment.cpp |
| 9 | ·····6:·000e8 | 9 | ·····6:·000e8b60···423·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment12convertStateEcN3PML7SeqTypeE.part.0 |
| 10 | ·····7:·000e8 | 10 | ·····7:·000e8d50····46·FUNC····LOCAL··DEFAULT···13·_ZN5Eigen15PlainObjectBaseINS_6MatrixIdLin1ELin1ELi0ELin1ELin1EEEE6resizeEii.part.0 |
| 11 | ·····8:·000e8 | 11 | ·····8:·000e8d80····46·FUNC····LOCAL··DEFAULT···13·_ZN5Eigen15PlainObjectBaseINS_6MatrixIiLin1ELi1ELi0ELin1ELi1EEEE6resizeEi.part.0 |
| 12 | ·····9:·000e8 | 12 | ·····9:·000e8db0····46·FUNC····LOCAL··DEFAULT···13·_ZN5Eigen8internal17resize_if_allowedINS_6MatrixIdLin1ELin1ELi0ELin1ELin1EEENS_14CwiseNullaryOpINS0_18scalar_constant_opIdEES3_EEddEEvRT_RKT0_RKNS0_9assign_opIT1_T2_EE.part.0 |
| 13 | ····10:·000e8 | 13 | ····10:·000e8de0····46·FUNC····LOCAL··DEFAULT···13·_ZN5Eigen15PlainObjectBaseINS_6MatrixIdLi1ELin1ELi1ELi1ELin1EEEE6resizeEii.part.0 |
| 14 | ····11:·000e8 | 14 | ····11:·000e8e10····46·FUNC····LOCAL··DEFAULT···13·_ZNK5Eigen10SolverBaseINS_9FullPivLUINS_6MatrixIdLin1ELin1ELi0ELin1ELin1EEEEEE22_check_solve_assertionILb0ENS_10MatrixBaseINS_14CwiseNullaryOpINS_8internal18scalar_identity_opIdEES3_EEEEEEvRKT0_.part.0 |
| 15 | ····12:·00120 | 15 | ····12:·00120c00···564·FUNC····LOCAL··DEFAULT···13·_ZN5Eigen8internal13gemm_pack_rhsIdiNS0_22const_blas_data_mapperIdiLi0EEELi4ELi0ELb0ELb0EEclEPdRKS3_iiii.isra.0 |
| 16 | ····13:·00120 | 16 | ····13:·00120e40··2227·FUNC····LOCAL··DEFAULT···13·_ZN5Eigen8internal29general_matrix_vector_productIidNS0_22const_blas_data_mapperIdiLi0EEELi0ELb0EdNS2_IdiLi1EEELb0ELi0EE3runEiiRKS3_RKS4_Pdid.isra.0 |
| 17 | ····14:·000e8 | 17 | ····14:·000e8e40···363·FUNC····LOCAL··DEFAULT···13·_ZN5Eigen8internal13gemm_pack_lhsIdiNS0_22const_blas_data_mapperIdiLi0EEELi2ELi2EDv2_dLi0ELb0ELb0EEclEPdRKS3_iiii.isra.0 |
| 18 | ····15:·000e8 | 18 | ····15:·000e8fb0···652·FUNC····LOCAL··DEFAULT···13·_ZN5Eigen8internal13gemm_pack_rhsIdiNS0_16blas_data_mapperIdiLi0ELi0ELi1EEELi4ELi0ELb0ELb1EEclEPdRKS3_iiii.isra.0 |
| 19 | ····16:·000e | 19 | ····16:·000e9240··1482·FUNC····LOCAL··DEFAULT···13·_ZN5boost4math5tools6detail23evaluate_rational_c_impIeyeEET1_PKT_PKT0_RKS4_PKSt17integral_constantIiLi17EE.isra.0 |
| 20 | ····17:·000e9 | 20 | ····17:·000e9810···167·FUNC····LOCAL··DEFAULT···13·_ZNSt7__cxx1112basic_stringIcSt11char_traitsIcESaIcEE12_M_constructIPKcEEvT_S8_St20forward_iterator_tag.isra.0 |
| 21 | ····18:·000e9 | 21 | ····18:·000e9960··2435·FUNC····LOCAL··DEFAULT···13·_ZN5Eigen8internal22lhs_process_one_packetILi4ELi2ELi1EdddDv2_dS2_S2_S2_NS0_11gebp_traitsIddLb0ELb0ELi1ELi0EEENS0_16BlasLinearMapperIdiLi0ELi1EEENS0_16blas_data_mapperIdiLi0ELi0ELi1EEEEclERKS8_PKdSD_diiiiiiiiiiii.isra.0 |
| 22 | ····19:·000e | 22 | ····19:·000ea2f0··1092·FUNC····LOCAL··DEFAULT···13·_ZN5Eigen8internal11gebp_kernelIddiNS0_16blas_data_mapperIdiLi0ELi0ELi1EEELi2ELi4ELb0ELb0EEclERKS3_PKdS8_iiidiiii.isra.0 |
| 23 | ····20:·000ea | 23 | ····20:·000ea740···257·FUNC····LOCAL··DEFAULT···13·_ZNSt3tr110_HashtableISt6vectorIjSaIjEESt4pairIKS3_iESaIS6_ESt10_Select1stIS6_ESt8equal_toIS3_E11hashPatternNS_8__detail18_Mod_range_hashingENSD_20_Default_ranged_hashENSD_20_Prime_rehash_policyELb0ELb0ELb1EE4findERS5_.isra.0 |
| 24 | ····21:·000ea | 24 | ····21:·000ea850···167·FUNC····LOCAL··DEFAULT···13·_ZNSt7__cxx1112basic_stringIcSt11char_traitsIcESaIcEE12_M_constructIPcEEvT_S7_St20forward_iterator_tag.isra.0 |
| 25 | ····22:·000ea | 25 | ····22:·000ea900···389·FUNC····LOCAL··DEFAULT···13·_ZNSt6vectorIiSaIiEEaSERKS1_.isra.0 |
| 26 | ····23:·000ea | 26 | ····23:·000eab60···176·FUNC····LOCAL··DEFAULT···13·_ZNSt7__cxx1112basic_stringIcSt11char_traitsIcESaIcEEC2EPKcRKS3_.isra.0 |
| 27 | ····24:·00081 | 27 | ····24:·0008180a····33·FUNC····LOCAL··DEFAULT···13·_ZNSt7__cxx1112basic_stringIcSt11char_traitsIcESaIcEEC2EPKcRKS3_.isra.0.cold |
| 28 | ····25:·000ea | 28 | ····25:·000eac10···704·FUNC····LOCAL··DEFAULT···13·_ZNSt3tr18__detail9_Map_baseIjSt4pairIKjjESt10_Select1stIS4_ELb1ENS_10_HashtableIjS4_SaIS4_ES6_St8equal_toIjENS_4hashIjEENS0_18_Mod_range_hashingENS0_20_Default_ranged_hashENS0_20_Prime_rehash_policyELb0ELb0ELb1EEEEixERS3_.isra.0 |
| 29 | ····26:·00081 | 29 | ····26:·0008182c····48·FUNC····LOCAL··DEFAULT···13·_ZNSt3tr18__detail9_Map_baseIjSt4pairIKjjESt10_Select1stIS4_ELb1ENS_10_HashtableIjS4_SaIS4_ES6_St8equal_toIjENS_4hashIjEENS0_18_Mod_range_hashingENS0_20_Default_ranged_hashENS0_20_Prime_rehash_policyELb0ELb0ELb1EEEEixERS3_.isra.0.cold |
| 30 | ····27:·00081 | 30 | ····27:·0008185c···192·FUNC····LOCAL··DEFAULT···13·_ZStplIcSt11char_traitsIcESaIcEENSt7__cxx1112basic_stringIT_T0_T1_EEPKS5_RKS8_.isra.0 |
| 31 | ····28:·000ea | 31 | ····28:·000eaed0···329·FUNC····LOCAL··DEFAULT···13·_ZNSt8_Rb_treeINSt7__cxx1112basic_stringIcSt11char_traitsIcESaIcEEESt4pairIKS5_iESt10_Select1stIS8_ESt4lessIS5_ESaIS8_EE24_M_get_insert_unique_posERS7_.isra.0 |
| 32 | ····29:·00081 | 32 | ····29:·0008191c···130·FUNC····LOCAL··DEFAULT···13·_ZStplIcSt11char_traitsIcESaIcEENSt7__cxx1112basic_stringIT_T0_T1_EEOS8_RKS8_.isra.0 |
| 33 | ····30:·000e | 33 | ····30:·000eb020···620·FUNC····LOCAL··DEFAULT···13·_ZNSt6vectorINSt7__cxx1112basic_stringIcSt11char_traitsIcESaIcEEESaIS5_EEaSERKS7_.isra.0 |
| 34 | ····31:·00081 | 34 | ····31:·0008199e···168·FUNC····LOCAL··DEFAULT···13·_ZNSt6vectorINSt7__cxx1112basic_stringIcSt11char_traitsIcESaIcEEESaIS5_EEaSERKS7_.isra.0.cold |
| 35 | ····32:·000e | 35 | ····32:·000eb290···636·FUNC····LOCAL··DEFAULT···13·_ZNSt8_Rb_treeINSt7__cxx1112basic_stringIcSt11char_traitsIcESaIcEEESt4pairIKS5_iESt10_Select1stIS8_ESt4lessIS5_ESaIS8_EE8_M_eraseEPSt13_Rb_tree_nodeIS8_E.isra.0 |
| 36 | ····33:·000e | 36 | ····33:·000eb510···768·FUNC····LOCAL··DEFAULT···13·_ZSt25__unguarded_linear_insertIN9__gnu_cxx17__normal_iteratorIPNSt7__cxx1112basic_stringIcSt11char_traitsIcESaIcEEESt6vectorIS7_SaIS7_EEEENS0_5__ops14_Val_less_iterEEvT_T0_.isra.0 |
| 37 | ····34:·000eb | 37 | ····34:·000eb810··1230·FUNC····LOCAL··DEFAULT···13·_ZSt16__insertion_sortIN9__gnu_cxx17__normal_iteratorIPNSt7__cxx1112basic_stringIcSt11char_traitsIcESaIcEEESt6vectorIS7_SaIS7_EEEENS0_5__ops15_Iter_less_iterEEvT_SF_T0_.isra.0 |
| 38 | ····35:·000eb | 38 | ····35:·000ebce0··2044·FUNC····LOCAL··DEFAULT···13·_ZSt13__adjust_heapIN9__gnu_cxx17__normal_iteratorIPNSt7__cxx1112basic_stringIcSt11char_traitsIcESaIcEEESt6vectorIS7_SaIS7_EEEEiS7_NS0_5__ops15_Iter_less_iterEEvT_T0_SG_T1_T2_.isra.0 |
| 39 | ····36:·000e | 39 | ····36:·000ec4e0···866·FUNC····LOCAL··DEFAULT···13·_ZN5boost4math6detail16lgamma_small_impIeNS0_8policies6policyINS3_13promote_floatILb0EEENS3_14promote_doubleILb0EEENS3_14default_policyES9_S9_S9_S9_S9_S9_S9_S9_S9_S9_EENS0_7lanczos12lanczos17m64EEET_SD_SD_SD_RKSt17integral_constantIiLi64EERKT0_RKT1_.isra.0 |
| 40 | ····37:·000ec | 40 | ····37:·000ec850···965·FUNC····LOCAL··DEFAULT···13·_ZNSt8_Rb_treeINSt7__cxx1112basic_stringIcSt11char_traitsIcESaIcEEESt4pairIKS5_iESt10_Select1stIS8_ESt4lessIS5_ESaIS8_EE22_M_emplace_hint_uniqueIJRKSt21piecewise_construct_tSt5tupleIJRS7_EESJ_IJEEEEESt17_Rb_tree_iteratorIS8_ESt23_Rb_tree_const_iteratorIS8_EDpOT_.isra.0 |
| 41 | ····38:·00081 | 41 | ····38:·00081a46····93·FUNC····LOCAL··DEFAULT···13·_ZNSt8_Rb_treeINSt7__cxx1112basic_stringIcSt11char_traitsIcESaIcEEESt4pairIKS5_iESt10_Select1stIS8_ESt4lessIS5_ESaIS8_EE22_M_emplace_hint_uniqueIJRKSt21piecewise_construct_tSt5tupleIJRS7_EESJ_IJEEEEESt17_Rb_tree_iteratorIS8_ESt23_Rb_tree_const_iteratorIS8_EDpOT_.isra.0.cold |
| 42 | ····39:·000ec | 42 | ····39:·000ecc20··1477·FUNC····LOCAL··DEFAULT···13·_ZN5boost4math6detail7erf_impIeNS0_8policies6policyINS3_13promote_floatILb0EEENS3_14promote_doubleILb0EEENS3_14default_policyES9_S9_S9_S9_S9_S9_S9_S9_S9_S9_EEEET_SB_bRKT0_RKSt17integral_constantIiLi64EE.isra.0 |
| 43 | ····40:·000e | 43 | ····40:·000ed1f0····41·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment10getSeqNameB5cxx11Ei.part.0 |
| 44 | ····41:·000e | 44 | ····41:·000ed220···726·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment16convertPomoStateEi.part.0 |
| 45 | ····42:·00081 | 45 | ····42:·00081aa4·····5·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment16convertPomoStateEi.part.0.cold |
| 46 | ····43:·00081 | 46 | ····43:·00081aaa···221·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment14computeObsDistEii.cold |
| 47 | ····44:·00081 | 47 | ····44:·00081b88····28·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment23computeDivergenceMatrixEPdS0_b.cold |
| 48 | ····45:·00081 | 48 | ····45:·00081ba4···161·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment13checkGappySeqEb.cold |
| 49 | ····46:·00081 | 49 | ····46:·00081c45···323·FUNC····LOCAL··DEFAULT···13·_Z23getDataBlockMorphStatesP18NxsCharactersBlock.cold |
| 50 | ····47:·00081 | 50 | ····47:·00081d88·····5·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment19printSiteInfoHeaderERSoPKcb.cold |
| 51 | ····48:·00081 | 51 | ····48:·00081d8e···133·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment19convertStateBackStrB5cxx11Ej.cold |
| 52 | ····49:·00081 | 52 | ····49:·00081e14···379·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment17checkAbsentStatesENSt7__cxx1112basic_stringIcSt11char_traitsIcESaIcEEE.cold |
| 53 | ····50:·00081 | 53 | ····50:·00081f90····78·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment9initCodonEPc.cold |
| 54 | ····51:·00081 | 54 | ····51:·00081fde····32·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment18getSiteFromResidueEiRiS0_.cold |
| 55 | ····52:·00081 | 55 | ····52:·00081ffe···304·FUNC····LOCAL··DEFAULT···13·_Z13convert_rangePKcRiS1_S1_RPc.cold |
| 56 | ····53:·00082 | 56 | ····53:·0008212e·····5·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment9printDistERSoPd.cold |
| 57 | ····54:·00082 | 57 | ····54:·00082134····19·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment21countStatePerSequenceEPj.cold |
| 58 | ····55:·00082 | 58 | ····55:·00082148····28·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment27computeStateFreqPerSequenceEPd.cold |
| 59 | ····56:·00082 | 59 | ····56:·00082164·····9·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment18convertCountToFreqEPjPd.cold |
| 60 | ····57:·00082 | 60 | ····57:·0008216e····10·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment16computeStateFreqEPdj.cold |
| 61 | ····58:·00082 | 61 | ····58:·00082178····64·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment16computeCodonFreqE13StateFreqTypePdS1_.cold |
| 62 | ····59:·00082 | 62 | ····59:·000821b8····39·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment15multinomialProbES_Rd.cold |
| 63 | ····60:·00082 | 63 | ····60:·000821e0····17·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment15multinomialProbERSt6vectorIiSaIiEE.cold |
| 64 | ····61:·00082 | 64 | ····61:·000821f1···676·FUNC····LOCAL··DEFAULT···13·_Z10processSeqRNSt7__cxx1112basic_stringIcSt11char_traitsIcESaIcEEES5_i.cold |
| 65 | ····62:·00082 | 65 | ····62:·00082496···228·FUNC····LOCAL··DEFAULT···13·_ZN9AlignmentC2Ev.cold |
| 66 | ····63:·00082 | 66 | ····63:·0008257a···537·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment13printSiteGapsEPKc.cold |
| 67 | ····64:·005 | 67 | ····64:·00524808····22·OBJECT··LOCAL··DEFAULT···15·_ZL16ERR_WRITE_OUTPUT |
| 68 | ····65:·00082 | 68 | ····65:·00082794···368·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment9printDistEPKcPd.cold |
| 69 | ····66:·00082 | 69 | ····66:·00082904···400·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment14printAlignmentE9InputTypePKcbS2_iS2_.cold |
| 70 | ····67:·00082 | 70 | ····67:·00082a94····23·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment24createBootstrapAlignmentERSt6vectorIiSaIiEEPKc.cold |
| 71 | ····68:·00082 | 71 | ····68:·00082aac····83·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment17checkIdenticalSeqEv.cold |
| 72 | ····69:·00082 | 72 | ····69:·00082b00···198·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment15multinomialProbEPdRd.cold |
| 73 | ····70:·00082 | 73 | ····70:·00082bc6···199·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment15multinomialProbESt6vectorIdSaIdEERd.cold |
| 74 | ····71:·00082 | 74 | ····71:·00082c8e··1004·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment19buildRetainingSitesEPKcRSt6vectorIiSaIiEEiS1_.cold |
| 75 | ····72:·005 | 75 | ····72:·00524820····55·OBJECT··LOCAL··DEFAULT···15·_ZL14ERR_READ_INPUT |
| 76 | ····73:·0008 | 76 | ····73:·0008307a···169·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment11printPhylipERSobPKciS2_b.cold |
| 77 | ····74:·00083 | 77 | ····74:·00083124···169·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment10printFastaERSobPKciS2_.cold |
| 78 | ····75:·00083 | 78 | ····75:·000831ce···320·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment10printNexusERSobPKciS2_b.cold |
| 79 | ····76:·00083 | 79 | ····76:·0008330e···873·FUNC····LOCAL··DEFAULT···13·_Z13extractSiteIDP9AlignmentPKcRSt6vectorIiSaIiEE.cold |
| 80 | ····77:·00083 | 80 | ····77:·00083678···407·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment24createBootstrapAlignmentEPiPKcS0_.cold |
| 81 | ····78:·00083 | 81 | ····78:·00083810···872·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment8readDistERSiPd.cold |
| 82 | ····79:·00083 | 82 | ····79:·00083b78···759·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment8readDistEPKcPd.cold |
| 83 | ····80:·000f9 | 83 | ····80:·000f9d60··1522·FUNC····LOCAL··DEFAULT···13·_ZSt16__introsort_loopIN9__gnu_cxx17__normal_iteratorIPNSt7__cxx1112basic_stringIcSt11char_traitsIcESaIcEEESt6vectorIS7_SaIS7_EEEEiNS0_5__ops15_Iter_less_iterEEvT_SF_T0_T1_.isra.0 |
| 84 | ····81:·000f | 84 | ····81:·000fa360··2200·FUNC····LOCAL··DEFAULT···13·_ZNSt6vectorINSt7__cxx1112basic_stringIcSt11char_traitsIcESaIcEEESaIS5_EE15_M_range_insertIN9__gnu_cxx17__normal_iteratorIPS5_S7_EEEEvSC_T_SD_St20forward_iterator_tag.isra.0 |
| 85 | ····82:·00083 | 85 | ····82:·00083e70···110·FUNC····LOCAL··DEFAULT···13·_ZNSt6vectorINSt7__cxx1112basic_stringIcSt11char_traitsIcESaIcEEESaIS5_EE15_M_range_insertIN9__gnu_cxx17__normal_iteratorIPS5_S7_EEEEvSC_T_SD_St20forward_iterator_tag.isra.0.cold |
| 86 | ····83:·00083 | 86 | ····83:·00083ede···532·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment12checkSeqNameEv.cold |
| 87 | ····84:·0008 | 87 | ····84:·000840f2····56·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment10addPatternER7Patternii.cold |
| 88 | ····85:·000e | 88 | ····85:·000e45f0····84·FUNC····LOCAL··DEFAULT···13·_ZN5boost4math3erfIeNS0_8policies6policyINS2_13promote_floatILb0EEENS2_14promote_doubleILb0EEENS2_14default_policyES8_S8_S8_S8_S8_S8_S8_S8_S8_S8_EEEENS0_5tools12promote_argsIT_fffffE4typeESC_RKT0_.isra.0 |
| 89 | ····86:·000f | 89 | ····86:·000fc710···482·FUNC····LOCAL··DEFAULT···13·_ZN5boost4math6detail18full_igamma_prefixIeNS0_8policies6policyINS3_13promote_floatILb0EEENS3_14promote_doubleILb0EEENS3_14default_policyES9_S9_S9_S9_S9_S9_S9_S9_S9_S9_EEEET_SB_SB_RKT0_.isra.0 |
| 90 | ····87:·000fc | 90 | ····87:·000fc900··1045·FUNC····LOCAL··DEFAULT···13·_ZN5boost4math6detail8beta_impIeNS0_7lanczos12lanczos17m64ENS0_8policies6policyINS5_13promote_floatILb0EEENS5_14promote_doubleILb0EEENS5_14default_policyESB_SB_SB_SB_SB_SB_SB_SB_SB_SB_EEEET_SD_SD_RKT0_RKT1_.isra.0 |
| 91 | ····88:·000fc | 91 | ····88:·000fcd20····98·FUNC····LOCAL··DEFAULT···13·_ZN5boost4math6detail4betaIeeNS0_8policies6policyINS3_13promote_floatILb0EEENS3_14promote_doubleILb0EEENS3_14default_policyES9_S9_S9_S9_S9_S9_S9_S9_S9_S9_EEEENS0_5tools12promote_argsIT_T0_ffffE4typeESD_SE_RKT1_PKSt17integral_constantIbLb1EE.isra.0 |
| 92 | ····89:·000fc | 92 | ····89:·000fcd90···542·FUNC····LOCAL··DEFAULT···13·_ZN5boost4math20binomial_coefficientIeNS0_8policies6policyINS2_13promote_floatILb0EEENS2_14promote_doubleILb0EEENS2_14default_policyES8_S8_S8_S8_S8_S8_S8_S8_S8_S8_EEEET_jjRKT0_.isra.0 |
| 93 | ····90:·000fc | 93 | ····90:·000fcfb0··4044·FUNC····LOCAL··DEFAULT···13·_ZN5boost4math6detail17ibeta_power_termsIeNS0_7lanczos12lanczos17m64ENS0_8policies6policyINS5_13promote_floatILb0EEENS5_14promote_doubleILb0EEENS5_14default_policyESB_SB_SB_SB_SB_SB_SB_SB_SB_SB_EEEET_SD_SD_SD_SD_RKT0_bRKT1_SD_PKc.isra.0 |
| 94 | ····91:·000fd | 94 | ····91:·000fdf80···769·FUNC····LOCAL··DEFAULT···13·_ZN5boost4math6detail15ibeta_fraction2IeNS0_8policies6policyINS3_13promote_floatILb0EEENS3_14promote_doubleILb0EEENS3_14default_policyES9_S9_S9_S9_S9_S9_S9_S9_S9_S9_EEEET_SB_SB_SB_SB_RKT0_bPSB_.isra.0 |
| 95 | ····92:·000f | 95 | ····92:·000fe290··1124·FUNC····LOCAL··DEFAULT···13·_ZN5boost4math6detail9powm1_impIeNS0_8policies6policyINS3_13promote_floatILb0EEENS3_14promote_doubleILb0EEENS3_14default_policyES9_S9_S9_S9_S9_S9_S9_S9_S9_S9_EEEET_SB_SB_RKT0_.isra.0 |
| 96 | ····93:·000f | 96 | ····93:·000fe700···849·FUNC····LOCAL··DEFAULT···13·_ZN5boost4math6detail9gamma_impIeNS0_8policies6policyINS3_13promote_floatILb0EEENS3_14promote_doubleILb0EEENS3_14default_policyES9_S9_S9_S9_S9_S9_S9_S9_S9_S9_EENS0_7lanczos12lanczos17m64EEET_SD_RKT0_RKT1_.isra.0 |
| 97 | ····94:·000fe | 97 | ····94:·000fea60···796·FUNC····LOCAL··DEFAULT···13·_ZN5boost4math6detail10lgamma_impIeNS0_8policies6policyINS3_13promote_floatILb0EEENS3_14promote_doubleILb0EEENS3_14default_policyES9_S9_S9_S9_S9_S9_S9_S9_S9_S9_EENS0_7lanczos12lanczos17m64EEET_SD_RKT0_RKT1_Pi.isra.0 |
| 98 | ····95:·000e | 98 | ····95:·000e4650····86·FUNC····LOCAL··DEFAULT···13·_ZN5boost4math6lgammaIeNS0_8policies6policyINS2_13promote_floatILb0EEENS2_14promote_doubleILb0EEENS2_14default_policyES8_S8_S8_S8_S8_S8_S8_S8_S8_S8_EEEENS0_5tools12promote_argsIT_fffffE4typeESC_PiRKT0_.isra.0 |
| 99 | ····96:·000fe | 99 | ····96:·000fed80···697·FUNC····LOCAL··DEFAULT···13·_ZN5boost4math6detail30tgamma_delta_ratio_imp_lanczosIeNS0_8policies6policyINS3_13promote_floatILb0EEENS3_14promote_doubleILb0EEENS3_14default_policyES9_S9_S9_S9_S9_S9_S9_S9_S9_S9_EENS0_7lanczos12lanczos17m64EEET_SD_SD_RKT0_RKT1_.isra.0 |
| 100 | ····97:·000f | 100 | ····97:·000ff040···114·FUNC····LOCAL··DEFAULT···13·_ZN5boost4math8policies23check_series_iterationsIeNS1_6policyINS1_13promote_floatILb0EEENS1_14promote_doubleILb0EEENS1_14default_policyES8_S8_S8_S8_S8_S8_S8_S8_S8_S8_EEEEvPKcyRKT0_.part.0 |
| 101 | ····98:·000f | 101 | ····98:·000ff0c0··1595·FUNC····LOCAL··DEFAULT···13·_ZN5boost4math6detail24regularised_gamma_prefixIeNS0_8policies6policyINS3_13promote_floatILb0EEENS3_14promote_doubleILb0EEENS3_14default_policyES9_S9_S9_S9_S9_S9_S9_S9_S9_S9_EENS0_7lanczos12lanczos17m64EEET_SD_SD_RKT0_RKT1_.isra.0 |
| 102 | ····99:·000f | 102 | ····99:·000ff700··1767·FUNC····LOCAL··DEFAULT···13·_ZN5boost4math6detail12ibeta_seriesIeNS0_7lanczos12lanczos17m64ENS0_8policies6policyINS5_13promote_floatILb0EEENS5_14promote_doubleILb0EEENS5_14default_policyESB_SB_SB_SB_SB_SB_SB_SB_SB_SB_EEEET_SD_SD_SD_SD_RKT0_bPSD_SD_RKT1_.isra.0 |
| 103 | ···100:·000ff | 103 | ···100:·000ffdf0··9796·FUNC····LOCAL··DEFAULT···13·_ZN5boost4math6detail20gamma_incomplete_impIeNS0_8policies6policyINS3_13promote_floatILb0EEENS3_14promote_doubleILb0EEENS3_14default_policyES9_S9_S9_S9_S9_S9_S9_S9_S9_S9_EEEET_SB_SB_bbRKT0_PSB_.isra.0 |
| 104 | ···101:·00084 | 104 | ···101:·0008412a···105·FUNC····LOCAL··DEFAULT···13·_ZN5boost4math6detail20gamma_incomplete_impIeNS0_8policies6policyINS3_13promote_floatILb0EEENS3_14promote_doubleILb0EEENS3_14default_policyES9_S9_S9_S9_S9_S9_S9_S9_S9_S9_EEEET_SB_SB_bbRKT0_PSB_.isra.0.cold |
| 105 | ···102:·0010 | 105 | ···102:·00102440··2045·FUNC····LOCAL··DEFAULT···13·_ZN5boost4math6detail27beta_small_b_large_a_seriesIeNS0_8policies6policyINS3_13promote_floatILb0EEENS3_14promote_doubleILb0EEENS3_14default_policyES9_S9_S9_S9_S9_S9_S9_S9_S9_S9_EEEET_SB_SB_SB_SB_SB_SB_RKT0_b.isra.0 |
| 106 | ···103:·00102 | 106 | ···103:·00102c40··7962·FUNC····LOCAL··DEFAULT···13·_ZN13SymTestResult13computePvalueEv.part.0 |
| 107 | ···104:·00084 | 107 | ···104:·00084194····96·FUNC····LOCAL··DEFAULT···13·_ZN13SymTestResult13computePvalueEv.part.0.cold |
| 108 | ···105:·00104 | 108 | ···105:·00104b80···362·FUNC····LOCAL··DEFAULT···13·_ZN5Eigen8internal19gemv_dense_selectorILi2ELi1ELb1EE3runINS_9TransposeIKNS_6MatrixIdLin1ELin1ELi0ELin1ELin1EEEEENS4_IKNS4_INS5_IdLin1ELi1ELi0ELin1ELi1EEEEEEENS4_INS5_IdLi1ELin1ELi1ELi1ELin1EEEEEEEvRKT_RKT0_RT1_RKNSL_6ScalarE.isra.0 |
| 109 | ···106:·00084 | 109 | ···106:·000841f4····22·FUNC····LOCAL··DEFAULT···13·_ZN5Eigen8internal19gemv_dense_selectorILi2ELi1ELb1EE3runINS_9TransposeIKNS_6MatrixIdLin1ELin1ELi0ELin1ELin1EEEEENS4_IKNS4_INS5_IdLin1ELi1ELi0ELin1ELi1EEEEEEENS4_INS5_IdLi1ELin1ELi1ELi1ELin1EEEEEEEvRKT_RKT0_RT1_RKNSL_6ScalarE.isra.0.cold |
| 110 | ···107:·001 | 110 | ···107:·001300f0···437·FUNC····LOCAL··DEFAULT···13·_ZN5Eigen8internal16parallelize_gemmILb1ENS0_12gemm_functorIdiNS0_29general_matrix_matrix_productIidLi0ELb0EdLi0ELb0ELi0ELi1EEENS_5BlockIKNS_6MatrixIdLin1ELin1ELi0ELin1ELin1EEELin1ELin1ELb0EEENS5_IS7_Lin1ELin1ELb0EEES7_NS0_19gemm_blocking_spaceILi0EddLin1ELin1ELin1ELi1ELb0EEEEEiEEvRKT0_T1_SH_SH_b._omp_fn.0 |
| 111 | ···108:·00104 | 111 | ···108:·00104cf0··1509·FUNC····LOCAL··DEFAULT···13·_ZNK5Eigen9DenseBaseINS_13CwiseBinaryOpINS_8internal17scalar_product_opIddEEKNS_9TransposeIKNS_7ProductINS5_INS_6MatrixIdLin1ELi1ELi0ELin1ELi1EEEEENS_7InverseINS_9FullPivLUINS7_IdLin1ELin1ELi0ELin1ELin1EEEEEEELi0EEEEEKS8_EEE5reduxINS2_13scalar_sum_opIddEEEEdRKT_.isra.0 |
| 112 | ···109:·00084 | 112 | ···109:·0008420a···285·FUNC····LOCAL··DEFAULT···13·_ZNK5Eigen9DenseBaseINS_13CwiseBinaryOpINS_8internal17scalar_product_opIddEEKNS_9TransposeIKNS_7ProductINS5_INS_6MatrixIdLin1ELi1ELi0ELin1ELi1EEEEENS_7InverseINS_9FullPivLUINS7_IdLin1ELin1ELi0ELin1ELin1EEEEEEELi0EEEEEKS8_EEE5reduxINS2_13scalar_sum_opIddEEEEdRKT_.isra.0.cold |
| 113 | ···110:·000e | 113 | ···110:·000e46b0···388·FUNC····LOCAL··DEFAULT···13·_GLOBAL__sub_I_symbols_protein |
| 114 | ···111:·00084 | 114 | ···111:·00084328···307·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment16extractDataBlockEP18NxsCharactersBlock.cold |
| 115 | ···112:·00084 | 115 | ···112:·0008445c···273·FUNC····LOCAL··DEFAULT···13·_ZN9AlignmentC2EP12NxsDataBlockPcNSt7__cxx1112basic_stringIcSt11char_traitsIcESaIcEEE.cold |
| 116 | ···113:·00084 | 116 | ···113:·0008456e···483·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment9readNexusEPc.cold |
| 117 | ···114:·00084 | 117 | ···114:·00084752···102·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment13printSiteInfoERSoi.cold |
| 118 | ···115:·00084 | 118 | ···115:·000847b8···209·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment13printSiteInfoEPKc.cold |
| 119 | ···116:·00084 | 119 | ···116:·0008488a····68·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment16addConstPatternsEPc.cold |
| 120 | ···117:·00084 | 120 | ···117:·000848ce···199·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment22orderPatternByNumCharsEi.cold |
| 121 | ···118:·00084 | 121 | ···118:·00084996···155·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment18ungroupSitePatternEv.cold |
| 122 | ···119:·00084 | 122 | ···119:·00084a32···180·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment18regroupSitePatternEiRSt6vectorIiSaIiEE.cold |
| 123 | ···120:·00084 | 123 | ···120:·00084ae6··1403·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment17readSiteStateFreqEPKc.cold |
| 124 | ···121:·0008 | 124 | ···121:·00085062··1418·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment12buildPatternERSt6vectorINSt7__cxx1112basic_stringIcSt11char_traitsIcESaIcEEESaIS6_EEPcii.cold |
| 125 | ···122:·00085 | 125 | ···122:·000855ec··1052·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment10readPhylipEPcS0_.cold |
| 126 | ···123:·00085 | 126 | ···123:·00085a08··1859·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment20readPhylipSequentialEPcS0_.cold |
| Max diff block lines reached; 2026462/2082889 bytes (97.29%) of diff not shown. | |||
| Offset 1, 8 lines modified | Offset 1, 8 lines modified | ||
| 1 | Displaying·notes·found·in:·.note.gnu.build-id | 1 | Displaying·notes·found·in:·.note.gnu.build-id |
| 2 | ··Owner················Data·size·» Description | 2 | ··Owner················Data·size·» Description |
| 3 | ··GNU··················0x00000014» NT_GNU_BUILD_ID·(unique·build·ID·bitstring)» ····Build·ID:· | 3 | ··GNU··················0x00000014» NT_GNU_BUILD_ID·(unique·build·ID·bitstring)» ····Build·ID:·235fee460a3080e8cc20829326b4b50a3516b56b |
| 4 | Displaying·notes·found·in:·.note.ABI-tag | 4 | Displaying·notes·found·in:·.note.ABI-tag |
| 5 | ··Owner················Data·size·» Description | 5 | ··Owner················Data·size·» Description |
| 6 | ··GNU··················0x00000010» NT_GNU_ABI_TAG·(ABI·version·tag)» ····OS:·Linux,·ABI:·3.2.0 | 6 | ··GNU··················0x00000010» NT_GNU_ABI_TAG·(ABI·version·tag)» ····OS:·Linux,·ABI:·3.2.0 |
| Offset 25, 194 lines modified | Offset 25, 194 lines modified | ||
| 25 | ··Opcode·9·has·1·arg | 25 | ··Opcode·9·has·1·arg |
| 26 | ··Opcode·10·has·0·args | 26 | ··Opcode·10·has·0·args |
| 27 | ··Opcode·11·has·0·args | 27 | ··Opcode·11·has·0·args |
| 28 | ··Opcode·12·has·1·arg | 28 | ··Opcode·12·has·1·arg |
| 29 | ·The·Directory·Table·(offset·0x22,·lines·22,·columns·1): | 29 | ·The·Directory·Table·(offset·0x22,·lines·22,·columns·1): |
| 30 | ··Entry» Name | 30 | ··Entry» Name |
| 31 | ··0» (line_strp)» (offset:·0x1e):·./build. | 31 | ··0» (line_strp)» (offset:·0x1e):·./build.mpi |
| 32 | ··1» (line_strp)» (offset:·0x2 | 32 | ··1» (line_strp)» (offset:·0x2a):·./obsolete |
| 33 | ··2» (line_strp)» (offset:·0x3 | 33 | ··2» (line_strp)» (offset:·0x35):·/usr/include/c++/14/bits |
| 34 | ··3» (line_strp)» (offset:·0x | 34 | ··3» (line_strp)» (offset:·0x4e):·/usr/include/c++/14 |
| 35 | ··4» (line_strp)» (offset:·0x6 | 35 | ··4» (line_strp)» (offset:·0x62):·/usr/include/c++/14/debug |
| 36 | ··5» (line_strp)» (offset:·0x7 | 36 | ··5» (line_strp)» (offset:·0x7c):·/usr/include/i386-linux-gnu/c++/14/bits |
| 37 | ··6» (line_strp)» (offset:·0xa | 37 | ··6» (line_strp)» (offset:·0xa4):·/usr/include/c++/14/tr1 |
| 38 | ··7» (line_strp)» (offset:·0xb | 38 | ··7» (line_strp)» (offset:·0xbc):·/usr/include/c++/14/ext |
| 39 | ··8» (line_strp)» (offset:·0xd | 39 | ··8» (line_strp)» (offset:·0xd4):·/usr/lib/gcc/i686-linux-gnu/14/include |
| 40 | ··9» (line_strp)» (offset:·0xf | 40 | ··9» (line_strp)» (offset:·0xfb):·/usr/include |
| 41 | ··10» (line_strp)» (offset:·0x10 | 41 | ··10» (line_strp)» (offset:·0x108):·/usr/include/i386-linux-gnu/bits/types |
| 42 | ··11» (line_strp)» (offset:·0x1 | 42 | ··11» (line_strp)» (offset:·0x12f):·/usr/include/i386-linux-gnu/bits |
| 43 | ··12» (line_strp)» (offset:·0x15 | 43 | ··12» (line_strp)» (offset:·0x150):·./ncl |
| 44 | ··13» (line_strp)» (offset:·0x15 | 44 | ··13» (line_strp)» (offset:·0x156):·./utils |
| 45 | ··14» (line_strp)» (offset:·0x1 | 45 | ··14» (line_strp)» (offset:·0x15e):·./pda |
| 46 | ··15» (line_strp)» (offset:·0x16 | 46 | ··15» (line_strp)» (offset:·0x164):·./tree |
| 47 | ··16» (line_strp)» (offset:·0x16 | 47 | ··16» (line_strp)» (offset:·0x16b):·./yaml-cpp/include/yaml-cpp |
| 48 | ··17» (line_strp)» (offset:·0x18 | 48 | ··17» (line_strp)» (offset:·0x187):·./yaml-cpp/include/yaml-cpp/node/detail |
| 49 | ··18» (line_strp)» (offset:·0x1 | 49 | ··18» (line_strp)» (offset:·0x1af):·./phylo-yaml |
| 50 | ··19» (line_strp)» (offset:·0x1b | 50 | ··19» (line_strp)» (offset:·0x1bc):·./alignment |
| 51 | ··20» (line_strp)» (offset:·0x1c | 51 | ··20» (line_strp)» (offset:·0x1c8):·./model |
| 52 | ··21» (line_strp)» (offset:·0x1d | 52 | ··21» (line_strp)» (offset:·0x1d0):·./nclextra |
| 53 | ·The·File·Name·Table·(offset·0x80,·lines·102,·columns·2): | 53 | ·The·File·Name·Table·(offset·0x80,·lines·102,·columns·2): |
| 54 | ··Entry» Dir» Name | 54 | ··Entry» Dir» Name |
| 55 | ··0» (udata)» 1» (line_strp)» (offset:·0xb):·parsmultistate.cpp | 55 | ··0» (udata)» 1» (line_strp)» (offset:·0xb):·parsmultistate.cpp |
| 56 | ··1» (udata)» 2» (line_strp)» (offset:·0x1d | 56 | ··1» (udata)» 2» (line_strp)» (offset:·0x1db):·locale_facets.h |
| 57 | ··2» (udata)» 1» (line_strp)» (offset:·0xb):·parsmultistate.cpp | 57 | ··2» (udata)» 1» (line_strp)» (offset:·0xb):·parsmultistate.cpp |
| 58 | ··3» (udata)» 2» (line_strp)» (offset:·0x1e | 58 | ··3» (udata)» 2» (line_strp)» (offset:·0x1eb):·basic_string.h |
| 59 | ··4» (udata)» 2» (line_strp)» (offset:·0x1f | 59 | ··4» (udata)» 2» (line_strp)» (offset:·0x1fa):·char_traits.h |
| 60 | ··5» (udata)» 2» (line_strp)» (offset:·0x20 | 60 | ··5» (udata)» 2» (line_strp)» (offset:·0x208):·basic_string.tcc |
| 61 | ··6» (udata)» 2» (line_strp)» (offset:·0x21 | 61 | ··6» (udata)» 2» (line_strp)» (offset:·0x219):·alloc_traits.h |
| 62 | ··7» (udata)» 2» (line_strp)» (offset:·0x22 | 62 | ··7» (udata)» 2» (line_strp)» (offset:·0x228):·new_allocator.h |
| 63 | ··8» (udata)» 2» (line_strp)» (offset:·0x2b | 63 | ··8» (udata)» 2» (line_strp)» (offset:·0x2bc):·allocator.h |
| 64 | ··9» (udata)» 3» (line_strp)» (offset:·0x30 | 64 | ··9» (udata)» 3» (line_strp)» (offset:·0x306):·ostream |
| 65 | ··10» (udata)» 2» (line_strp)» (offset:·0x23 | 65 | ··10» (udata)» 2» (line_strp)» (offset:·0x238):·basic_ios.h |
| 66 | ··11» (udata)» 2» (line_strp)» (offset:·0x24 | 66 | ··11» (udata)» 2» (line_strp)» (offset:·0x244):·ios_base.h |
| 67 | ··12» (udata)» 2» (line_strp)» (offset:·0x2 | 67 | ··12» (udata)» 2» (line_strp)» (offset:·0x24f):·stl_pair.h |
| 68 | ··13» (udata)» 2» (line_strp)» (offset:·0x25 | 68 | ··13» (udata)» 2» (line_strp)» (offset:·0x25a):·stl_iterator_base_types.h |
| 69 | ··14» (udata)» 3» (line_strp)» (offset:·0x95 | 69 | ··14» (udata)» 3» (line_strp)» (offset:·0x950):·type_traits |
| 70 | ··15» (udata)» 4» (line_strp)» (offset:·0x27 | 70 | ··15» (udata)» 4» (line_strp)» (offset:·0x274):·debug.h |
| 71 | ··16» (udata)» 5» (line_strp)» (offset:·0x27 | 71 | ··16» (udata)» 5» (line_strp)» (offset:·0x27c):·c++config.h |
| 72 | ··17» (udata)» 3» (line_strp)» (offset:·0x28 | 72 | ··17» (udata)» 3» (line_strp)» (offset:·0x288):·cwchar |
| 73 | ··18» (udata)» 3» (line_strp)» (offset:·0x2 | 73 | ··18» (udata)» 3» (line_strp)» (offset:·0x28f):·clocale |
| 74 | ··19» (udata)» 3» (line_strp)» (offset:·0x29 | 74 | ··19» (udata)» 3» (line_strp)» (offset:·0x297):·cstdlib |
| 75 | ··20» (udata)» 3» (line_strp)» (offset:·0x2 | 75 | ··20» (udata)» 3» (line_strp)» (offset:·0x29f):·cstdio |
| 76 | ··21» (udata)» 3» (line_strp)» (offset:·0x2a | 76 | ··21» (udata)» 3» (line_strp)» (offset:·0x2a6):·initializer_list |
| 77 | ··22» (udata)» 2» (line_strp)» (offset:·0x2b | 77 | ··22» (udata)» 2» (line_strp)» (offset:·0x2b7):·uses_allocator.h |
| 78 | ··23» (udata)» 3» (line_strp)» (offset:·0x2c | 78 | ··23» (udata)» 3» (line_strp)» (offset:·0x2c8):·tuple |
| 79 | ··24» (udata)» 2» (line_strp)» (offset:·0x2 | 79 | ··24» (udata)» 2» (line_strp)» (offset:·0x2ce):·exception_ptr.h |
| 80 | ··25» (udata)» 2» (line_strp)» (offset:·0x2 | 80 | ··25» (udata)» 2» (line_strp)» (offset:·0x2de):·stringfwd.h |
| 81 | ··26» (udata)» 3» (line_strp)» (offset:·0x2e | 81 | ··26» (udata)» 3» (line_strp)» (offset:·0x2ea):·cwctype |
| 82 | ··27» (udata)» 2» (line_strp)» (offset:·0x2f | 82 | ··27» (udata)» 2» (line_strp)» (offset:·0x2f2):·ostream.tcc |
| 83 | ··28» (udata)» 3» (line_strp)» (offset:·0x | 83 | ··28» (udata)» 3» (line_strp)» (offset:·0x2fe):·iosfwd |
| 84 | ··29» (udata)» 3» (line_strp)» (offset:·0x30 | 84 | ··29» (udata)» 3» (line_strp)» (offset:·0x305):·iostream |
| 85 | ··30» (udata)» 2» (line_strp)» (offset:·0x3 | 85 | ··30» (udata)» 2» (line_strp)» (offset:·0x30e):·postypes.h |
| 86 | ··31» (udata)» 2» (line_strp)» (offset:·0x31 | 86 | ··31» (udata)» 2» (line_strp)» (offset:·0x319):·std_abs.h |
| 87 | ··32» (udata)» 3» (line_strp)» (offset:·0x32 | 87 | ··32» (udata)» 3» (line_strp)» (offset:·0x323):·cmath |
| 88 | ··33» (udata)» 3» (line_strp)» (offset:·0x32 | 88 | ··33» (udata)» 3» (line_strp)» (offset:·0x329):·cstdarg |
| 89 | ··34» (udata)» 3» (line_strp)» (offset:·0x33 | 89 | ··34» (udata)» 3» (line_strp)» (offset:·0x331):·ctime |
| 90 | ··35» (udata)» 3» (line_strp)» (offset:·0x33 | 90 | ··35» (udata)» 3» (line_strp)» (offset:·0x337):·cstring |
| 91 | ··36» (udata)» 6» (line_strp)» (offset:·0x95 | 91 | ··36» (udata)» 6» (line_strp)» (offset:·0x950):·type_traits |
| 92 | ··37» (udata)» 6» (line_strp)» (offset:·0x3 | 92 | ··37» (udata)» 6» (line_strp)» (offset:·0x33f):·hashtable_policy.h |
| 93 | ··38» (udata)» 2» (line_strp)» (offset:·0x35 | 93 | ··38» (udata)» 2» (line_strp)» (offset:·0x352):·shared_ptr_base.h |
| 94 | ··39» (udata)» 3» (line_strp)» (offset:·0x36 | 94 | ··39» (udata)» 3» (line_strp)» (offset:·0x364):·cstddef |
| 95 | ··40» (udata)» 2» (line_strp)» (offset:·0x36 | 95 | ··40» (udata)» 2» (line_strp)» (offset:·0x36c):·ptr_traits.h |
| 96 | ··41» (udata)» 2» (line_strp)» (offset:·0x37 | 96 | ··41» (udata)» 2» (line_strp)» (offset:·0x379):·basic_ios.tcc |
| 97 | ··42» (udata)» 2» (line_strp)» (offset:·0x38 | 97 | ··42» (udata)» 2» (line_strp)» (offset:·0x387):·ostream_insert.h |
| 98 | ··43» (udata)» 2» (line_strp)» (offset:·0x39 | 98 | ··43» (udata)» 2» (line_strp)» (offset:·0x398):·functexcept.h |
| 99 | ··44» (udata)» 2» (line_strp)» (offset:·0x3a | 99 | ··44» (udata)» 2» (line_strp)» (offset:·0x3a6):·stl_iterator_base_funcs.h |
| 100 | ··45» (udata)» 2» (line_strp)» (offset:·0x3c | 100 | ··45» (udata)» 2» (line_strp)» (offset:·0x3c0):·predefined_ops.h |
| 101 | ··46» (udata)» 7» (line_strp)» (offset:·0x21 | 101 | ··46» (udata)» 7» (line_strp)» (offset:·0x219):·alloc_traits.h |
| 102 | ··47» (udata)» 2» (line_strp)» (offset:·0x3d | 102 | ··47» (udata)» 2» (line_strp)» (offset:·0x3d1):·stl_iterator.h |
| 103 | ··48» (udata)» 7» (line_strp)» (offset:·0x3e | 103 | ··48» (udata)» 7» (line_strp)» (offset:·0x3e0):·concurrence.h |
| 104 | ··49» (udata)» 8» (line_strp)» (offset:·0x3 | 104 | ··49» (udata)» 8» (line_strp)» (offset:·0x3ee):·stddef.h |
| 105 | ··50» (udata)» 8» (line_strp)» (offset:·0x3f | 105 | ··50» (udata)» 8» (line_strp)» (offset:·0x3f7):·stdarg.h |
| 106 | ··51» (udata)» 9» (line_strp)» (offset:·0x4b | 106 | ··51» (udata)» 9» (line_strp)» (offset:·0x4b9):·wchar.h |
| 107 | ··52» (udata)» 10» (line_strp)» (offset:·0x40 | 107 | ··52» (udata)» 10» (line_strp)» (offset:·0x400):·wint_t.h |
| 108 | ··53» (udata)» 10» (line_strp)» (offset:·0x40 | 108 | ··53» (udata)» 10» (line_strp)» (offset:·0x409):·__mbstate_t.h |
| 109 | ··54» (udata)» 10» (line_strp)» (offset:·0x40 | 109 | ··54» (udata)» 10» (line_strp)» (offset:·0x40b):·mbstate_t.h |
| 110 | ··55» (udata)» 10» (line_strp)» (offset:·0x41 | 110 | ··55» (udata)» 10» (line_strp)» (offset:·0x417):·__FILE.h |
| 111 | ··56» (udata)» 10» (line_strp)» (offset:·0x42 | 111 | ··56» (udata)» 10» (line_strp)» (offset:·0x420):·struct_FILE.h |
| 112 | ··57» (udata)» 10» (line_strp)» (offset:·0x41 | 112 | ··57» (udata)» 10» (line_strp)» (offset:·0x419):·FILE.h |
| 113 | ··58» (udata)» 11» (line_strp)» (offset:·0x4 | 113 | ··58» (udata)» 11» (line_strp)» (offset:·0x42e):·wchar2.h |
| 114 | ··59» (udata)» 10» (line_strp)» (offset:·0x43 | 114 | ··59» (udata)» 10» (line_strp)» (offset:·0x437):·struct_tm.h |
| 115 | ··60» (udata)» 9» (line_strp)» (offset:·0x44 | 115 | ··60» (udata)» 9» (line_strp)» (offset:·0x443):·locale.h |
| 116 | ··61» (udata)» 11» (line_strp)» (offset:·0x129 | 116 | ··61» (udata)» 11» (line_strp)» (offset:·0x1293):·types.h |
| 117 | ··62» (udata)» 9» (line_strp)» (offset:·0x44 | 117 | ··62» (udata)» 9» (line_strp)» (offset:·0x44c):·stdlib.h |
| 118 | ··63» (udata)» 10» (line_strp)» (offset:·0x45 | 118 | ··63» (udata)» 10» (line_strp)» (offset:·0x455):·clock_t.h |
| 119 | ··64» (udata)» 10» (line_strp)» (offset:·0x4 | 119 | ··64» (udata)» 10» (line_strp)» (offset:·0x45f):·time_t.h |
| 120 | ··65» (udata)» 11» (line_strp)» (offset:·0x46 | 120 | ··65» (udata)» 11» (line_strp)» (offset:·0x468):·stdint-intn.h |
| 121 | ··66» (udata)» 11» (line_strp)» (offset:·0x47 | 121 | ··66» (udata)» 11» (line_strp)» (offset:·0x476):·stdlib-float.h |
| 122 | ··67» (udata)» 11» (line_strp)» (offset:·0x48 | 122 | ··67» (udata)» 11» (line_strp)» (offset:·0x485):·stdlib-bsearch.h |
| 123 | ··68» (udata)» 11» (line_strp)» (offset:·0x44 | 123 | ··68» (udata)» 11» (line_strp)» (offset:·0x44c):·stdlib.h |
| 124 | ··69» (udata)» 10» (line_strp)» (offset:·0x49 | 124 | ··69» (udata)» 10» (line_strp)» (offset:·0x496):·__fpos_t.h |
| 125 | ··70» (udata)» 9» (line_strp)» (offset:·0x4a | 125 | ··70» (udata)» 9» (line_strp)» (offset:·0x4a1):·stdio.h |
| 126 | ··71» (udata)» 11» (line_strp)» (offset:·0x4a | 126 | ··71» (udata)» 11» (line_strp)» (offset:·0x4a9):·stdio2.h |
| 127 | ··72» (udata)» 11» (line_strp)» (offset:·0x4a | 127 | ··72» (udata)» 11» (line_strp)» (offset:·0x4a1):·stdio.h |
| 128 | ··73» (udata)» 11» (line_strp)» (offset:·0x4b | 128 | ··73» (udata)» 11» (line_strp)» (offset:·0x4b2):·wctype-wchar.h |
| 129 | ··74» (udata)» 9» (line_strp)» (offset:·0x4c | 129 | ··74» (udata)» 9» (line_strp)» (offset:·0x4c1):·wctype.h |
| 130 | ··75» (udata)» 3» (line_strp)» (offset:·0x44 | 130 | ··75» (udata)» 3» (line_strp)» (offset:·0x44c):·stdlib.h |
| 131 | ··76» (udata)» 9» (line_strp)» (offset:·0x4c | 131 | ··76» (udata)» 9» (line_strp)» (offset:·0x4ca):·math.h |
| 132 | ··77» (udata)» 9» (line_strp)» (offset:·0x4d | 132 | ··77» (udata)» 9» (line_strp)» (offset:·0x4d1):·time.h |
| 133 | ··78» (udata)» 12» (line_strp)» (offset:·0x4d | 133 | ··78» (udata)» 12» (line_strp)» (offset:·0x4d8):·ncl.h |
| 134 | ··79» (udata)» 9» (line_strp)» (offset:·0x1f | 134 | ··79» (udata)» 9» (line_strp)» (offset:·0x1f1):·string.h |
| 135 | ··80» (udata)» 13» (line_strp)» (offset:·0x27 | 135 | ··80» (udata)» 13» (line_strp)» (offset:·0x2767):·tools.h |
| 136 | ··81» (udata)» 14» (line_strp)» (offset:·0x4 | 136 | ··81» (udata)» 14» (line_strp)» (offset:·0x4de):·split.h |
| 137 | ··82» (udata)» 15» (line_strp)» (offset:·0x5 | 137 | ··82» (udata)» 15» (line_strp)» (offset:·0x57d):·node.h |
| 138 | ··83» (udata)» 14» (line_strp)» (offset:·0x4e | 138 | ··83» (udata)» 14» (line_strp)» (offset:·0x4e6):·hashsplitset.h |
| 139 | ··84» (udata)» 15» (line_strp)» (offset:·0x4f | 139 | ··84» (udata)» 15» (line_strp)» (offset:·0x4f5):·mtree.h |
| 140 | ··85» (udata)» 16» (line_strp)» (offset:·0x2 | 140 | ··85» (udata)» 16» (line_strp)» (offset:·0x2211):·parser.h |
| 141 | ··86» (udata)» 16» (line_strp)» (offset:·0x | 141 | ··86» (udata)» 16» (line_strp)» (offset:·0x4fd):·exceptions.h |
| 142 | ··87» (udata)» 17» (line_strp)» (offset:·0x50 | 142 | ··87» (udata)» 17» (line_strp)» (offset:·0x50a):·bool_type.h |
| 143 | ··88» (udata)» 18» (line_strp)» (offset:·0x51 | 143 | ··88» (udata)» 18» (line_strp)» (offset:·0x516):·statespace.h |
| 144 | ··89» (udata)» 19» (line_strp)» (offset:·0x52 | 144 | ··89» (udata)» 19» (line_strp)» (offset:·0x523):·pattern.h |
| 145 | ··90» (udata)» 19» (line_strp)» (offset:·0x1d | 145 | ··90» (udata)» 19» (line_strp)» (offset:·0x1d62):·alignment.h |
| 146 | ··91» (udata)» 13» (line_strp)» (offset:·0x5 | 146 | ··91» (udata)» 13» (line_strp)» (offset:·0x52d):·checkpoint.h |
| 147 | ··92» (udata)» 20» (line_strp)» (offset:·0x53 | 147 | ··92» (udata)» 20» (line_strp)» (offset:·0x53a):·modelsubst.h |
| 148 | ··93» (udata)» 20» (line_strp)» (offset:·0x54 | 148 | ··93» (udata)» 20» (line_strp)» (offset:·0x547):·rateheterogeneity.h |
| 149 | ··94» (udata)» 21» (line_strp)» (offset:·0x55 | 149 | ··94» (udata)» 21» (line_strp)» (offset:·0x55b):·modelsblock.h |
| Max diff block lines reached; 405734116/405748287 bytes (100.00%) of diff not shown. | |||
| Offset 1, 4194304 lines modified | Offset 1, 4194304 lines modified | ||
| 1 | Contents·of·the·.debug_info·section: | 1 | Contents·of·the·.debug_info·section: |
| 2 | ··Compilation·Unit·@·offset·0: | 2 | ··Compilation·Unit·@·offset·0: |
| 3 | ···Length:········0x14·(32-bit) | 3 | ···Length:········0x14·(32-bit) |
| 4 | ···Version:·······5 | 4 | ···Version:·······5 |
| 5 | ···Unit·Type:·····DW_UT_partial·(3) | 5 | ···Unit·Type:·····DW_UT_partial·(3) |
| 6 | ···Abbrev·Offset:·0 | 6 | ···Abbrev·Offset:·0 |
| 7 | ···Pointer·Size:··4 | 7 | ···Pointer·Size:··4 |
| 8 | ·<0><c>:·Abbrev·Number:· | 8 | ·<0><c>:·Abbrev·Number:·47·(DW_TAG_partial_unit) |
| 9 | ·<1><d>:·Abbrev·Number:· | 9 | ·<1><d>:·Abbrev·Number:·3·(DW_TAG_imported_unit) |
| 10 | ····<e>···DW_AT_import······:·(GNU_ref_alt)·<0xc> | 10 | ····<e>···DW_AT_import······:·(GNU_ref_alt)·<0xc> |
| 11 | ·<1><12>:·Abbrev·Number:· | 11 | ·<1><12>:·Abbrev·Number:·3·(DW_TAG_imported_unit) |
| 12 | ····<13>···DW_AT_import······:·(GNU_ref_alt)·<0x14555b6> | 12 | ····<13>···DW_AT_import······:·(GNU_ref_alt)·<0x14555b6> |
| 13 | ·<1><17>:·Abbrev·Number:·0 | 13 | ·<1><17>:·Abbrev·Number:·0 |
| 14 | ··Compilation·Unit·@·offset·0x18: | 14 | ··Compilation·Unit·@·offset·0x18: |
| 15 | ···Length:········0x14·(32-bit) | 15 | ···Length:········0x14·(32-bit) |
| 16 | ···Version:·······5 | 16 | ···Version:·······5 |
| 17 | ···Unit·Type:·····DW_UT_partial·(3) | 17 | ···Unit·Type:·····DW_UT_partial·(3) |
| 18 | ···Abbrev·Offset:·0 | 18 | ···Abbrev·Offset:·0 |
| 19 | ···Pointer·Size:··4 | 19 | ···Pointer·Size:··4 |
| 20 | ·<0><24>:·Abbrev·Number:· | 20 | ·<0><24>:·Abbrev·Number:·47·(DW_TAG_partial_unit) |
| 21 | ·<1><25>:·Abbrev·Number:· | 21 | ·<1><25>:·Abbrev·Number:·3·(DW_TAG_imported_unit) |
| 22 | ····<26>···DW_AT_import······:·(GNU_ref_alt)·<0xc> | 22 | ····<26>···DW_AT_import······:·(GNU_ref_alt)·<0xc> |
| 23 | ·<1><2a>:·Abbrev·Number:· | 23 | ·<1><2a>:·Abbrev·Number:·3·(DW_TAG_imported_unit) |
| 24 | ····<2b>···DW_AT_import······:·(GNU_ref_alt)·<0x14533a8> | 24 | ····<2b>···DW_AT_import······:·(GNU_ref_alt)·<0x14533a8> |
| 25 | ·<1><2f>:·Abbrev·Number:·0 | 25 | ·<1><2f>:·Abbrev·Number:·0 |
| 26 | ··Compilation·Unit·@·offset·0x30: | 26 | ··Compilation·Unit·@·offset·0x30: |
| 27 | ···Length:········0x14·(32-bit) | 27 | ···Length:········0x14·(32-bit) |
| 28 | ···Version:·······5 | 28 | ···Version:·······5 |
| 29 | ···Unit·Type:·····DW_UT_partial·(3) | 29 | ···Unit·Type:·····DW_UT_partial·(3) |
| 30 | ···Abbrev·Offset:·0 | 30 | ···Abbrev·Offset:·0 |
| 31 | ···Pointer·Size:··4 | 31 | ···Pointer·Size:··4 |
| 32 | ·<0><3c>:·Abbrev·Number:· | 32 | ·<0><3c>:·Abbrev·Number:·47·(DW_TAG_partial_unit) |
| 33 | ·<1><3d>:·Abbrev·Number:· | 33 | ·<1><3d>:·Abbrev·Number:·3·(DW_TAG_imported_unit) |
| 34 | ····<3e>···DW_AT_import······:·(GNU_ref_alt)·<0xc> | 34 | ····<3e>···DW_AT_import······:·(GNU_ref_alt)·<0xc> |
| 35 | ·<1><42>:·Abbrev·Number:· | 35 | ·<1><42>:·Abbrev·Number:·3·(DW_TAG_imported_unit) |
| 36 | ····<43>···DW_AT_import······:·(GNU_ref_alt)·<0x145564c> | 36 | ····<43>···DW_AT_import······:·(GNU_ref_alt)·<0x145564c> |
| 37 | ·<1><47>:·Abbrev·Number:·0 | 37 | ·<1><47>:·Abbrev·Number:·0 |
| 38 | ··Compilation·Unit·@·offset·0x48: | 38 | ··Compilation·Unit·@·offset·0x48: |
| 39 | ···Length:········0x14·(32-bit) | 39 | ···Length:········0x14·(32-bit) |
| 40 | ···Version:·······5 | 40 | ···Version:·······5 |
| 41 | ···Unit·Type:·····DW_UT_partial·(3) | 41 | ···Unit·Type:·····DW_UT_partial·(3) |
| 42 | ···Abbrev·Offset:·0 | 42 | ···Abbrev·Offset:·0 |
| 43 | ···Pointer·Size:··4 | 43 | ···Pointer·Size:··4 |
| 44 | ·<0><54>:·Abbrev·Number:· | 44 | ·<0><54>:·Abbrev·Number:·47·(DW_TAG_partial_unit) |
| 45 | ·<1><55>:·Abbrev·Number:· | 45 | ·<1><55>:·Abbrev·Number:·3·(DW_TAG_imported_unit) |
| 46 | ····<56>···DW_AT_import······:·(GNU_ref_alt)·<0xc> | 46 | ····<56>···DW_AT_import······:·(GNU_ref_alt)·<0xc> |
| 47 | ·<1><5a>:·Abbrev·Number:· | 47 | ·<1><5a>:·Abbrev·Number:·3·(DW_TAG_imported_unit) |
| 48 | ····<5b>···DW_AT_import······:·(GNU_ref_alt)·<0xb38e3> | 48 | ····<5b>···DW_AT_import······:·(GNU_ref_alt)·<0xb38e3> |
| 49 | ·<1><5f>:·Abbrev·Number:·0 | 49 | ·<1><5f>:·Abbrev·Number:·0 |
| 50 | ··Compilation·Unit·@·offset·0x60: | 50 | ··Compilation·Unit·@·offset·0x60: |
| 51 | ···Length:········0x14·(32-bit) | 51 | ···Length:········0x14·(32-bit) |
| 52 | ···Version:·······5 | 52 | ···Version:·······5 |
| 53 | ···Unit·Type:·····DW_UT_partial·(3) | 53 | ···Unit·Type:·····DW_UT_partial·(3) |
| 54 | ···Abbrev·Offset:·0 | 54 | ···Abbrev·Offset:·0 |
| 55 | ···Pointer·Size:··4 | 55 | ···Pointer·Size:··4 |
| 56 | ·<0><6c>:·Abbrev·Number:· | 56 | ·<0><6c>:·Abbrev·Number:·47·(DW_TAG_partial_unit) |
| 57 | ·<1><6d>:·Abbrev·Number:· | 57 | ·<1><6d>:·Abbrev·Number:·3·(DW_TAG_imported_unit) |
| 58 | ····<6e>···DW_AT_import······:·(GNU_ref_alt)·<0x14555b6> | 58 | ····<6e>···DW_AT_import······:·(GNU_ref_alt)·<0x14555b6> |
| 59 | ·<1><72>:·Abbrev·Number:· | 59 | ·<1><72>:·Abbrev·Number:·3·(DW_TAG_imported_unit) |
| 60 | ····<73>···DW_AT_import······:·(GNU_ref_alt)·<0x14533a8> | 60 | ····<73>···DW_AT_import······:·(GNU_ref_alt)·<0x14533a8> |
| 61 | ·<1><77>:·Abbrev·Number:·0 | 61 | ·<1><77>:·Abbrev·Number:·0 |
| 62 | ··Compilation·Unit·@·offset·0x78: | 62 | ··Compilation·Unit·@·offset·0x78: |
| 63 | ···Length:········0x14·(32-bit) | 63 | ···Length:········0x14·(32-bit) |
| 64 | ···Version:·······5 | 64 | ···Version:·······5 |
| 65 | ···Unit·Type:·····DW_UT_partial·(3) | 65 | ···Unit·Type:·····DW_UT_partial·(3) |
| 66 | ···Abbrev·Offset:·0 | 66 | ···Abbrev·Offset:·0 |
| 67 | ···Pointer·Size:··4 | 67 | ···Pointer·Size:··4 |
| 68 | ·<0><84>:·Abbrev·Number:· | 68 | ·<0><84>:·Abbrev·Number:·47·(DW_TAG_partial_unit) |
| 69 | ·<1><85>:·Abbrev·Number:· | 69 | ·<1><85>:·Abbrev·Number:·3·(DW_TAG_imported_unit) |
| 70 | ····<86>···DW_AT_import······:·(GNU_ref_alt)·<0x14533a8> | 70 | ····<86>···DW_AT_import······:·(GNU_ref_alt)·<0x14533a8> |
| 71 | ·<1><8a>:·Abbrev·Number:· | 71 | ·<1><8a>:·Abbrev·Number:·3·(DW_TAG_imported_unit) |
| 72 | ····<8b>···DW_AT_import······:·(GNU_ref_alt)·<0x1453358> | 72 | ····<8b>···DW_AT_import······:·(GNU_ref_alt)·<0x1453358> |
| 73 | ·<1><8f>:·Abbrev·Number:·0 | 73 | ·<1><8f>:·Abbrev·Number:·0 |
| 74 | ··Compilation·Unit·@·offset·0x90: | 74 | ··Compilation·Unit·@·offset·0x90: |
| 75 | ···Length:········0x14·(32-bit) | 75 | ···Length:········0x14·(32-bit) |
| 76 | ···Version:·······5 | 76 | ···Version:·······5 |
| 77 | ···Unit·Type:·····DW_UT_partial·(3) | 77 | ···Unit·Type:·····DW_UT_partial·(3) |
| 78 | ···Abbrev·Offset:·0 | 78 | ···Abbrev·Offset:·0 |
| 79 | ···Pointer·Size:··4 | 79 | ···Pointer·Size:··4 |
| 80 | ·<0><9c>:·Abbrev·Number:· | 80 | ·<0><9c>:·Abbrev·Number:·47·(DW_TAG_partial_unit) |
| 81 | ·<1><9d>:·Abbrev·Number:· | 81 | ·<1><9d>:·Abbrev·Number:·3·(DW_TAG_imported_unit) |
| 82 | ····<9e>···DW_AT_import······:·(GNU_ref_alt)·<0x14533a8> | 82 | ····<9e>···DW_AT_import······:·(GNU_ref_alt)·<0x14533a8> |
| 83 | ·<1><a2>:·Abbrev·Number:· | 83 | ·<1><a2>:·Abbrev·Number:·3·(DW_TAG_imported_unit) |
| 84 | ····<a3>···DW_AT_import······:·(GNU_ref_alt)·<0x1453338> | 84 | ····<a3>···DW_AT_import······:·(GNU_ref_alt)·<0x1453338> |
| 85 | ·<1><a7>:·Abbrev·Number:·0 | 85 | ·<1><a7>:·Abbrev·Number:·0 |
| 86 | ··Compilation·Unit·@·offset·0xa8: | 86 | ··Compilation·Unit·@·offset·0xa8: |
| 87 | ···Length:········0x14·(32-bit) | 87 | ···Length:········0x14·(32-bit) |
| 88 | ···Version:·······5 | 88 | ···Version:·······5 |
| 89 | ···Unit·Type:·····DW_UT_partial·(3) | 89 | ···Unit·Type:·····DW_UT_partial·(3) |
| 90 | ···Abbrev·Offset:·0 | 90 | ···Abbrev·Offset:·0 |
| 91 | ···Pointer·Size:··4 | 91 | ···Pointer·Size:··4 |
| 92 | ·<0><b4>:·Abbrev·Number:· | 92 | ·<0><b4>:·Abbrev·Number:·47·(DW_TAG_partial_unit) |
| 93 | ·<1><b5>:·Abbrev·Number:· | 93 | ·<1><b5>:·Abbrev·Number:·3·(DW_TAG_imported_unit) |
| 94 | ····<b6>···DW_AT_import······:·(GNU_ref_alt)·<0x1453358> | 94 | ····<b6>···DW_AT_import······:·(GNU_ref_alt)·<0x1453358> |
| 95 | ·<1><ba>:·Abbrev·Number:· | 95 | ·<1><ba>:·Abbrev·Number:·3·(DW_TAG_imported_unit) |
| 96 | ····<bb>···DW_AT_import······:·(GNU_ref_alt)·<0x1453338> | 96 | ····<bb>···DW_AT_import······:·(GNU_ref_alt)·<0x1453338> |
| 97 | ·<1><bf>:·Abbrev·Number:·0 | 97 | ·<1><bf>:·Abbrev·Number:·0 |
| 98 | ··Compilation·Unit·@·offset·0xc0: | 98 | ··Compilation·Unit·@·offset·0xc0: |
| 99 | ···Length:········0x14·(32-bit) | 99 | ···Length:········0x14·(32-bit) |
| 100 | ···Version:·······5 | 100 | ···Version:·······5 |
| 101 | ···Unit·Type:·····DW_UT_partial·(3) | 101 | ···Unit·Type:·····DW_UT_partial·(3) |
| 102 | ···Abbrev·Offset:·0 | 102 | ···Abbrev·Offset:·0 |
| 103 | ···Pointer·Size:··4 | 103 | ···Pointer·Size:··4 |
| 104 | ·<0><cc>:·Abbrev·Number:· | 104 | ·<0><cc>:·Abbrev·Number:·47·(DW_TAG_partial_unit) |
| 105 | ·<1><cd>:·Abbrev·Number:· | 105 | ·<1><cd>:·Abbrev·Number:·3·(DW_TAG_imported_unit) |
| 106 | ····<ce>···DW_AT_import······:·(GNU_ref_alt)·<0x1453358> | 106 | ····<ce>···DW_AT_import······:·(GNU_ref_alt)·<0x1453358> |
| 107 | ·<1><d2>:·Abbrev·Number:· | 107 | ·<1><d2>:·Abbrev·Number:·3·(DW_TAG_imported_unit) |
| 108 | ····<d3>···DW_AT_import······:·(GNU_ref_alt)·<0xb38e3> | 108 | ····<d3>···DW_AT_import······:·(GNU_ref_alt)·<0xb38e3> |
| 109 | ·<1><d7>:·Abbrev·Number:·0 | 109 | ·<1><d7>:·Abbrev·Number:·0 |
| 110 | ··Compilation·Unit·@·offset·0xd8: | 110 | ··Compilation·Unit·@·offset·0xd8: |
| 111 | ···Length:········0x1e·(32-bit) | 111 | ···Length:········0x1e·(32-bit) |
| 112 | ···Version:·······5 | 112 | ···Version:·······5 |
| 113 | ···Unit·Type:·····DW_UT_partial·(3) | 113 | ···Unit·Type:·····DW_UT_partial·(3) |
| 114 | ···Abbrev·Offset:·0 | 114 | ···Abbrev·Offset:·0 |
| 115 | ···Pointer·Size:··4 | 115 | ···Pointer·Size:··4 |
| 116 | ·<0><e4>:·Abbrev·Number:· | 116 | ·<0><e4>:·Abbrev·Number:·47·(DW_TAG_partial_unit) |
| 117 | ·<1><e5>:·Abbrev·Number:· | 117 | ·<1><e5>:·Abbrev·Number:·3·(DW_TAG_imported_unit) |
| 118 | ····<e6>···DW_AT_import······:·(GNU_ref_alt)·<0x1453338> | 118 | ····<e6>···DW_AT_import······:·(GNU_ref_alt)·<0x1453338> |
| 119 | ·<1><ea>:·Abbrev·Number:· | 119 | ·<1><ea>:·Abbrev·Number:·3·(DW_TAG_imported_unit) |
| 120 | ····<eb>···DW_AT_import······:·(GNU_ref_alt)·<0xb38e3> | 120 | ····<eb>···DW_AT_import······:·(GNU_ref_alt)·<0xb38e3> |
| 121 | ·<1><ef>:·Abbrev·Number:· | 121 | ·<1><ef>:·Abbrev·Number:·1·(DW_TAG_imported_unit) |
| 122 | ····<f0>···DW_AT_import······:·(ref_addr)·<0xc>» [Abbrev·Number:· | 122 | ····<f0>···DW_AT_import······:·(ref_addr)·<0xc>» [Abbrev·Number:·47·(DW_TAG_partial_unit)] |
| 123 | ·<1><f4>:·Abbrev·Number:· | 123 | ·<1><f4>:·Abbrev·Number:·1·(DW_TAG_imported_unit) |
| 124 | ····<f5>···DW_AT_import······:·(ref_addr)·<0x84>» [Abbrev·Number:· | 124 | ····<f5>···DW_AT_import······:·(ref_addr)·<0x84>» [Abbrev·Number:·47·(DW_TAG_partial_unit)] |
| 125 | ·<1><f9>:·Abbrev·Number:·0 | 125 | ·<1><f9>:·Abbrev·Number:·0 |
| 126 | ··Compilation·Unit·@·offset·0xfa: | 126 | ··Compilation·Unit·@·offset·0xfa: |
| Max diff block lines reached; 463085734/463092862 bytes (100.00%) of diff not shown. | |||
| Offset 1, 929 lines modified | Offset 1, 595 lines modified | ||
| 1 | Contents·of·the·.debug_abbrev·section: | 1 | Contents·of·the·.debug_abbrev·section: |
| 2 | ··Number·TAG·(0) | 2 | ··Number·TAG·(0) |
| 3 | ···1······DW_TAG_subprogram····[has·children] | ||
| 4 | ····DW_AT_specification·DW_FORM_ref1 | ||
| 5 | ····DW_AT_inline·······DW_FORM_data1 | ||
| 6 | ····DW_AT·value:·0·····DW_FORM·value:·0 | ||
| 7 | ··· | 3 | ···1······DW_TAG_imported_unit····[no·children] |
| 8 | ····DW_AT_byte_size····DW_FORM_implicit_const:·4 | ||
| 9 | ····DW_AT_ | 4 | ····DW_AT_import·······DW_FORM_ref_addr |
| 10 | ····DW_AT·value:·0·····DW_FORM·value:·0 | ||
| 11 | ···3······DW_TAG_variable····[no·children] | ||
| 12 | ····DW_AT_name·········DW_FORM_GNU_strp_alt | ||
| 13 | ····DW_AT_decl_file····DW_FORM_data1 | ||
| 14 | ····DW_AT_decl_line····DW_FORM_data2 | ||
| 15 | ····DW_AT_decl_column··DW_FORM_data1 | ||
| 16 | ····DW_AT_type·········DW_FORM_ref1 | ||
| 17 | ····DW_AT_external·····DW_FORM_flag_present | ||
| 18 | ····DW_AT_declaration··DW_FORM_flag_present | ||
| 19 | ····DW_AT·value:·0·····DW_FORM·value:·0 | 5 | ····DW_AT·value:·0·····DW_FORM·value:·0 |
| 20 | ··· | 6 | ···2······DW_TAG_subprogram····[has·children] |
| 21 | ····DW_AT_external·····DW_FORM_flag_present | 7 | ····DW_AT_external·····DW_FORM_flag_present |
| 22 | ····DW_AT_name·········DW_FORM_GNU_strp_alt | 8 | ····DW_AT_name·········DW_FORM_GNU_strp_alt |
| 23 | ····DW_AT_decl_file····DW_FORM_data1 | 9 | ····DW_AT_decl_file····DW_FORM_data1 |
| 24 | ····DW_AT_decl_line····DW_FORM_data | 10 | ····DW_AT_decl_line····DW_FORM_data2 |
| 25 | ····DW_AT_decl_column··DW_FORM_data1 | 11 | ····DW_AT_decl_column··DW_FORM_data1 |
| 26 | ····DW_AT_linkage_name·DW_FORM_GNU_strp_alt | 12 | ····DW_AT_linkage_name·DW_FORM_GNU_strp_alt |
| 27 | ····DW_AT_type·········DW_FORM_ref | 13 | ····DW_AT_type·········DW_FORM_GNU_ref_alt |
| 28 | ····DW_AT_ | 14 | ····DW_AT_inline·······DW_FORM_implicit_const:·3 |
| 29 | ····DW_AT·value:·0·····DW_FORM·value:·0 | 15 | ····DW_AT·value:·0·····DW_FORM·value:·0 |
| 16 | ···3······DW_TAG_imported_unit····[no·children] | ||
| 17 | ····DW_AT_import·······DW_FORM_GNU_ref_alt | ||
| 18 | ····DW_AT·value:·0·····DW_FORM·value:·0 | ||
| 30 | ··· | 19 | ···4······DW_TAG_partial_unit····[has·children] |
| 31 | ····DW_AT_stmt_list····DW_FORM_sec_offset | 20 | ····DW_AT_stmt_list····DW_FORM_sec_offset |
| 32 | ····DW_AT_comp_dir·····DW_FORM_line_strp | 21 | ····DW_AT_comp_dir·····DW_FORM_line_strp |
| 33 | ····DW_AT·value:·0·····DW_FORM·value:·0 | 22 | ····DW_AT·value:·0·····DW_FORM·value:·0 |
| 34 | ··· | 23 | ···5······DW_TAG_formal_parameter····[no·children] |
| 24 | ····DW_AT_name·········DW_FORM_GNU_strp_alt | ||
| 25 | ····DW_AT_decl_file····DW_FORM_data1 | ||
| 26 | ····DW_AT_decl_line····DW_FORM_data2 | ||
| 27 | ····DW_AT_decl_column··DW_FORM_data1 | ||
| 35 | ····DW_AT_type·········DW_FORM_GNU_ref_alt | 28 | ····DW_AT_type·········DW_FORM_GNU_ref_alt |
| 36 | ····DW_AT·value:·0·····DW_FORM·value:·0 | 29 | ····DW_AT·value:·0·····DW_FORM·value:·0 |
| 37 | ··· | 30 | ···6······DW_TAG_formal_parameter····[no·children] |
| 38 | ····DW_AT_name·········DW_FORM_string | ||
| 39 | ····DW_AT_type·········DW_FORM_ref1 | ||
| 40 | ····DW_AT·value:·0·····DW_FORM·value:·0 | ||
| 41 | ···8······DW_TAG_const_type····[no·children] | ||
| 42 | ····DW_AT_type·········DW_FORM_ref1 | ||
| 43 | ····DW_AT·value:·0·····DW_FORM·value:·0 | ||
| 44 | ···9······DW_TAG_enumeration_type····[has·children] | ||
| 45 | ····DW_AT_name·········DW_FORM_GNU_strp_alt | ||
| 46 | ····DW_AT_encoding·····DW_FORM_implicit_const:·7 | ||
| 47 | ····DW_AT_byte_size····DW_FORM_implicit_const:·4 | ||
| 48 | ····DW_AT_type·········DW_FORM_GNU_ref_alt | 31 | ····DW_AT_type·········DW_FORM_GNU_ref_alt |
| 49 | ····DW_AT_decl_file····DW_FORM_implicit_const:·33 | ||
| 50 | ····DW_AT_decl_line····DW_FORM_data2 | ||
| 51 | ····DW_AT_decl_column··DW_FORM_implicit_const:·6 | ||
| 52 | ····DW_AT_sibling······DW_FORM_ref1 | ||
| 53 | ····DW_AT·value:·0·····DW_FORM·value:·0 | 32 | ····DW_AT·value:·0·····DW_FORM·value:·0 |
| 33 | ···7······DW_TAG_unspecified_parameters····[no·children] | ||
| 54 | ···10······DW_TAG_enumerator····[no·children] | ||
| 55 | ····DW_AT_name·········DW_FORM_GNU_strp_alt | ||
| 56 | ····DW_AT_const_value··DW_FORM_data1 | ||
| 57 | ····DW_AT·value:·0·····DW_FORM·value:·0 | 34 | ····DW_AT·value:·0·····DW_FORM·value:·0 |
| 58 | ··· | 35 | ···8······DW_TAG_subprogram····[has·children] |
| 36 | ····DW_AT_external·····DW_FORM_flag_present | ||
| 59 | ····DW_AT_name·········DW_FORM_str | 37 | ····DW_AT_name·········DW_FORM_GNU_strp_alt |
| 60 | ····DW_AT_decl_file····DW_FORM_data1 | 38 | ····DW_AT_decl_file····DW_FORM_data1 |
| 61 | ····DW_AT_decl_line····DW_FORM_data1 | 39 | ····DW_AT_decl_line····DW_FORM_data1 |
| 62 | ····DW_AT_decl_column··DW_FORM_data1 | 40 | ····DW_AT_decl_column··DW_FORM_data1 |
| 63 | ····DW_AT_ | 41 | ····DW_AT_linkage_name·DW_FORM_GNU_strp_alt |
| 42 | ····DW_AT_noreturn·····DW_FORM_flag_present | ||
| 43 | ····DW_AT_declaration··DW_FORM_flag_present | ||
| 64 | ····DW_AT·value:·0·····DW_FORM·value:·0 | 44 | ····DW_AT·value:·0·····DW_FORM·value:·0 |
| 45 | ···9······DW_TAG_namespace····[has·children] | ||
| 65 | ···12······DW_TAG_reference_type····[no·children] | ||
| 66 | ····DW_AT_byte_size····DW_FORM_implicit_const:·4 | ||
| 67 | ····DW_AT_ | 46 | ····DW_AT_name·········DW_FORM_string |
| 68 | ····DW_AT·value:·0·····DW_FORM·value:·0 | 47 | ····DW_AT·value:·0·····DW_FORM·value:·0 |
| 69 | ···1 | 48 | ···10······DW_TAG_subprogram····[has·children] |
| 70 | ····DW_AT_external·····DW_FORM_flag_present | 49 | ····DW_AT_external·····DW_FORM_flag_present |
| 71 | ····DW_AT_name·········DW_FORM_GNU_strp_alt | 50 | ····DW_AT_name·········DW_FORM_GNU_strp_alt |
| 72 | ····DW_AT_decl_file····DW_FORM_data1 | 51 | ····DW_AT_decl_file····DW_FORM_data1 |
| 73 | ····DW_AT_decl_line····DW_FORM_data2 | 52 | ····DW_AT_decl_line····DW_FORM_data2 |
| 74 | ····DW_AT_decl_column··DW_FORM_data1 | 53 | ····DW_AT_decl_column··DW_FORM_data1 |
| 75 | ····DW_AT_ | 54 | ····DW_AT_type·········DW_FORM_GNU_ref_alt |
| 76 | ····DW_AT_declaration··DW_FORM_flag_present | 55 | ····DW_AT_declaration··DW_FORM_flag_present |
| 77 | ····DW_AT_sibling······DW_FORM_ref1 | ||
| 78 | ····DW_AT·value:·0·····DW_FORM·value:·0 | ||
| 79 | ···14······DW_TAG_formal_parameter····[no·children] | ||
| 80 | ····DW_AT_type·········DW_FORM_ref1 | ||
| 81 | ····DW_AT·value:·0·····DW_FORM·value:·0 | 56 | ····DW_AT·value:·0·····DW_FORM·value:·0 |
| 82 | ···1 | 57 | ···11······DW_TAG_namespace····[has·children] |
| 83 | ····DW_AT_name·········DW_FORM_string | 58 | ····DW_AT_name·········DW_FORM_string |
| 84 | ····DW_AT_sibling······DW_FORM_ref | 59 | ····DW_AT_sibling······DW_FORM_ref_udata |
| 85 | ····DW_AT·value:·0·····DW_FORM·value:·0 | 60 | ····DW_AT·value:·0·····DW_FORM·value:·0 |
| 86 | ···1 | 61 | ···12······DW_TAG_imported_declaration····[no·children] |
| 62 | ····DW_AT_decl_file····DW_FORM_data1 | ||
| 87 | ····DW_AT_name·········DW_FORM_GNU_strp_alt | ||
| 88 | ····DW_AT_decl_file····DW_FORM_implicit_const:·258 | ||
| 89 | ····DW_AT_decl_line····DW_FORM_data1 | 63 | ····DW_AT_decl_line····DW_FORM_data1 |
| 90 | ····DW_AT_decl_column··DW_FORM_ | 64 | ····DW_AT_decl_column··DW_FORM_data1 |
| 91 | ····DW_AT_ | 65 | ····DW_AT_import·······DW_FORM_ref_udata |
| 92 | ····DW_AT_declaration··DW_FORM_flag_present | ||
| 93 | ····DW_AT·value:·0·····DW_FORM·value:·0 | 66 | ····DW_AT·value:·0·····DW_FORM·value:·0 |
| 94 | ···1 | 67 | ···13······DW_TAG_subprogram····[has·children] |
| 68 | ····DW_AT_external·····DW_FORM_flag_present | ||
| 95 | ····DW_AT_name·········DW_FORM_GNU_strp_alt | 69 | ····DW_AT_name·········DW_FORM_GNU_strp_alt |
| 96 | ····DW_AT_decl_file····DW_FORM_ | 70 | ····DW_AT_decl_file····DW_FORM_data1 |
| 97 | ····DW_AT_decl_line····DW_FORM_data1 | 71 | ····DW_AT_decl_line····DW_FORM_data1 |
| 98 | ····DW_AT_decl_column··DW_FORM_ | 72 | ····DW_AT_decl_column··DW_FORM_data1 |
| 99 | ····DW_AT_type·········DW_FORM_GNU_ref_alt | 73 | ····DW_AT_type·········DW_FORM_GNU_ref_alt |
| 100 | ····DW_AT_ | 74 | ····DW_AT_declaration··DW_FORM_flag_present |
| 101 | ····DW_AT·value:·0·····DW_FORM·value:·0 | 75 | ····DW_AT·value:·0·····DW_FORM·value:·0 |
| 102 | ···1 | 76 | ···14······DW_TAG_enumerator····[no·children] |
| 103 | ····DW_AT_name·········DW_FORM_GNU_strp_alt | 77 | ····DW_AT_name·········DW_FORM_GNU_strp_alt |
| 104 | ····DW_AT_decl_file····DW_FORM_implicit_const:·2 | ||
| 105 | ····DW_AT_decl_line····DW_FORM_data1 | ||
| 106 | ····DW_AT_decl_column··DW_FORM_implicit_const:·15 | ||
| 107 | ····DW_AT_type·········DW_FORM_GNU_ref_alt | ||
| 108 | ····DW_AT_const_expr···DW_FORM_flag_present | ||
| 109 | ····DW_AT_const_value··DW_FORM_data1 | 78 | ····DW_AT_const_value··DW_FORM_data1 |
| 110 | ····DW_AT·value:·0·····DW_FORM·value:·0 | 79 | ····DW_AT·value:·0·····DW_FORM·value:·0 |
| 80 | ···15······DW_TAG_enumeration_type····[has·children] | ||
| 81 | ····DW_AT_encoding·····DW_FORM_data1 | ||
| Max diff block lines reached; 2950078/2957331 bytes (99.75%) of diff not shown. | |||
| Offset 1, 5198 lines modified | Offset 1, 5203 lines modified | ||
| 1 | Contents·of·the·.debug_aranges·section: | 1 | Contents·of·the·.debug_aranges·section: |
| 2 | ··Length:···················44 | 2 | ··Length:···················44 |
| 3 | ··Version:··················2 | 3 | ··Version:··················2 |
| 4 | ··Offset·into·.debug_info:··0x2 | 4 | ··Offset·into·.debug_info:··0x237a8 |
| 5 | ··Pointer·Size:·············4 | 5 | ··Pointer·Size:·············4 |
| 6 | ··Segment·Size:·············0 | 6 | ··Segment·Size:·············0 |
| 7 | ····Address····Length | 7 | ····Address····Length |
| 8 | ····000e | 8 | ····000e8610·000003f7 |
| 9 | ····00081 | 9 | ····00081380·000000b6 |
| 10 | ····000e8 | 10 | ····000e8a10·00000006 |
| 11 | ····00000000·00000000 | 11 | ····00000000·00000000 |
| 12 | ··Length:···················1164 | 12 | ··Length:···················1164 |
| 13 | ··Version:··················2 | 13 | ··Version:··················2 |
| 14 | ··Offset·into·.debug_info:··0x2 | 14 | ··Offset·into·.debug_info:··0x25858 |
| 15 | ··Pointer·Size:·············4 | 15 | ··Pointer·Size:·············4 |
| 16 | ··Segment·Size:·············0 | 16 | ··Segment·Size:·············0 |
| 17 | ····Address····Length | 17 | ····Address····Length |
| 18 | ····000e8 | 18 | ····000e8a40·00037e03 |
| 19 | ····00081 | 19 | ····0008180a·00008ad9 |
| 20 | ····000e8 | 20 | ····000e8a10·00000006 |
| 21 | ····00120 | 21 | ····00120850·00000003 |
| 22 | ····00120 | 22 | ····00120860·0000000b |
| 23 | ····00120 | 23 | ····00120870·00000001 |
| 24 | ····00120 | 24 | ····00120880·00000001 |
| 25 | ····00120 | 25 | ····00120890·00000001 |
| 26 | ····00120 | 26 | ····001208a0·00000001 |
| 27 | ····00120 | 27 | ····001208b0·000000ab |
| 28 | ····00120 | 28 | ····00120960·00000026 |
| 29 | ····00120 | 29 | ····00120990·00000030 |
| 30 | ····00120 | 30 | ····001209c0·00000067 |
| 31 | ····00120 | 31 | ····00120b10·00000026 |
| 32 | ····00120 | 32 | ····00120b40·00000030 |
| 33 | ····00120 | 33 | ····00120b70·00000026 |
| 34 | ····00120 | 34 | ····00120ba0·00000030 |
| 35 | ····00120 | 35 | ····00120c00·00000234 |
| 36 | ····00120 | 36 | ····00120e40·000008b3 |
| 37 | ····00081 | 37 | ····00081436·000000f1 |
| 38 | ····00081 | 38 | ····00081528·000000f1 |
| 39 | ····00081 | 39 | ····0008161a·000000f7 |
| 40 | ····00081 | 40 | ····00081712·000000f7 |
| 41 | ····0012 | 41 | ····00121700·00000013 |
| 42 | ····0012 | 42 | ····00121720·00000073 |
| 43 | ····00121 | 43 | ····001217a0·0000006e |
| 44 | ····00120 | 44 | ····00120a30·0000006c |
| 45 | ····00120 | 45 | ····00120aa0·00000064 |
| 46 | ····00121 | 46 | ····00121810·00000078 |
| 47 | ····00121 | 47 | ····00121890·0000005d |
| 48 | ····00121 | 48 | ····001219b0·0000005d |
| 49 | ····00121390·00000063 | ||
| 50 | ····00121400·00000065 | ||
| 51 | ····001214e0·00000063 | ||
| 52 | ····00121550·00000065 | ||
| 53 | ····001211b0·0000005b | ||
| 54 | ····00121210·0000005d | ||
| 55 | ····001212d0·0000005b | ||
| 56 | ····00121330·0000005d | ||
| 57 | ····00121470·00000065 | ||
| 58 | ····001215c0·00000065 | ||
| 59 | ····00121630·0000006c | ||
| 60 | ····00121780·0000006c | ||
| 61 | ····00121 | 49 | ····00121ad0·00000063 |
| 62 | ····00121a20·00000063 | ||
| 63 | ····001216a0·0000006d | ||
| 64 | ····00121710·0000006f | ||
| 65 | ····001217f0·0000006d | ||
| 66 | ····00121860·0000006f | ||
| 67 | ····00121 | 50 | ····00121b40·00000065 |
| 68 | ····00121 | 51 | ····00121c20·00000063 |
| 69 | ····00121 | 52 | ····00121c90·00000065 |
| 53 | ····001218f0·0000005b | ||
| 54 | ····00121950·0000005d | ||
| 55 | ····00121a10·0000005b | ||
| 56 | ····00121a70·0000005d | ||
| 70 | ····00121b | 57 | ····00121bb0·00000065 |
| 71 | ····00121b70·00000121 | ||
| 72 | ····00121ca0·00000129 | ||
| 73 | ····00121d | 58 | ····00121d00·00000065 |
| 74 | ····00121 | 59 | ····00121d70·0000006c |
| 60 | ····00121ec0·0000006c | ||
| 61 | ····00122010·00000063 | ||
| 62 | ····00122160·00000063 | ||
| 63 | ····00121de0·0000006d | ||
| 64 | ····00121e50·0000006f | ||
| 65 | ····00121f30·0000006d | ||
| 75 | ····00121f | 66 | ····00121fa0·0000006f |
| 67 | ····00122080·00000065 | ||
| 68 | ····001220f0·00000067 | ||
| 69 | ····001221d0·00000065 | ||
| 70 | ····00122240·00000067 | ||
| 71 | ····001222b0·00000121 | ||
| 72 | ····001223e0·00000129 | ||
| 73 | ····00122510·000000f4 | ||
| 74 | ····00122610·00000114 | ||
| 75 | ····00122730·0000009f | ||
| 76 | ····0008a | 76 | ····0008a2e3·00000036 |
| 77 | ····00122 | 77 | ····001227d0·00000046 |
| 78 | ····00122 | 78 | ····00122820·000003e1 |
| 79 | ····00122 | 79 | ····00122c10·000002df |
| 80 | ····00122 | 80 | ····00122ef0·000000bc |
| 81 | ····00122 | 81 | ····00122fb0·000000a0 |
| 82 | ····0012 | 82 | ····00123050·000001a2 |
| 83 | ····0012 | 83 | ····00123200·00000005 |
| 84 | ····0012 | 84 | ····00123210·00000082 |
| 85 | ····0012 | 85 | ····001232a0·000000e9 |
| 86 | ····0012 | 86 | ····00123390·00000053 |
| 87 | ····0012 | 87 | ····001233f0·0000005a |
| 88 | ····0012 | 88 | ····00123450·0000004e |
| 89 | ····0012 | 89 | ····001234a0·00000088 |
| 90 | ····0012 | 90 | ····00123530·00000057 |
| 91 | ····0012 | 91 | ····00123590·00000205 |
| 92 | ····00123 | 92 | ····001237a0·00000173 |
| 93 | ····00123 | 93 | ····00123920·0000008f |
| 94 | ····00123 | 94 | ····001239b0·000000c3 |
| 95 | ····00123340·0000002c | ||
| 96 | ····00123370·0000002c | ||
| 97 | ····00123 | 95 | ····00123a80·0000002c |
| 96 | ····00123ab0·0000002c | ||
| 97 | ····00123ae0·0000002c | ||
| 98 | ····00123 | 98 | ····00123b10·0000038e |
| 99 | ····00123 | 99 | ····00123ea0·00000029 |
| 100 | ····00123 | 100 | ····00123ed0·0000010a |
| 101 | ····00123 | 101 | ····00123fe0·00000117 |
| 102 | ····001239c0·00000117 | ||
| 103 | ····00123ae0·00000111 | ||
| Max diff block lines reached; 206105/213382 bytes (96.59%) of diff not shown. | |||
| Offset 10, 527 lines modified | Offset 10, 527 lines modified | ||
| 10 | ····Offset···Begin············End··············Expression | 10 | ····Offset···Begin············End··············Expression |
| 11 | ····0000000c·v0000000·v0000000·location·view·pair | 11 | ····0000000c·v0000000·v0000000·location·view·pair |
| 12 | ····0000000e·v0000000·v0000000·location·view·pair | 12 | ····0000000e·v0000000·v0000000·location·view·pair |
| 13 | ····00000010·v0000000·v0000000·location·view·pair | 13 | ····00000010·v0000000·v0000000·location·view·pair |
| 14 | ····00000012·v0000000·v0000000·views·at·0000000c·for: | 14 | ····00000012·v0000000·v0000000·views·at·0000000c·for: |
| 15 | ·············000e | 15 | ·············000e8610·000e8a07·(DW_OP_fbreg:·0) |
| 16 | ····0000001c·00081 | 16 | ····0000001c·00081380·(base·address) |
| 17 | ····00000021·v0000000·v0000000·views·at·0000000e·for: | 17 | ····00000021·v0000000·v0000000·views·at·0000000e·for: |
| 18 | ·············00081 | 18 | ·············00081380·000813e9·(DW_OP_fbreg:·0) |
| 19 | ····00000027·v0000000·v0000000·views·at·00000010·for: | 19 | ····00000027·v0000000·v0000000·views·at·00000010·for: |
| 20 | ·············00081 | 20 | ·············000813ee·00081436·(DW_OP_fbreg:·0) |
| 21 | ····0000002e·<End·of·list> | 21 | ····0000002e·<End·of·list> |
| 22 | ····0000002f·v0000000·v0000000·location·view·pair | 22 | ····0000002f·v0000000·v0000000·location·view·pair |
| 23 | ····00000031·v0000000·v0000000·location·view·pair | 23 | ····00000031·v0000000·v0000000·location·view·pair |
| 24 | ····00000033·v0000000·v0000000·location·view·pair | 24 | ····00000033·v0000000·v0000000·location·view·pair |
| 25 | ····00000035·v0000000·v0000000·location·view·pair | 25 | ····00000035·v0000000·v0000000·location·view·pair |
| 26 | ····00000037·v0000000·v0000000·location·view·pair | 26 | ····00000037·v0000000·v0000000·location·view·pair |
| 27 | ····00000039·000e8 | 27 | ····00000039·000e8746·(base·address) |
| 28 | ····0000003e·v0000000·v0000000·views·at·0000002f·for: | 28 | ····0000003e·v0000000·v0000000·views·at·0000002f·for: |
| 29 | ·············000e8 | 29 | ·············000e8746·000e874c·(DW_OP_reg0·(eax)) |
| 30 | ····00000043·v0000000·v0000000·views·at·00000031·for: | 30 | ····00000043·v0000000·v0000000·views·at·00000031·for: |
| 31 | ·············000e8 | 31 | ·············000e874c·000e87f8·(DW_OP_fbreg:·-4016) |
| 32 | ····0000004b·v0000000·v0000000·views·at·00000033·for: | 32 | ····0000004b·v0000000·v0000000·views·at·00000033·for: |
| 33 | ·············000e8 | 33 | ·············000e88e3·000e8943·(DW_OP_fbreg:·-4016) |
| 34 | ····00000054·00081 | 34 | ····00000054·000813ee·(base·address) |
| 35 | ····00000059·v0000000·v0000000·views·at·00000035·for: | 35 | ····00000059·v0000000·v0000000·views·at·00000035·for: |
| 36 | ·············00081 | 36 | ·············000813ee·000813ff·(DW_OP_fbreg:·-4016) |
| 37 | ····00000060·v0000000·v0000000·views·at·00000037·for: | 37 | ····00000060·v0000000·v0000000·views·at·00000037·for: |
| 38 | ·············00081 | 38 | ·············00081427·0008142c·(DW_OP_fbreg:·-4016) |
| 39 | ····00000067·<End·of·list> | 39 | ····00000067·<End·of·list> |
| 40 | ····00000068·v0000000·v0000000·location·view·pair | 40 | ····00000068·v0000000·v0000000·location·view·pair |
| 41 | ····0000006a·v0000000·v0000000·views·at·00000068·for: | 41 | ····0000006a·v0000000·v0000000·views·at·00000068·for: |
| 42 | ·············000e8 | 42 | ·············000e87c1·000e87c7·(DW_OP_fbreg:·-4020) |
| 43 | ····00000074·<End·of·list> | 43 | ····00000074·<End·of·list> |
| 44 | ····00000075·v0000003·v0000002·location·view·pair | 44 | ····00000075·v0000003·v0000002·location·view·pair |
| 45 | ····00000077·v0000003·v0000002·views·at·00000075·for: | 45 | ····00000077·v0000003·v0000002·views·at·00000075·for: |
| 46 | ·············000e | 46 | ·············000e865a·000e8671·(DW_OP_implicit_pointer:·<0x25852>·0) |
| 47 | ····00000084·<End·of·list> | 47 | ····00000084·<End·of·list> |
| 48 | ····00000085·v0000000·v0000003·location·view·pair | 48 | ····00000085·v0000000·v0000003·location·view·pair |
| 49 | ····00000087·v0000000·v0000003·views·at·00000085·for: | 49 | ····00000087·v0000000·v0000003·views·at·00000085·for: |
| 50 | ·············000e | 50 | ·············000e865a·000e865a·(DW_OP_implicit_pointer:·<0x25852>·0) |
| 51 | ····00000094·<End·of·list> | 51 | ····00000094·<End·of·list> |
| 52 | ····00000095·v0000003·v0000002·location·view·pair | 52 | ····00000095·v0000003·v0000002·location·view·pair |
| 53 | ····00000097·v0000003·v0000002·views·at·00000095·for: | 53 | ····00000097·v0000003·v0000002·views·at·00000095·for: |
| 54 | ·············000e | 54 | ·············000e865a·000e8671·(DW_OP_reg7·(edi)) |
| 55 | ····0000009f·<End·of·list> | 55 | ····0000009f·<End·of·list> |
| 56 | ····000000a0·v0000005·v0000002·location·view·pair | 56 | ····000000a0·v0000005·v0000002·location·view·pair |
| 57 | ····000000a2·v0000005·v0000002·views·at·000000a0·for: | 57 | ····000000a2·v0000005·v0000002·views·at·000000a0·for: |
| 58 | ·············000e | 58 | ·············000e865a·000e8671·(DW_OP_lit0;·DW_OP_stack_value) |
| 59 | ····000000ab·<End·of·list> | 59 | ····000000ab·<End·of·list> |
| 60 | ····000000ac·v0000005·v0000006·location·view·pair | 60 | ····000000ac·v0000005·v0000006·location·view·pair |
| 61 | ····000000ae·v0000005·v0000006·views·at·000000ac·for: | 61 | ····000000ae·v0000005·v0000006·views·at·000000ac·for: |
| 62 | ·············000e | 62 | ·············000e865a·000e865a·(DW_OP_implicit_pointer:·<0x24f56>·0) |
| 63 | ····000000bb·<End·of·list> | 63 | ····000000bb·<End·of·list> |
| 64 | ····000000bc·v0000005·v0000006·location·view·pair | 64 | ····000000bc·v0000005·v0000006·location·view·pair |
| 65 | ····000000be·v0000005·v0000006·views·at·000000bc·for: | 65 | ····000000be·v0000005·v0000006·views·at·000000bc·for: |
| 66 | ·············000e | 66 | ·············000e865a·000e865a·(DW_OP_reg7·(edi)) |
| 67 | ····000000c6·<End·of·list> | 67 | ····000000c6·<End·of·list> |
| 68 | ····000000c7·v0000006·v0000000·location·view·pair | 68 | ····000000c7·v0000006·v0000000·location·view·pair |
| 69 | ····000000c9·v0000006·v0000000·views·at·000000c7·for: | 69 | ····000000c9·v0000006·v0000000·views·at·000000c7·for: |
| 70 | ·············000e | 70 | ·············000e865a·000e8671·(DW_OP_reg7·(edi)) |
| 71 | ····000000d1·<End·of·list> | 71 | ····000000d1·<End·of·list> |
| 72 | ····000000d2·v0000006·v0000000·location·view·pair | 72 | ····000000d2·v0000006·v0000000·location·view·pair |
| 73 | ····000000d4·v0000006·v0000000·views·at·000000d2·for: | 73 | ····000000d4·v0000006·v0000000·views·at·000000d2·for: |
| 74 | ·············000e | 74 | ·············000e865a·000e8671·(DW_OP_lit0;·DW_OP_stack_value) |
| 75 | ····000000dd·<End·of·list> | 75 | ····000000dd·<End·of·list> |
| 76 | ····000000de·v0000008·v0000000·location·view·pair | 76 | ····000000de·v0000008·v0000000·location·view·pair |
| 77 | ····000000e0·v0000008·v0000000·views·at·000000de·for: | 77 | ····000000e0·v0000008·v0000000·views·at·000000de·for: |
| 78 | ·············000e | 78 | ·············000e865a·000e866a·(DW_OP_reg7·(edi)) |
| 79 | ····000000e8·<End·of·list> | 79 | ····000000e8·<End·of·list> |
| 80 | ····000000e9·v0000008·v0000000·location·view·pair | 80 | ····000000e9·v0000008·v0000000·location·view·pair |
| 81 | ····000000eb·v0000008·v0000000·views·at·000000e9·for: | 81 | ····000000eb·v0000008·v0000000·views·at·000000e9·for: |
| 82 | ·············000e | 82 | ·············000e865a·000e866a·(DW_OP_lit0;·DW_OP_stack_value) |
| 83 | ····000000f4·<End·of·list> | 83 | ····000000f4·<End·of·list> |
| 84 | ····000000f5·v0000000·v0000000·location·view·pair | 84 | ····000000f5·v0000000·v0000000·location·view·pair |
| 85 | ····000000f7·v0000000·v0000000·views·at·000000f5·for: | 85 | ····000000f7·v0000000·v0000000·views·at·000000f5·for: |
| 86 | ·············000e | 86 | ·············000e866a·000e8671·(DW_OP_breg7·(edi):·0) |
| 87 | ····00000100·<End·of·list> | 87 | ····00000100·<End·of·list> |
| 88 | ····00000101·v0000000·v0000002·location·view·pair | 88 | ····00000101·v0000000·v0000002·location·view·pair |
| 89 | ····00000103·v0000000·v0000002·views·at·00000101·for: | 89 | ····00000103·v0000000·v0000002·views·at·00000101·for: |
| 90 | ·············000e | 90 | ·············000e8671·000e8671·(DW_OP_implicit_pointer:·<0x24f56>·0) |
| 91 | ····00000110·<End·of·list> | 91 | ····00000110·<End·of·list> |
| 92 | ····00000111·v0000000·v0000004·location·view·pair | 92 | ····00000111·v0000000·v0000004·location·view·pair |
| 93 | ····00000113·v0000000·v0000004·views·at·00000111·for: | 93 | ····00000113·v0000000·v0000004·views·at·00000111·for: |
| 94 | ·············000e | 94 | ·············000e869a·000e86aa·(DW_OP_reg7·(edi)) |
| 95 | ····0000011b·<End·of·list> | 95 | ····0000011b·<End·of·list> |
| 96 | ····0000011c·v0000001·v0000000·location·view·pair | 96 | ····0000011c·v0000001·v0000000·location·view·pair |
| 97 | ····0000011e·v0000001·v0000000·views·at·0000011c·for: | 97 | ····0000011e·v0000001·v0000000·views·at·0000011c·for: |
| 98 | ·············000e | 98 | ·············000e869a·000e86aa·(DW_OP_reg7·(edi)) |
| 99 | ····00000126·<End·of·list> | 99 | ····00000126·<End·of·list> |
| 100 | ····00000127·v0000002·v0000000·location·view·pair | 100 | ····00000127·v0000002·v0000000·location·view·pair |
| Max diff block lines reached; 327523968/327529961 bytes (100.00%) of diff not shown. | |||
| Offset 1, 5198 lines modified | Offset 1, 5203 lines modified | ||
| 1 | Contents·of·the·.debug_aranges·section: | 1 | Contents·of·the·.debug_aranges·section: |
| 2 | ··Length:···················44 | 2 | ··Length:···················44 |
| 3 | ··Version:··················2 | 3 | ··Version:··················2 |
| 4 | ··Offset·into·.debug_info:··0x2 | 4 | ··Offset·into·.debug_info:··0x237a8 |
| 5 | ··Pointer·Size:·············4 | 5 | ··Pointer·Size:·············4 |
| 6 | ··Segment·Size:·············0 | 6 | ··Segment·Size:·············0 |
| 7 | ····Address····Length | 7 | ····Address····Length |
| 8 | ····000e | 8 | ····000e8610·000003f7 |
| 9 | ····00081 | 9 | ····00081380·000000b6 |
| 10 | ····000e8 | 10 | ····000e8a10·00000006 |
| 11 | ····00000000·00000000 | 11 | ····00000000·00000000 |
| 12 | ··Length:···················1164 | 12 | ··Length:···················1164 |
| 13 | ··Version:··················2 | 13 | ··Version:··················2 |
| 14 | ··Offset·into·.debug_info:··0x2 | 14 | ··Offset·into·.debug_info:··0x25858 |
| 15 | ··Pointer·Size:·············4 | 15 | ··Pointer·Size:·············4 |
| 16 | ··Segment·Size:·············0 | 16 | ··Segment·Size:·············0 |
| 17 | ····Address····Length | 17 | ····Address····Length |
| 18 | ····000e8 | 18 | ····000e8a40·00037e03 |
| 19 | ····00081 | 19 | ····0008180a·00008ad9 |
| 20 | ····000e8 | 20 | ····000e8a10·00000006 |
| 21 | ····00120 | 21 | ····00120850·00000003 |
| 22 | ····00120 | 22 | ····00120860·0000000b |
| 23 | ····00120 | 23 | ····00120870·00000001 |
| 24 | ····00120 | 24 | ····00120880·00000001 |
| 25 | ····00120 | 25 | ····00120890·00000001 |
| 26 | ····00120 | 26 | ····001208a0·00000001 |
| 27 | ····00120 | 27 | ····001208b0·000000ab |
| 28 | ····00120 | 28 | ····00120960·00000026 |
| 29 | ····00120 | 29 | ····00120990·00000030 |
| 30 | ····00120 | 30 | ····001209c0·00000067 |
| 31 | ····00120 | 31 | ····00120b10·00000026 |
| 32 | ····00120 | 32 | ····00120b40·00000030 |
| 33 | ····00120 | 33 | ····00120b70·00000026 |
| 34 | ····00120 | 34 | ····00120ba0·00000030 |
| 35 | ····00120 | 35 | ····00120c00·00000234 |
| 36 | ····00120 | 36 | ····00120e40·000008b3 |
| 37 | ····00081 | 37 | ····00081436·000000f1 |
| 38 | ····00081 | 38 | ····00081528·000000f1 |
| 39 | ····00081 | 39 | ····0008161a·000000f7 |
| 40 | ····00081 | 40 | ····00081712·000000f7 |
| 41 | ····0012 | 41 | ····00121700·00000013 |
| 42 | ····0012 | 42 | ····00121720·00000073 |
| 43 | ····00121 | 43 | ····001217a0·0000006e |
| 44 | ····00120 | 44 | ····00120a30·0000006c |
| 45 | ····00120 | 45 | ····00120aa0·00000064 |
| 46 | ····00121 | 46 | ····00121810·00000078 |
| 47 | ····00121 | 47 | ····00121890·0000005d |
| 48 | ····00121 | 48 | ····001219b0·0000005d |
| 49 | ····00121390·00000063 | ||
| 50 | ····00121400·00000065 | ||
| 51 | ····001214e0·00000063 | ||
| 52 | ····00121550·00000065 | ||
| 53 | ····001211b0·0000005b | ||
| 54 | ····00121210·0000005d | ||
| 55 | ····001212d0·0000005b | ||
| 56 | ····00121330·0000005d | ||
| 57 | ····00121470·00000065 | ||
| 58 | ····001215c0·00000065 | ||
| 59 | ····00121630·0000006c | ||
| 60 | ····00121780·0000006c | ||
| 61 | ····00121 | 49 | ····00121ad0·00000063 |
| 62 | ····00121a20·00000063 | ||
| 63 | ····001216a0·0000006d | ||
| 64 | ····00121710·0000006f | ||
| 65 | ····001217f0·0000006d | ||
| 66 | ····00121860·0000006f | ||
| 67 | ····00121 | 50 | ····00121b40·00000065 |
| 68 | ····00121 | 51 | ····00121c20·00000063 |
| 69 | ····00121 | 52 | ····00121c90·00000065 |
| 53 | ····001218f0·0000005b | ||
| 54 | ····00121950·0000005d | ||
| 55 | ····00121a10·0000005b | ||
| 56 | ····00121a70·0000005d | ||
| 70 | ····00121b | 57 | ····00121bb0·00000065 |
| 71 | ····00121b70·00000121 | ||
| 72 | ····00121ca0·00000129 | ||
| 73 | ····00121d | 58 | ····00121d00·00000065 |
| 74 | ····00121 | 59 | ····00121d70·0000006c |
| 60 | ····00121ec0·0000006c | ||
| 61 | ····00122010·00000063 | ||
| 62 | ····00122160·00000063 | ||
| 63 | ····00121de0·0000006d | ||
| 64 | ····00121e50·0000006f | ||
| 65 | ····00121f30·0000006d | ||
| 75 | ····00121f | 66 | ····00121fa0·0000006f |
| 67 | ····00122080·00000065 | ||
| 68 | ····001220f0·00000067 | ||
| 69 | ····001221d0·00000065 | ||
| 70 | ····00122240·00000067 | ||
| 71 | ····001222b0·00000121 | ||
| 72 | ····001223e0·00000129 | ||
| 73 | ····00122510·000000f4 | ||
| 74 | ····00122610·00000114 | ||
| 75 | ····00122730·0000009f | ||
| 76 | ····0008a | 76 | ····0008a2e3·00000036 |
| 77 | ····00122 | 77 | ····001227d0·00000046 |
| 78 | ····00122 | 78 | ····00122820·000003e1 |
| 79 | ····00122 | 79 | ····00122c10·000002df |
| 80 | ····00122 | 80 | ····00122ef0·000000bc |
| 81 | ····00122 | 81 | ····00122fb0·000000a0 |
| 82 | ····0012 | 82 | ····00123050·000001a2 |
| 83 | ····0012 | 83 | ····00123200·00000005 |
| 84 | ····0012 | 84 | ····00123210·00000082 |
| 85 | ····0012 | 85 | ····001232a0·000000e9 |
| 86 | ····0012 | 86 | ····00123390·00000053 |
| 87 | ····0012 | 87 | ····001233f0·0000005a |
| 88 | ····0012 | 88 | ····00123450·0000004e |
| 89 | ····0012 | 89 | ····001234a0·00000088 |
| 90 | ····0012 | 90 | ····00123530·00000057 |
| 91 | ····0012 | 91 | ····00123590·00000205 |
| 92 | ····00123 | 92 | ····001237a0·00000173 |
| 93 | ····00123 | 93 | ····00123920·0000008f |
| 94 | ····00123 | 94 | ····001239b0·000000c3 |
| 95 | ····00123340·0000002c | ||
| 96 | ····00123370·0000002c | ||
| 97 | ····00123 | 95 | ····00123a80·0000002c |
| 96 | ····00123ab0·0000002c | ||
| 97 | ····00123ae0·0000002c | ||
| 98 | ····00123 | 98 | ····00123b10·0000038e |
| 99 | ····00123 | 99 | ····00123ea0·00000029 |
| 100 | ····00123 | 100 | ····00123ed0·0000010a |
| 101 | ····00123 | 101 | ····00123fe0·00000117 |
| 102 | ····001239c0·00000117 | ||
| 103 | ····00123ae0·00000111 | ||
| Max diff block lines reached; 206105/213382 bytes (96.59%) of diff not shown. | |||
| Offset 1, 5070 lines modified | Offset 1, 5112 lines modified | Diff chunk too large, falling back to line-by-line diff (2898 lines added, 2870 lines removed) | |
| 1 | GCC:·(Debian·14.2.0-8)·14.2.0 | 1 | GCC:·(Debian·14.2.0-8)·14.2.0 |
| 2 | 2 | Uwa7i>jzi9 | |
| 3 | 3 | _aPaXaT!. | |
| 4 | 4 | S,eUiA}oR | |
| 5 | 5 | r|e)7sDt5 | |
| 6 | 6 | ?5I3=lC3 | |
| 7 | 7 | T-]^Fj» 4 | |
| 8 | 8 | U[.,#]D.k | |
| 9 | 9 | `[)y_hb· | |
| 10 | 10 | [@`k8)~V<vr | |
| 11 | 11 | o`M:#yN2 | |
| 12 | 12 | z{A3EQSv | |
| 13 | 13 | 7Uo» ^HU_ | |
| 14 | 14 | ;a9]Fb9» | |
| 15 | 15 | 7AM]'q=»|v | |
| 16 | 16 | \[BNqj&Q | |
| 17 | 17 | nelT}{Z1Y | |
| 18 | 18 | b[eX[=p5 | |
| 19 | 19 | b#YCItr4 | |
| 20 | 20 | (R;1KxLn | |
| 21 | 21 | FjuYXF]uj | |
| 22 | 22 | gC9rNbHtN | |
| 23 | 23 | Y7+'qrVu | |
| 24 | 24 | 9>IrhnOV9 | |
| 25 | 25 | Rbm*I,B} | |
| 26 | 26 | R.nsf~KS | |
| 27 | 27 | NS"6EpIs# | |
| 28 | 28 | ToT» T^^ku- | |
| 29 | 29 | 4&|A';jRh | |
| 30 | 30 | F/QKQ#Wx | |
| 31 | 31 | A"zUK>gpr> | |
| 32 | 32 | 9`eg(I/7 | |
| 33 | 33 | ,!hWw;NE | |
| 34 | 34 | IV?zRaa^ | |
| 35 | 35 | ngV^a()S1 | |
| 36 | 36 | 9GB^a$0L | |
| 37 | 37 | dui-$gUL | |
| 38 | 38 | |2zH|;0zH | |
| 39 | 39 | XSvOn\kc | |
| 40 | 40 | a$;CyFxDT | |
| 41 | 41 | Xp1.k;#F | |
| 42 | 42 | /MdR0SQ6 | |
| 43 | 43 | gmy@&,=k[ | |
| 44 | 44 | 0[^V=/Io | |
| 45 | 45 | t,^(S($S | |
| 46 | 46 | ·JaP'd>O | |
| 47 | 47 | #I)hVJBY | |
| 48 | 48 | M}`9^+)» | |
| 49 | 49 | K·N3*`$d | |
| 50 | 50 | %^3d[a,0?- | |
| 51 | 51 | $&)7fDk· | |
| 52 | 52 | EfvCGnId | |
| 53 | 53 | 0ur9/SPetY | |
| 54 | 54 | TYg%sdV2 | |
| 55 | 55 | iHNh*Drg | |
| 56 | 56 | r3vSSnX75 | |
| 57 | 57 | Gazm3~TO' | |
| 58 | 58 | @UPhCtxrTA | |
| 59 | 59 | U%e-(WHr | |
| 60 | 60 | 72Ttq#7'v | |
| 61 | 61 | HGekBa+i | |
| 62 | 62 | OYoNY.@]gOa | |
| 63 | 63 | /Z.·]#.b | |
| 64 | 64 | Z\@wU@~A}) | |
| 65 | 65 | Mz·2y·J>Q | |
| 66 | 66 | dTc:vO26 | |
| 67 | 67 | <GOjS{,XN | |
| 68 | 68 | x{hHC+R|! | |
| 69 | 69 | 8Rs0d<7/ | |
| 70 | 70 | };-L[4e3H? | |
| 71 | 71 | r_=@^/l. | |
| 72 | 72 | UX^)%&Zom | |
| 73 | 73 | S%KA,h-G | |
| 74 | 74 | 't_07@\$f$ | |
| 75 | 75 | .yuN.SUkR; | |
| 76 | 76 | /"byQ#Z"w | |
| 77 | 77 | !Y» n9R`> | |
| 78 | 78 | xJLI0%&b45 | |
| 79 | 79 | 3+:sC@!> | |
| 80 | 80 | D3~:5S4c | |
| 81 | 81 | 697EZM`hn | |
| 82 | 82 | .'_*rAXoN | |
| 83 | 83 | q%))J+,% | |
| 84 | 84 | -IkCN!C' | |
| 85 | 85 | ywQRgD:v | |
| 86 | 86 | QR}VR}7% | |
| 87 | 87 | PV~+E_Hd'\_q3J | |
| 88 | 88 | JTGte)]Gv | |
| 89 | 89 | Gz%d1(S{ | |
| 90 | 90 | d@Pn2Y | |
| 91 | 91 | lZ&lqQDg | |
| 92 | 92 | T9Xe!8?" | |
| 93 | 93 | dSQ69{[8{wL | |
| 94 | 94 | jTFp\vAX | |
| 95 | 95 | S_<gs<E_ | |
| 96 | 96 | TRo$zFJ%ueq | |
| 97 | 97 | $$&·d=,K | |
| 98 | 98 | [zzNRR:) | |
| 99 | 99 | ·gCnP;\/ | |
| 100 | 100 | 2qL2=;+dz | |
| 101 | 101 | ?J-CY·l'R | |
| 102 | 102 | 12IHHdUq | |
| 103 | 103 | xiI{<}6_Z | |
| 104 | 104 | 5'5p2~'r | |
| 105 | 105 | W,|(zE·8% | |
| 106 | o | 106 | 1o·`?wD<, |
| 107 | 107 | gG<*]OOP | |
| 108 | $ | 108 | r$L<X>KVF |
| 109 | 109 | F\6B5bW@: | |
| 110 | 110 | fcZBc-*= | |
| 111 | 111 | N_q1_y6T | |
| 112 | 112 | Eq$rE^)P | |
| 113 | 113 | $h<3YM:[ | |
| 114 | 114 | f5[k5'mSjv | |
| 115 | 115 | E(2·» _\r | |
| 116 | 116 | z9`gs1enm | |
| 117 | 117 | ZR]@bKHK | |
| 118 | 118 | fu|V%ef[ | |
| 119 | 119 | }NK20f/S:2W | |
| 120 | 120 | /5XNmB/O | |
| 121 | 121 | l&:tf825 | |
| 122 | 122 | ~ZoY+9XD | |
| 123 | 123 | `<L\&]v\z | |
| 124 | 124 | g9w!rmM6 | |
| 125 | 125 | g#oqLP^< | |
| 126 | 126 | ·ME*uzeT | |
| Max diff block lines reached; 71675/132906 bytes (53.93%) of diff not shown. | |||
| Offset 1, 7 lines modified | Offset 1, 7 lines modified | ||
| 1 | Disassembly·of·section·.plt.got: | 1 | Disassembly·of·section·.plt.got: |
| 2 | 00081 | 2 | 00081350·<.plt.got>: |
| 3 | » ... | 3 | » ... |
| Offset 1, 23448 lines modified | Offset 1, 23491 lines modified | ||
| 1 | Disassembly·of·section·.text: | 1 | Disassembly·of·section·.text: |
| 2 | 00081 | 2 | 00081380·<doParsMultiState(Params&)·[clone·.cold]>: |
| 3 | » ... | 3 | » ... |
| 4 | 00081 | 4 | 00081436·<boost::wrapexcept<std::overflow_error>::rethrow()·const>: |
| 5 | » ... | 5 | » ... |
| 6 | 00081 | 6 | 00081528·<boost::wrapexcept<std::domain_error>::rethrow()·const>: |
| 7 | » ... | 7 | » ... |
| 8 | 00081 | 8 | 0008161a·<boost::wrapexcept<boost::math::rounding_error>::rethrow()·const>: |
| 9 | » ... | 9 | » ... |
| 10 | 00081 | 10 | 00081712·<boost::wrapexcept<boost::math::evaluation_error>::rethrow()·const>: |
| 11 | » ... | 11 | » ... |
| 12 | 00081 | 12 | 0008180a·<std::__cxx11::basic_string<char,·std::char_traits<char>,·std::allocator<char>·>::basic_string(char·const*,·std::allocator<char>·const&)·[clone·.isra.0]·[clone·.cold]>: |
| 13 | » ... | 13 | » ... |
| 14 | 00081 | 14 | 0008182c·<std::tr1::__detail::_Map_base<unsigned·int,·std::pair<unsigned·int·const,·unsigned·int>,·std::_Select1st<std::pair<unsigned·int·const,·unsigned·int>·>,·true,·std::tr1::_Hashtable<unsigned·int,·std::pair<unsigned·int·const,·unsigned·int>,·std::allocator<std::pair<unsigned·int·const,·unsigned·int>·>,·std::_Select1st<std::pair<unsigned·int·const,·unsigned·int>·>,·std::equal_to<unsigned·int>,·std::tr1::hash<unsigned·int>,·std::tr1::__detail::_Mod_range_hashing,·std::tr1::__detail::_Default_ranged_hash,·std::tr1::__detail::_Prime_rehash_policy,·false,·false,·true>·>::operator[](unsigned·int·const&)·[clone·.isra.0]·[clone·.cold]>: |
| 15 | » ... | 15 | » ... |
| 16 | 00081 | 16 | 0008185c·<std::__cxx11::basic_string<char,·std::char_traits<char>,·std::allocator<char>·>·std::operator+<char,·std::char_traits<char>,·std::allocator<char>·>(char·const*,·std::__cxx11::basic_string<char,·std::char_traits<char>,·std::allocator<char>·>·const&)·[clone·.isra.0]>: |
| 17 | » ... | 17 | » ... |
| 18 | 00081 | 18 | 0008191c·<std::__cxx11::basic_string<char,·std::char_traits<char>,·std::allocator<char>·>·std::operator+<char,·std::char_traits<char>,·std::allocator<char>·>(std::__cxx11::basic_string<char,·std::char_traits<char>,·std::allocator<char>·>&&,·std::__cxx11::basic_string<char,·std::char_traits<char>,·std::allocator<char>·>·const&)·[clone·.isra.0]>: |
| 19 | » ... | 19 | » ... |
| 20 | 00081 | 20 | 0008199e·<std::vector<std::__cxx11::basic_string<char,·std::char_traits<char>,·std::allocator<char>·>,·std::allocator<std::__cxx11::basic_string<char,·std::char_traits<char>,·std::allocator<char>·>·>·>::operator=(std::vector<std::__cxx11::basic_string<char,·std::char_traits<char>,·std::allocator<char>·>,·std::allocator<std::__cxx11::basic_string<char,·std::char_traits<char>,·std::allocator<char>·>·>·>·const&)·[clone·.isra.0]·[clone·.cold]>: |
| 21 | » ... | 21 | » ... |
| 22 | 00081 | 22 | 00081a46·<std::_Rb_tree_iterator<std::pair<std::__cxx11::basic_string<char,·std::char_traits<char>,·std::allocator<char>·>·const,·int>·>·std::_Rb_tree<std::__cxx11::basic_string<char,·std::char_traits<char>,·std::allocator<char>·>,·std::pair<std::__cxx11::basic_string<char,·std::char_traits<char>,·std::allocator<char>·>·const,·int>,·std::_Select1st<std::pair<std::__cxx11::basic_string<char,·std::char_traits<char>,·std::allocator<char>·>·const,·int>·>,·std::less<std::__cxx11::basic_string<char,·std::char_traits<char>,·std::allocator<char>·>·>,·std::allocator<std::pair<std::__cxx11::basic_string<char,·std::char_traits<char>,·std::allocator<char>·>·const,·int>·>·>::_M_emplace_hint_unique<std::piecewise_construct_t·const&,·std::tuple<std::__cxx11::basic_string<char,·std::char_traits<char>,·std::allocator<char>·>·const&>,·std::tuple<>·>(std::_Rb_tree_const_iterator<std::pair<std::__cxx11::basic_string<char,·std::char_traits<char>,·std::allocator<char>·>·const,·int>·>,·std::piecewise_construct_t·const&,·std::tuple<std::__cxx11::basic_string<char,·std::char_traits<char>,·std::allocator<char>·>·const&>&&,·std::tuple<>&&)·[clone·.isra.0]·[clone·.cold]>: |
| 23 | » ... | 23 | » ... |
| 24 | 00081 | 24 | 00081aa4·<Alignment::convertPomoState(int)·[clone·.part.0]·[clone·.cold]>: |
| 25 | Alignment::convertPomoState(int)·[clone·.part.0]·[clone·.cold]: | 25 | Alignment::convertPomoState(int)·[clone·.part.0]·[clone·.cold]: |
| 26 | /usr/include/c++/14/bits/basic_ios.h:50 | 26 | /usr/include/c++/14/bits/basic_ios.h:50 |
| 27 | » add····%al,(%eax) | 27 | » add····%al,(%eax) |
| 28 | » add····%al,(%eax) | 28 | » add····%al,(%eax) |
| 29 | » ... | 29 | » ... |
| 30 | 00081 | 30 | 00081aaa·<Alignment::computeObsDist(int,·int)·[clone·.cold]>: |
| 31 | » ... | 31 | » ... |
| 32 | 00081 | 32 | 00081b88·<Alignment::computeDivergenceMatrix(double*,·double*,·bool)·[clone·.cold]>: |
| 33 | » ... | 33 | » ... |
| 34 | 00081 | 34 | 00081ba4·<Alignment::checkGappySeq(bool)·[clone·.cold]>: |
| 35 | » ... | 35 | » ... |
| 36 | 00081 | 36 | 00081c45·<getDataBlockMorphStates(NxsCharactersBlock*)·[clone·.cold]>: |
| 37 | » ... | 37 | » ... |
| 38 | 00081 | 38 | 00081d88·<Alignment::printSiteInfoHeader(std::ostream&,·char·const*,·bool)·[clone·.cold]>: |
| 39 | Alignment::printSiteInfoHeader(std::ostream&,·char·const*,·bool)·[clone·.cold]: | 39 | Alignment::printSiteInfoHeader(std::ostream&,·char·const*,·bool)·[clone·.cold]: |
| 40 | /usr/include/c++/14/bits/basic_ios.h:50 | 40 | /usr/include/c++/14/bits/basic_ios.h:50 |
| 41 | » add····%al,(%eax) | 41 | » add····%al,(%eax) |
| 42 | » add····%al,(%eax) | 42 | » add····%al,(%eax) |
| 43 | » ... | 43 | » ... |
| 44 | 00081 | 44 | 00081d8e·<Alignment::convertStateBackStr[abi:cxx11](unsigned·int)·[clone·.cold]>: |
| 45 | » ... | 45 | » ... |
| 46 | 00081 | 46 | 00081e14·<Alignment::checkAbsentStates(std::__cxx11::basic_string<char,·std::char_traits<char>,·std::allocator<char>·>)·[clone·.cold]>: |
| 47 | » ... | 47 | » ... |
| 48 | 00081 | 48 | 00081f90·<Alignment::initCodon(char*)·[clone·.cold]>: |
| 49 | » ... | 49 | » ... |
| 50 | 00081 | 50 | 00081fde·<Alignment::getSiteFromResidue(int,·int&,·int&)·[clone·.cold]>: |
| 51 | » ... | 51 | » ... |
| 52 | 00081 | 52 | 00081ffe·<convert_range(char·const*,·int&,·int&,·int&,·char*&)·[clone·.cold]>: |
| 53 | » ... | 53 | » ... |
| 54 | 00082 | 54 | 0008212e·<Alignment::printDist(std::ostream&,·double*)·[clone·.cold]>: |
| 55 | Alignment::printDist(std::ostream&,·double*)·[clone·.cold]: | 55 | Alignment::printDist(std::ostream&,·double*)·[clone·.cold]: |
| 56 | /usr/include/c++/14/bits/basic_ios.h:50 | 56 | /usr/include/c++/14/bits/basic_ios.h:50 |
| 57 | » add····%al,(%eax) | 57 | » add····%al,(%eax) |
| 58 | » add····%al,(%eax) | 58 | » add····%al,(%eax) |
| 59 | » ... | 59 | » ... |
| 60 | 00082 | 60 | 00082134·<Alignment::countStatePerSequence(unsigned·int*)·[clone·.cold]>: |
| 61 | » ... | 61 | » ... |
| 62 | 00082 | 62 | 00082148·<Alignment::computeStateFreqPerSequence(double*)·[clone·.cold]>: |
| 63 | » ... | 63 | » ... |
| 64 | 00082 | 64 | 00082164·<Alignment::convertCountToFreq(unsigned·int*,·double*)·[clone·.cold]>: |
| 65 | » ... | 65 | » ... |
| 66 | 00082 | 66 | 0008216e·<Alignment::computeStateFreq(double*,·unsigned·int)·[clone·.cold]>: |
| 67 | » ... | 67 | » ... |
| 68 | 00082 | 68 | 00082178·<Alignment::computeCodonFreq(StateFreqType,·double*,·double*)·[clone·.cold]>: |
| 69 | » ... | 69 | » ... |
| 70 | 00082 | 70 | 000821b8·<Alignment::multinomialProb(Alignment,·double&)·[clone·.cold]>: |
| 71 | » ... | 71 | » ... |
| 72 | 00082 | 72 | 000821e0·<Alignment::multinomialProb(std::vector<int,·std::allocator<int>·>&)·[clone·.cold]>: |
| 73 | » ... | 73 | » ... |
| 74 | 00082 | 74 | 000821f1·<processSeq(std::__cxx11::basic_string<char,·std::char_traits<char>,·std::allocator<char>·>&,·std::__cxx11::basic_string<char,·std::char_traits<char>,·std::allocator<char>·>&,·int)·[clone·.cold]>: |
| 75 | » ... | 75 | » ... |
| 76 | 00082 | 76 | 00082496·<Alignment::Alignment()·[clone·.cold]>: |
| 77 | » ... | 77 | » ... |
| 78 | 00082 | 78 | 0008257a·<Alignment::printSiteGaps(char·const*)·[clone·.cold]>: |
| 79 | » ... | 79 | » ... |
| 80 | 00082 | 80 | 00082794·<Alignment::printDist(char·const*,·double*)·[clone·.cold]>: |
| 81 | » ... | 81 | » ... |
| 82 | 00082 | 82 | 00082904·<Alignment::printAlignment(InputType,·char·const*,·bool,·char·const*,·int,·char·const*)·[clone·.cold]>: |
| 83 | » ... | 83 | » ... |
| 84 | 00082 | 84 | 00082a94·<Alignment::createBootstrapAlignment(std::vector<int,·std::allocator<int>·>&,·char·const*)·[clone·.cold]>: |
| 85 | » ... | 85 | » ... |
| 86 | 00082 | 86 | 00082aac·<Alignment::checkIdenticalSeq()·[clone·.cold]>: |
| 87 | » ... | 87 | » ... |
| Max diff block lines reached; 2724017/2736024 bytes (99.56%) of diff not shown. | |||
| Offset 1, 7 lines modified | Offset 1, 7 lines modified | ||
| 1 | Disassembly·of·section·.fini: | 1 | Disassembly·of·section·.fini: |
| 2 | 0051 | 2 | 00516594·<_fini>: |
| 3 | » ... | 3 | » ... |
| Offset 1, 847 lines modified | Offset 1, 851 lines modified | ||
| 1 | String·dump·of·section·'.debug_line_str': | 1 | String·dump·of·section·'.debug_line_str': | Diff chunk too large, falling back to line-by-line diff (847 lines added, 843 lines removed) |
| 2 | ··[·····0]··./obsolete/parsmultistate.cpp | 2 | ··[·····0]··./obsolete/parsmultistate.cpp |
| 3 | ··[····1e]··./build. | 3 | ··[····1e]··./build.mpi |
| 4 | ··[····2 | 4 | ··[····2a]··./obsolete |
| 5 | ··[····3 | 5 | ··[····35]··/usr/include/c++/14/bits |
| 6 | ··[···· | 6 | ··[····4e]··/usr/include/c++/14 |
| 7 | ··[····6 | 7 | ··[····62]··/usr/include/c++/14/debug |
| 8 | ··[····7 | 8 | ··[····7c]··/usr/include/i386-linux-gnu/c++/14/bits |
| 9 | ··[····a | 9 | ··[····a4]··/usr/include/c++/14/tr1 |
| 10 | ··[····b | 10 | ··[····bc]··/usr/include/c++/14/ext |
| 11 | ··[····d | 11 | ··[····d4]··/usr/lib/gcc/i686-linux-gnu/14/include |
| 12 | ··[····f | 12 | ··[····fb]··/usr/include |
| 13 | ··[···10 | 13 | ··[···108]··/usr/include/i386-linux-gnu/bits/types |
| 14 | ··[···1 | 14 | ··[···12f]··/usr/include/i386-linux-gnu/bits |
| 15 | ··[···15 | 15 | ··[···150]··./ncl |
| 16 | ··[···15 | 16 | ··[···156]··./utils |
| 17 | ··[···1 | 17 | ··[···15e]··./pda |
| 18 | ··[···16 | 18 | ··[···164]··./tree |
| 19 | ··[···16 | 19 | ··[···16b]··./yaml-cpp/include/yaml-cpp |
| 20 | ··[···18 | 20 | ··[···187]··./yaml-cpp/include/yaml-cpp/node/detail |
| 21 | ··[···1 | 21 | ··[···1af]··./phylo-yaml |
| 22 | ··[···1b | 22 | ··[···1bc]··./alignment |
| 23 | ··[···1c | 23 | ··[···1c8]··./model |
| 24 | ··[···1d | 24 | ··[···1d0]··./nclextra |
| 25 | ··[···1d | 25 | ··[···1db]··locale_facets.h |
| 26 | ··[···1e | 26 | ··[···1eb]··basic_string.h |
| 27 | ··[···1f | 27 | ··[···1fa]··char_traits.h |
| 28 | ··[···20 | 28 | ··[···208]··basic_string.tcc |
| 29 | ··[···21 | 29 | ··[···219]··alloc_traits.h |
| 30 | ··[···22 | 30 | ··[···228]··new_allocator.h |
| 31 | ··[···23 | 31 | ··[···238]··basic_ios.h |
| 32 | ··[···24 | 32 | ··[···244]··ios_base.h |
| 33 | ··[···2 | 33 | ··[···24f]··stl_pair.h |
| 34 | ··[···25 | 34 | ··[···25a]··stl_iterator_base_types.h |
| 35 | ··[···27 | 35 | ··[···274]··debug.h |
| 36 | ··[···27 | 36 | ··[···27c]··c++config.h |
| 37 | ··[···28 | 37 | ··[···288]··cwchar |
| 38 | ··[···2 | 38 | ··[···28f]··clocale |
| 39 | ··[···29 | 39 | ··[···297]··cstdlib |
| 40 | ··[···2 | 40 | ··[···29f]··cstdio |
| 41 | ··[···2a | 41 | ··[···2a6]··initializer_list |
| 42 | ··[···2b | 42 | ··[···2b7]··uses_allocator.h |
| 43 | ··[···2c | 43 | ··[···2c8]··tuple |
| 44 | ··[···2 | 44 | ··[···2ce]··exception_ptr.h |
| 45 | ··[···2 | 45 | ··[···2de]··stringfwd.h |
| 46 | ··[···2e | 46 | ··[···2ea]··cwctype |
| 47 | ··[···2f | 47 | ··[···2f2]··ostream.tcc |
| 48 | ··[··· | 48 | ··[···2fe]··iosfwd |
| 49 | ··[···30 | 49 | ··[···305]··iostream |
| 50 | ··[···3 | 50 | ··[···30e]··postypes.h |
| 51 | ··[···31 | 51 | ··[···319]··std_abs.h |
| 52 | ··[···32 | 52 | ··[···323]··cmath |
| 53 | ··[···32 | 53 | ··[···329]··cstdarg |
| 54 | ··[···33 | 54 | ··[···331]··ctime |
| 55 | ··[···33 | 55 | ··[···337]··cstring |
| 56 | ··[···3 | 56 | ··[···33f]··hashtable_policy.h |
| 57 | ··[···35 | 57 | ··[···352]··shared_ptr_base.h |
| 58 | ··[···36 | 58 | ··[···364]··cstddef |
| 59 | ··[···36 | 59 | ··[···36c]··ptr_traits.h |
| 60 | ··[···37 | 60 | ··[···379]··basic_ios.tcc |
| 61 | ··[···38 | 61 | ··[···387]··ostream_insert.h |
| 62 | ··[···39 | 62 | ··[···398]··functexcept.h |
| 63 | ··[···3a | 63 | ··[···3a6]··stl_iterator_base_funcs.h |
| 64 | ··[···3c | 64 | ··[···3c0]··predefined_ops.h |
| 65 | ··[···3d | 65 | ··[···3d1]··stl_iterator.h |
| 66 | ··[···3e | 66 | ··[···3e0]··concurrence.h |
| 67 | ··[···3 | 67 | ··[···3ee]··stddef.h |
| 68 | ··[···3f | 68 | ··[···3f7]··stdarg.h |
| 69 | ··[···40 | 69 | ··[···400]··wint_t.h |
| 70 | ··[···40 | 70 | ··[···409]··__mbstate_t.h |
| 71 | ··[···41 | 71 | ··[···417]··__FILE.h |
| 72 | ··[···42 | 72 | ··[···420]··struct_FILE.h |
| 73 | ··[···4 | 73 | ··[···42e]··wchar2.h |
| 74 | ··[···43 | 74 | ··[···437]··struct_tm.h |
| 75 | ··[···44 | 75 | ··[···443]··locale.h |
| 76 | ··[···44 | 76 | ··[···44c]··stdlib.h |
| 77 | ··[···45 | 77 | ··[···455]··clock_t.h |
| 78 | ··[···4 | 78 | ··[···45f]··time_t.h |
| 79 | ··[···46 | 79 | ··[···468]··stdint-intn.h |
| 80 | ··[···47 | 80 | ··[···476]··stdlib-float.h |
| 81 | ··[···48 | 81 | ··[···485]··stdlib-bsearch.h |
| 82 | ··[···49 | 82 | ··[···496]··__fpos_t.h |
| 83 | ··[···4a | 83 | ··[···4a1]··stdio.h |
| 84 | ··[···4a | 84 | ··[···4a9]··stdio2.h |
| 85 | ··[···4b | 85 | ··[···4b2]··wctype-wchar.h |
| 86 | ··[···4c | 86 | ··[···4c1]··wctype.h |
| 87 | ··[···4c | 87 | ··[···4ca]··math.h |
| 88 | ··[···4d | 88 | ··[···4d1]··time.h |
| 89 | ··[···4d | 89 | ··[···4d8]··ncl.h |
| 90 | ··[···4 | 90 | ··[···4de]··split.h |
| 91 | ··[···4e | 91 | ··[···4e6]··hashsplitset.h |
| 92 | ··[···4f | 92 | ··[···4f5]··mtree.h |
| 93 | ··[··· | 93 | ··[···4fd]··exceptions.h |
| 94 | ··[···50 | 94 | ··[···50a]··bool_type.h |
| 95 | ··[···51 | 95 | ··[···516]··statespace.h |
| 96 | ··[···52 | 96 | ··[···523]··pattern.h |
| 97 | ··[···5 | 97 | ··[···52d]··checkpoint.h |
| 98 | ··[···53 | 98 | ··[···53a]··modelsubst.h |
| 99 | ··[···54 | 99 | ··[···547]··rateheterogeneity.h |
| 100 | ··[···55 | 100 | ··[···55b]··modelsblock.h |
| 101 | ··[···56 | 101 | ··[···569]··modelfactory.h |
| 102 | ··[···57 | 102 | ··[···578]··phylonode.h |
| 103 | ··[···58 | 103 | ··[···584]··splitgraph.h |
| 104 | ··[···59 | 104 | ··[···591]··phylotree.h |
| 105 | ··[···5 | 105 | ··[···59d]··new |
| 106 | ··[···5a | 106 | ··[···5a1]··parstree.h |
| 107 | ··[···5a | 107 | ··[···5ac]··system_error |
| 108 | ··[···5b | 108 | ··[···5b9]··./alignment/alignment.cpp |
| 109 | ··[···5d | 109 | ··[···5d3]··./build.mpi/alignment |
| 110 | ··[···5e | 110 | ··[···5e9]··/usr/include/boost/math/policies |
| 111 | ··[···6 | 111 | ··[···60a]··/usr/include/eigen3/Eigen/src/Core |
| 112 | ··[···6 | 112 | ··[···62d]··/usr/include/eigen3/Eigen/src/Core/products |
| 113 | ··[···65 | 113 | ··[···659]··/usr/include/eigen3/Eigen/src/Core/util |
| 114 | ··[···68 | 114 | ··[···681]··/usr/include/eigen3/Eigen/src/Core/arch/SSE |
| 115 | ··[···6 | 115 | ··[···6ad]··/usr/include/eigen3/Eigen/src/Core/arch/Default |
| 116 | ··[···6 | 116 | ··[···6dd]··/usr/include/boost/math/tools/detail |
| 117 | ··[···70 | 117 | ··[···702]··/usr/include/boost |
| 118 | ··[···71 | 118 | ··[···715]··/usr/include/boost/exception |
| 119 | ··[···73 | 119 | ··[···732]··/usr/include/boost/math/special_functions/detail |
| 120 | ··[···76 | 120 | ··[···763]··/usr/include/boost/math/tools |
| 121 | ··[···78 | 121 | ··[···781]··/usr/include/boost/math/special_functions |
| 122 | ··[···7 | 122 | ··[···7ab]··/usr/include/eigen3/Eigen/src/LU |
| 123 | ··[···7 | 123 | ··[···7cc]··/usr/include/eigen3/Eigen/src/Core/functors |
| 124 | ··[···7f | 124 | ··[···7f8]··/usr/include/eigen3/Eigen/src/Core/../plugins |
| 125 | ··[···82 | 125 | ··[···826]··/usr/include/boost/math/distributions |
| Max diff block lines reached; 0/52283 bytes (0.00%) of diff not shown. | |||
| Offset 1, 8 lines modified | Offset 1, 8 lines modified | ||
| 1 | Hex·dump·of·section·'.gnu_debugaltlink': | 1 | Hex·dump·of·section·'.gnu_debugaltlink': |
| 2 | ··0x00000000·2f757372·2f6c6962·2f646562·75672f2e·/usr/lib/debug/. | 2 | ··0x00000000·2f757372·2f6c6962·2f646562·75672f2e·/usr/lib/debug/. |
| 3 | ··0x00000010·64777a2f·69333836·2d6c696e·75782d67·dwz/i386-linux-g | 3 | ··0x00000010·64777a2f·69333836·2d6c696e·75782d67·dwz/i386-linux-g |
| 4 | ··0x00000020·6e752f69·71747265·652e6465·62756700·nu/iqtree.debug. | 4 | ··0x00000020·6e752f69·71747265·652e6465·62756700·nu/iqtree.debug. |
| 5 | ··0x00000030· | 5 | ··0x00000030·6b572d48·6c5a52d6·d5a227cc·ab12a58e·kW-HlZR...'..... |
| 6 | ··0x00000040· | 6 | ··0x00000040·b8e8e5e8····························.... |
| Offset 1743, 28561 lines modified | Offset 1743, 28616 lines modified | ||
| 1743 | ··0x00006cc0·5a4e5374·385f5262·5f747265·65496953·ZNSt8_Rb_treeIiS | 1743 | ··0x00006cc0·5a4e5374·385f5262·5f747265·65496953·ZNSt8_Rb_treeIiS |
| 1744 | ··0x00006cd0·74347061·6972494b·6953305f·4950344e·t4pairIKiS0_IP4N | 1744 | ··0x00006cd0·74347061·6972494b·6953305f·4950344e·t4pairIKiS0_IP4N |
| 1745 | ··0x00006ce0·6f646553·335f4545·53743130·5f53656c·odeS3_EESt10_Sel | 1745 | ··0x00006ce0·6f646553·335f4545·53743130·5f53656c·odeS3_EESt10_Sel |
| 1746 | ··0x00006cf0·65637431·73744953·355f4553·74346c65·ect1stIS5_ESt4le | 1746 | ··0x00006cf0·65637431·73744953·355f4553·74346c65·ect1stIS5_ESt4le |
| 1747 | ··0x00006d00·73734969·45536149·53355f45·45385f4d·ssIiESaIS5_EE8_M | 1747 | ··0x00006d00·73734969·45536149·53355f45·45385f4d·ssIiESaIS5_EE8_M |
| 1748 | ··0x00006d10·5f657261·73654550·53743133·5f52625f·_eraseEPSt13_Rb_ | 1748 | ··0x00006d10·5f657261·73654550·53743133·5f52625f·_eraseEPSt13_Rb_ |
| 1749 | ··0x00006d20·74726565·5f6e6f64·65495335·5f452e69·tree_nodeIS5_E.i | 1749 | ··0x00006d20·74726565·5f6e6f64·65495335·5f452e69·tree_nodeIS5_E.i |
| 1750 | ··0x00006d30·7372612e·30005f5a·4e3 | 1750 | ··0x00006d30·7372612e·30005f5a·4e537438·5f52625f·sra.0._ZNSt8_Rb_ |
| 1751 | ··0x00006d40·31357072·696e7452·6573756c·74547265·15printResultTre | ||
| 1752 | ··0x00006d | 1751 | ··0x00006d40·74726565·494e5374·375f5f63·78783131·treeINSt7__cxx11 |
| 1753 | ··0x00006d | 1752 | ··0x00006d50·31326261·7369635f·73747269·6e674963·12basic_stringIc |
| 1754 | ··0x00006d | 1753 | ··0x00006d60·53743131·63686172·5f747261·69747349·St11char_traitsI |
| 1754 | ··0x00006d70·63455361·49634545·45537434·70616972·cESaIcEEESt4pair | ||
| 1755 | ··0x00006d80·494b5335·5f53355f·45537431·305f5365·IKS5_S5_ESt10_Se | ||
| 1756 | ··0x00006d90·6c656374·31737449·53385f45·5374346c·lect1stIS8_ESt4l | ||
| 1757 | ··0x00006da0·65737349·53355f45·53614953·385f4545·essIS5_ESaIS8_EE | ||
| 1758 | ··0x00006db0·385f4d5f·65726173·65455053·7431335f·8_M_eraseEPSt13_ | ||
| 1759 | ··0x00006dc0·52625f74·7265655f·6e6f6465·4953385f·Rb_tree_nodeIS8_ | ||
| 1760 | ··0x00006dd0·452e6973·72612e30·005f5a4e·36495154·E.isra.0._ZN6IQT | ||
| 1761 | ··0x00006de0·72656531·35707269·6e745265·73756c74·ree15printResult | ||
| 1762 | ··0x00006df0·54726565·454e5374·375f5f63·78783131·TreeENSt7__cxx11 | ||
| 1763 | ··0x00006e00·31326261·7369635f·73747269·6e674963·12basic_stringIc | ||
| 1764 | ··0x00006e10·53743131·63686172·5f747261·69747349·St11char_traitsI | ||
| 1755 | ··0x00006 | 1765 | ··0x00006e20·63455361·49634545·452e636f·6c64005f·cESaIcEEE.cold._ |
| 1756 | ··0x00006d90·49515472·65653135·696e6974·69616c69·IQTree15initiali | ||
| 1757 | ··0x00006da0·7a654d6f·64656c45·52365061·72616d73·zeModelER6Params | ||
| 1758 | ··0x00006db0·4e537437·5f5f6378·78313131·32626173·NSt7__cxx1112bas | ||
| 1759 | ··0x00006dc0·69635f73·7472696e·67496353·74313163·ic_stringIcSt11c | ||
| 1760 | ··0x00006dd0·6861725f·74726169·74734963·45536149·har_traitsIcESaI | ||
| 1761 | ··0x00006de0·63454545·5031314d·6f64656c·73426c6f·cEEEP11ModelsBlo | ||
| 1762 | ··0x00006df0·636b2e63·6f6c6400·5f5a4e36·49515472·ck.cold._ZN6IQTr | ||
| 1763 | ··0x00006e00·65653469·6e697445·762e636f·6c64005f·ee4initEv.cold._ | ||
| 1764 | ··0x00006e10·5a4e3649·51547265·65323167·656e6572·ZN6IQTree21gener | ||
| 1765 | ··0x00006e20·61746550·61727369·6d6f6e79·54726565·ateParsimonyTree | ||
| 1766 | ··0x00006e30·42356378·78313145·692e636f·6c64005f·B5cxx11Ei.cold._ | ||
| 1767 | ··0x00006e | 1766 | ··0x00006e30·5a4e3649·51547265·65313569·6e697469·ZN6IQTree15initi |
| 1768 | ··0x00006e | 1767 | ··0x00006e40·616c697a·654d6f64·656c4552·36506172·alizeModelER6Par |
| 1768 | ··0x00006e50·616d734e·5374375f·5f637878·31313132·amsNSt7__cxx1112 | ||
| 1769 | ··0x00006e60·62617369·635f7374·72696e67·49635374·basic_stringIcSt | ||
| 1770 | ··0x00006e70·31316368·61725f74·72616974·73496345·11char_traitsIcE | ||
| 1771 | ··0x00006e80·53614963·45454550·31314d6f·64656c73·SaIcEEEP11Models | ||
| 1772 | ··0x00006e90·426c6f63·6b2e636f·6c64005f·5a4e3649·Block.cold._ZN6I | ||
| 1773 | ··0x00006ea0·51547265·6534696e·69744576·2e636f6c·QTree4initEv.col | ||
| 1769 | ··0x00006e | 1774 | ··0x00006eb0·64005f5a·4e364951·54726565·32316765·d._ZN6IQTree21ge |
| 1775 | ··0x00006ec0·6e657261·74655061·7273696d·6f6e7954·nerateParsimonyT | ||
| 1776 | ··0x00006ed0·72656542·35637878·31314569·2e636f6c·reeB5cxx11Ei.col | ||
| 1770 | ··0x00006e70·69736542·6f6e7573·4550384e·65696768·iseBonusEP8Neigh | ||
| 1771 | ··0x00006e80·626f7250·344e6f64·65642e63·6f6c6400·borP4Noded.cold. | ||
| 1772 | ··0x00006e90·5f5a4e36·49515472·65653230·6765744d·_ZN6IQTree20getM | ||
| 1773 | ··0x00006ea0·6f64656c·52617465·7346726f·6d504c4c·odelRatesFromPLL | ||
| 1774 | ··0x00006eb0·45762e63·6f6c6400·5f5a4e36·49515472·Ev.cold._ZN6IQTr | ||
| 1775 | ··0x00006ec0·65653139·706c6c50·72696e74·4d6f6465·ee19pllPrintMode | ||
| 1776 | ··0x00006ed0·6c506172·616d7345·762e636f·6c64005f·lParamsEv.cold._ | ||
| 1777 | ··0x00006ee0·5a4e3649·51547265·65323670·6c6c4275·ZN6IQTree26pllBu | ||
| 1778 | ··0x00006ef0·696c6449·51547265·65506174·7465726e·ildIQTreePattern | ||
| 1779 | ··0x00006f00·496e6465·7845762e·636f6c64·005f5a4e·IndexEv.cold._ZN | ||
| 1780 | ··0x00006f10·36495154·72656537·70657274·75726245·6IQTree7perturbE | ||
| 1781 | ··0x00006f20·692e636f·6c64005f·5a4e3649·51547265·i.cold._ZN6IQTre | ||
| 1782 | ··0x00006f30·6532336f·7074696d·697a654d·6f64656c·e23optimizeModel | ||
| 1783 | ··0x00006f40·50617261·6d657465·72734235·63787831·ParametersB5cxx1 | ||
| 1784 | ··0x00006f50·31456264·2e636f6c·64005f5a·4e364951·1Ebd.cold._ZN6IQ | ||
| 1785 | ··0x00006f60·54726565·31357072·696e7442·65737453·Tree15printBestS | ||
| 1786 | ··0x00006f70·636f7265·7345762e·636f6c64·005f5a4e·coresEv.cold._ZN | ||
| 1787 | ··0x00006f80·36495154·72656531·366f7074·696d697a·6IQTree16optimiz | ||
| 1788 | ··0x00006f90·65427261·6e636865·73423563·78783131·eBranchesB5cxx11 | ||
| 1789 | ··0x00006fa0·45692e63·6f6c6400·5f5a4e36·49515472·Ei.cold._ZN6IQTr | ||
| 1790 | ··0x00006fb0·65653138·7072696e·74497465·72617469·ee18printIterati | ||
| 1791 | ··0x00006fc0·6f6e496e·666f4569·2e636f6c·64005f5a·onInfoEi.cold._Z | ||
| 1792 | ··0x00006fd0·4e364951·54726565·32316164·64547265·N6IQTree21addTre | ||
| 1793 | ··0x00006fe0·65546f43·616e6469·64617465·53657445·eToCandidateSetE | ||
| 1794 | ··0x00006ff0·4e537437·5f5f6378·78313131·32626173·NSt7__cxx1112bas | ||
| 1795 | ··0x00007000·69635f73·7472696e·67496353·74313163·ic_stringIcSt11c | ||
| 1796 | ··0x00007010·6861725f·74726169·74734963·45536149·har_traitsIcESaI | ||
| 1797 | ··0x00007020·63454545·6462692e·636f6c64·005f5a4e·cEEEdbi.cold._ZN | ||
| 1798 | ··0x00007030·36495154·72656531·32736176·654e4e49·6IQTree12saveNNI | ||
| 1799 | ··0x00007040·54726565·73455039·5068796c·6f4e6f64·TreesEP9PhyloNod | ||
| 1800 | ··0x00007050·6553315f·2e636f6c·64005f5a·4e364951·eS1_.cold._ZN6IQ | ||
| 1801 | ··0x00007060·54726565·31377072·696e7450·68796c6f·Tree17printPhylo | ||
| 1802 | ··0x00007070·6c696254·72656545·504b632e·636f6c64·libTreeEPKc.cold | ||
| 1803 | ··0x0000 | 1777 | ··0x00006ee0·64005f5a·4e364951·54726565·3135696e·d._ZN6IQTree15in |
| 1778 | ··0x00006ef0·63726561·73654b44·656c6574·6545762e·creaseKDeleteEv. | ||
| 1804 | ··0x00007090·76657274·4e4e4932·53706c69·74734552·vertNNI2SplitsER | ||
| 1805 | ··0x000070a0·31315370·6c697449·6e744d61·70695253·11SplitIntMapiRS | ||
| 1806 | ··0x000070b0·74367665·63746f72·49374e4e·494d6f76·t6vectorI7NNIMov | ||
| 1807 | ··0x000070c0·65536149·53335f45·452e636f·6c64005f·eSaIS3_EE.cold._ | ||
| 1808 | ··0x000070d0·5a4e3649·51547265·65323069·6e707574·ZN6IQTree20input | ||
| 1809 | ··0x000070e0·4d6f6465·6c495154·72656532·504c4c45·ModelIQTree2PLLE | ||
| 1810 | ··0x000070f0·762e636f·6c64005f·5a4e3649·51547265·v.cold._ZN6IQTre | ||
| 1811 | ··0x00007100·65313863·72656174·65504c4c·50617274·e18createPLLPart | ||
| 1812 | ··0x00007110·6974696f·6e455236·50617261·6d735253·itionER6ParamsRS | ||
| 1813 | ··0x00007120·6f2e636f·6c64005f·5a4e3649·51547265·o.cold._ZN6IQTre | ||
| 1814 | ··0x00007130·65313369·6e697469·616c697a·65504c4c·e13initializePLL | ||
| 1815 | ··0x00007140·45523650·6172616d·732e636f·6c64005f·ER6Params.cold._ | ||
| 1816 | ··0x00007150·5a4e3649·51547265·65323270·72696e74·ZN6IQTree22print | ||
| 1817 | ··0x00007160·42657374·43616e64·69646174·65547265·BestCandidateTre | ||
| 1818 | ··0x00007170·6545762e·636f6c64·005f5a4e·36495154·eEv.cold._ZN6IQT | ||
| 1819 | ··0x00007180·72656531·37657374·696d6174·654e4e49·ree17estimateNNI | ||
| 1820 | ··0x00007190·4375746f·66664550·36506172·616d732e·CutoffEP6Params. | ||
| 1821 | ··0x0000 | 1779 | ··0x00006f00·636f6c64·005f5a4e·36495154·72656531·cold._ZN6IQTree1 |
| 1780 | ··0x00006f10·30726169·7365426f·6e757345·50384e65·0raiseBonusEP8Ne | ||
| 1781 | ··0x00006f20·69676862·6f725034·4e6f6465·642e636f·ighborP4Noded.co | ||
| 1822 | ··0x000071b0·30736176·65554642·6f6f7445·50313043·0saveUFBootEP10C | ||
| 1823 | ··0x000071c0·6865636b·706f696e·742e636f·6c64005f·heckpoint.cold._ | ||
| 1824 | ··0x000071d0·5a4e3649·51547265·65313573·61766543·ZN6IQTree15saveC | ||
| 1825 | ··0x000071e0·75727265·6e745472·65654564·2e636f6c·urrentTreeEd.col | ||
| 1826 | ··0x000071f0·64005f5a·3138636f·6d707574·65436f72·d._Z18computeCor | ||
| 1827 | ··0x00007200·72656c61·74696f6e·52537436·76656374·relationRSt6vect | ||
| 1828 | ··0x00007210·6f724969·53614969·45455332·5f2e636f·orIiSaIiEES2_.co | ||
| 1829 | ··0x0000 | 1782 | ··0x00006f30·6c64005f·5a4e3649·51547265·65323067·ld._ZN6IQTree20g |
| 1830 | ··0x00007230·6f6d7075·7465496e·69746961·6c547265·omputeInitialTre | ||
| 1831 | ··0x0000 | 1783 | ··0x00006f40·65744d6f·64656c52·61746573·46726f6d·etModelRatesFrom |
| 1784 | ··0x00006f50·504c4c45·762e636f·6c64005f·5a4e3649·PLLEv.cold._ZN6I | ||
| 1785 | ··0x00006f60·51547265·65313970·6c6c5072·696e744d·QTree19pllPrintM | ||
| 1786 | ··0x00006f70·6f64656c·50617261·6d734576·2e636f6c·odelParamsEv.col | ||
| 1787 | ··0x00006f80·64005f5a·4e364951·54726565·3236706c·d._ZN6IQTree26pl | ||
| 1788 | ··0x00006f90·6c427569·6c644951·54726565·50617474·lBuildIQTreePatt | ||
| 1789 | ··0x00006fa0·65726e49·6e646578·45762e63·6f6c6400·ernIndexEv.cold. | ||
| 1790 | ··0x00006fb0·5f5a4e36·49515472·65653770·65727475·_ZN6IQTree7pertu | ||
| 1832 | ··0x0000 | 1791 | ··0x00006fc0·72624569·2e636f6c·64005f5a·4e364951·rbEi.cold._ZN6IQ |
| 1833 | ··0x0000 | 1792 | ··0x00006fd0·54726565·32336f70·74696d69·7a654d6f·Tree23optimizeMo |
| 1793 | ··0x00006fe0·64656c50·6172616d·65746572·73423563·delParametersB5c | ||
| 1794 | ··0x00006ff0·78783131·4562642e·636f6c64·005f5a4e·xx11Ebd.cold._ZN | ||
| 1795 | ··0x00007000·36495154·72656531·35707269·6e744265·6IQTree15printBe | ||
| 1796 | ··0x00007010·73745363·6f726573·45762e63·6f6c6400·stScoresEv.cold. | ||
| 1797 | ··0x00007020·5f5a4e36·49515472·65653136·6f707469·_ZN6IQTree16opti | ||
| 1798 | ··0x00007030·6d697a65·4272616e·63686573·42356378·mizeBranchesB5cx | ||
| 1799 | ··0x00007040·78313145·692e636f·6c64005f·5a4e3649·x11Ei.cold._ZN6I | ||
| Max diff block lines reached; 3790120/3828876 bytes (98.99%) of diff not shown. | |||
| Offset 17, 13 lines modified | Offset 17, 13 lines modified | ||
| 17 | ··0x000000e0·72726179·002e6669·6e695f61·72726179·rray..fini_array | 17 | ··0x000000e0·72726179·002e6669·6e695f61·72726179·rray..fini_array |
| 18 | ··0x000000f0·002e6461·74612e72·656c2e72·6f002e64·..data.rel.ro..d | 18 | ··0x000000f0·002e6461·74612e72·656c2e72·6f002e64·..data.rel.ro..d |
| 19 | ··0x00000100·796e616d·6963002e·64617461·002e6273·ynamic..data..bs | 19 | ··0x00000100·796e616d·6963002e·64617461·002e6273·ynamic..data..bs |
| 20 | ··0x00000110·73002e63·6f6d6d65·6e74002e·64656275·s..comment..debu | 20 | ··0x00000110·73002e63·6f6d6d65·6e74002e·64656275·s..comment..debu |
| 21 | ··0x00000120·675f6172·616e6765·73002e64·65627567·g_aranges..debug | 21 | ··0x00000120·675f6172·616e6765·73002e64·65627567·g_aranges..debug |
| 22 | ··0x00000130·5f696e66·6f002e64·65627567·5f616262·_info..debug_abb | 22 | ··0x00000130·5f696e66·6f002e64·65627567·5f616262·_info..debug_abb |
| 23 | ··0x00000140·72657600·2e646562·75675f6c·696e6500·rev..debug_line. | 23 | ··0x00000140·72657600·2e646562·75675f6c·696e6500·rev..debug_line. |
| 24 | ··0x00000150·2e646562·75675f6c·696e655f·73747200·.debug_line_str. | ||
| 25 | ··0x00000160·2e646562·75675f6c·6f636c69·73747300·.debug_loclists. | ||
| 26 | ··0x00000170·2e646562·75675f72·6e676c69·73747300·.debug_rnglists. | ||
| 27 | ··0x00000180·2e676e75·5f646562·7567616c·746c696e·.gnu_debugaltlin | ||
| 28 | ··0x000001 | 24 | ··0x00000150·2e646562·75675f73·7472002e·64656275·.debug_str..debu |
| 25 | ··0x00000160·675f6c69·6e655f73·7472002e·64656275·g_line_str..debu | ||
| 26 | ··0x00000170·675f6c6f·636c6973·7473002e·64656275·g_loclists..debu | ||
| 27 | ··0x00000180·675f726e·676c6973·7473002e·676e755f·g_rnglists..gnu_ | ||
| 28 | ··0x00000190·64656275·67616c74·6c696e6b·00·······debugaltlink. | ||
| Offset 4, 17 lines modified | Offset 4, 17 lines modified | ||
| 4 | ··Data:······························2's·complement,·little·endian | 4 | ··Data:······························2's·complement,·little·endian |
| 5 | ··Version:···························1·(current) | 5 | ··Version:···························1·(current) |
| 6 | ··OS/ABI:····························UNIX·-·GNU | 6 | ··OS/ABI:····························UNIX·-·GNU |
| 7 | ··ABI·Version:·······················0 | 7 | ··ABI·Version:·······················0 |
| 8 | ··Type:······························DYN·(Shared·object·file) | 8 | ··Type:······························DYN·(Shared·object·file) |
| 9 | ··Machine:···························Intel·80386 | 9 | ··Machine:···························Intel·80386 |
| 10 | ··Version:···························0x1 | 10 | ··Version:···························0x1 |
| 11 | ··Entry·point·address:···············0xe | 11 | ··Entry·point·address:···············0xe7e30 |
| 12 | ··Start·of·program·headers:··········52·(bytes·into·file) | 12 | ··Start·of·program·headers:··········52·(bytes·into·file) |
| 13 | ··Start·of·section·headers:··········23 | 13 | ··Start·of·section·headers:··········23033616·(bytes·into·file) |
| 14 | ··Flags:·····························0x0 | 14 | ··Flags:·····························0x0 |
| 15 | ··Size·of·this·header:···············52·(bytes) | 15 | ··Size·of·this·header:···············52·(bytes) |
| 16 | ··Size·of·program·headers:···········32·(bytes) | 16 | ··Size·of·program·headers:···········32·(bytes) |
| 17 | ··Number·of·program·headers:·········12 | 17 | ··Number·of·program·headers:·········12 |
| 18 | ··Size·of·section·headers:···········40·(bytes) | 18 | ··Size·of·section·headers:···········40·(bytes) |
| 19 | ··Number·of·section·headers:········· | 19 | ··Number·of·section·headers:·········39 |
| 20 | ··Section·header·string·table·index:·3 | 20 | ··Section·header·string·table·index:·38 |
| Offset 1, 26 lines modified | Offset 1, 26 lines modified | ||
| 1 | Elf·file·type·is·DYN·(Shared·object·file) | 1 | Elf·file·type·is·DYN·(Shared·object·file) |
| 2 | Entry·point·0xe | 2 | Entry·point·0xe7e30 |
| 3 | There·are·12·program·headers,·starting·at·offset·52 | 3 | There·are·12·program·headers,·starting·at·offset·52 |
| 4 | Program·Headers: | 4 | Program·Headers: |
| 5 | ··Type···········Offset···VirtAddr···PhysAddr···FileSiz·MemSiz··Flg·Align | 5 | ··Type···········Offset···VirtAddr···PhysAddr···FileSiz·MemSiz··Flg·Align |
| 6 | ··PHDR···········0x000034·0x00000034·0x00000034·0x00180·0x00180·R···0x4 | 6 | ··PHDR···········0x000034·0x00000034·0x00000034·0x00180·0x00180·R···0x4 |
| 7 | ··INTERP·········0x0001d8·0x000001d8·0x000001d8·0x00000·0x00013·R···0x1 | 7 | ··INTERP·········0x0001d8·0x000001d8·0x000001d8·0x00000·0x00013·R···0x1 |
| 8 | ··LOAD···········0x000000·0x00000000·0x00000000·0x001d8·0x7f | 8 | ··LOAD···········0x000000·0x00000000·0x00000000·0x001d8·0x7fba8·R···0x1000 |
| 9 | ··LOAD···········0x000000·0x00080000·0x00080000·0x00000·0x49 | 9 | ··LOAD···········0x000000·0x00080000·0x00080000·0x00000·0x492e68·R·E·0x1000 |
| 10 | ··LOAD···········0x001000·0x0051 | 10 | ··LOAD···········0x001000·0x00513000·0x00513000·0x17fecc·0x17fecc·R···0x1000 |
| 11 | ··LOAD···········0x0001 | 11 | ··LOAD···········0x00016c·0x0069316c·0x0069316c·0x00000·0x24614·RW··0x1000 |
| 12 | ··DYNAMIC········0x18 | 12 | ··DYNAMIC········0x18116c·0x0069a93c·0x0069a93c·0x00000·0x00128·RW··0x4 |
| 13 | ··NOTE···········0x0001b4·0x000001b4·0x000001b4·0x00024·0x00024·R···0x4 | 13 | ··NOTE···········0x0001b4·0x000001b4·0x000001b4·0x00024·0x00024·R···0x4 |
| 14 | ··NOTE···········0x18 | 14 | ··NOTE···········0x180eac·0x00692eac·0x00692eac·0x00020·0x00020·R···0x4 |
| 15 | ··GNU_EH_FRAME···0x001000·0x005d | 15 | ··GNU_EH_FRAME···0x001000·0x005d72f8·0x005d72f8·0x00000·0x0de0c·R···0x4 |
| 16 | ··GNU_STACK······0x000000·0x00000000·0x00000000·0x00000·0x00000·RW··0x10 | 16 | ··GNU_STACK······0x000000·0x00000000·0x00000000·0x00000·0x00000·RW··0x10 |
| 17 | ··GNU_RELRO······0x18 | 17 | ··GNU_RELRO······0x18116c·0x0069316c·0x0069316c·0x00000·0x07e94·R···0x1 |
| 18 | ·Section·to·Segment·mapping: | 18 | ·Section·to·Segment·mapping: |
| 19 | ··Segment·Sections... | 19 | ··Segment·Sections... |
| 20 | ···00····· | 20 | ···00····· |
| 21 | ···01·····.interp· | 21 | ···01·····.interp· |
| 22 | ···02·····.note.gnu.build-id·.interp·.gnu.hash·.dynsym·.dynstr·.gnu.version·.gnu.version_r·.rel.dyn·.rel.plt· | 22 | ···02·····.note.gnu.build-id·.interp·.gnu.hash·.dynsym·.dynstr·.gnu.version·.gnu.version_r·.rel.dyn·.rel.plt· |
| 23 | ···03·····.init·.plt·.plt.got·.text·.fini· | 23 | ···03·····.init·.plt·.plt.got·.text·.fini· |
| Offset 1, 49 lines modified | Offset 1, 48 lines modified | ||
| 1 | There·are· | 1 | There·are·39·section·headers,·starting·at·offset·0x15f7710: |
| 2 | Section·Headers: | 2 | Section·Headers: |
| 3 | ··[Nr]·Name··············Type············Addr·····Off····Size···ES·Flg·Lk·Inf·Al | 3 | ··[Nr]·Name··············Type············Addr·····Off····Size···ES·Flg·Lk·Inf·Al |
| 4 | ··[·0]···················NULL············00000000·000000·000000·00······0···0··0 | 4 | ··[·0]···················NULL············00000000·000000·000000·00······0···0··0 |
| 5 | ··[·1]·.note.gnu.build-id·NOTE············000001b4·0001b4·000024·00···A··0···0··4 | 5 | ··[·1]·.note.gnu.build-id·NOTE············000001b4·0001b4·000024·00···A··0···0··4 |
| 6 | ··[·2]·.interp···········NOBITS··········000001d8·0001d8·000013·00···A··0···0··1 | 6 | ··[·2]·.interp···········NOBITS··········000001d8·0001d8·000013·00···A··0···0··1 |
| 7 | ··[·3]·.gnu.hash·········NOBITS··········000001ec·0001d8·00ab | 7 | ··[·3]·.gnu.hash·········NOBITS··········000001ec·0001d8·00abb8·04···A··4···0··4 |
| 8 | ··[·4]·.dynsym···········NOBITS··········0000ad | 8 | ··[·4]·.dynsym···········NOBITS··········0000ada4·0001d8·018520·10···A··5···1··4 |
| 9 | ··[·5]·.dynstr···········NOBITS··········00023 | 9 | ··[·5]·.dynstr···········NOBITS··········000232c4·0001d8·04cbfd·00···A··0···0··1 |
| 10 | ··[·6]·.gnu.version······NOBITS··········000 | 10 | ··[·6]·.gnu.version······NOBITS··········0006fec2·0001d8·0030a4·02···A··4···0··2 |
| 11 | ··[·7]·.gnu.version_r····NOBITS··········0007 | 11 | ··[·7]·.gnu.version_r····NOBITS··········00072f68·0001d8·0002e0·00···A··5···5··4 |
| 12 | ··[·8]·.rel.dyn··········NOBITS··········00073 | 12 | ··[·8]·.rel.dyn··········NOBITS··········00073248·0001d8·00c048·08···A··4···0··4 |
| 13 | ··[·9]·.rel.plt··········NOBITS··········0007f | 13 | ··[·9]·.rel.plt··········NOBITS··········0007f290·0001d8·000918·08···A··4··24··4 |
| 14 | ··[10]·.init·············NOBITS··········00080000·001000·000020·00··AX··0···0··4 | 14 | ··[10]·.init·············NOBITS··········00080000·001000·000020·00··AX··0···0··4 |
| 15 | ··[11]·.plt··············NOBITS··········00080020·001000·001 | 15 | ··[11]·.plt··············NOBITS··········00080020·001000·001240·04··AX··0···0·16 |
| 16 | ··[12]·.plt.got··········NOBITS··········00081 | 16 | ··[12]·.plt.got··········NOBITS··········00081260·001000·000018·08··AX··0···0··8 |
| 17 | ··[13]·.text·············NOBITS··········00081 | 17 | ··[13]·.text·············NOBITS··········00081280·001000·491bd4·00··AX··0···0·64 |
| 18 | ··[14]·.fini·············NOBITS··········0051 | 18 | ··[14]·.fini·············NOBITS··········00512e54·001000·000014·00··AX··0···0··4 |
| 19 | ··[15]·.rodata···········NOBITS··········0051 | 19 | ··[15]·.rodata···········NOBITS··········00513000·001000·0c42f8·00···A··0···0·32 |
| 20 | ··[16]·.eh_frame_hdr·····NOBITS··········005d | 20 | ··[16]·.eh_frame_hdr·····NOBITS··········005d72f8·001000·00de0c·00···A··0···0··4 |
| 21 | ··[17]·.eh_frame·········NOBITS··········005e | 21 | ··[17]·.eh_frame·········NOBITS··········005e5104·001000·08f8b0·00···A··0···0··4 |
| 22 | ··[18]·.gcc_except_table·NOBITS··········0067 | 22 | ··[18]·.gcc_except_table·NOBITS··········006749b4·001000·01e4f5·00···A··0···0··4 |
| 23 | ··[19]·.note.ABI-tag·····NOTE············0069 | 23 | ··[19]·.note.ABI-tag·····NOTE············00692eac·180eac·000020·00···A··0···0··4 |
| 24 | ··[20]·.init_array·······NOBITS··········0069 | 24 | ··[20]·.init_array·······NOBITS··········0069316c·18116c·000030·04··WA··0···0··4 |
| 25 | ··[21]·.fini_array·······NOBITS··········0069 | 25 | ··[21]·.fini_array·······NOBITS··········0069319c·18116c·000004·04··WA··0···0··4 |
| 26 | ··[22]·.data.rel.ro······NOBITS··········0069 | 26 | ··[22]·.data.rel.ro······NOBITS··········006931a0·18116c·00779c·00··WA··0···0·32 |
| 27 | ··[23]·.dynamic··········NOBITS··········0069 | 27 | ··[23]·.dynamic··········NOBITS··········0069a93c·18116c·000128·08··WA··5···0··4 |
| 28 | ··[24]·.got··············NOBITS··········0069 | 28 | ··[24]·.got··············NOBITS··········0069aa64·18116c·000580·04··WA··0···0··4 |
| 29 | ··[25]·.data·············NOBITS··········0069 | 29 | ··[25]·.data·············NOBITS··········0069b000·18116c·01049c·00··WA··0···0·32 |
| 30 | ··[26]·.bss··············NOBITS··········006a | 30 | ··[26]·.bss··············NOBITS··········006ab4a0·18116c·00c2e0·00··WA··0···0·32 |
| 31 | ··[27]·.comment··········PROGBITS········00000000·18 | 31 | ··[27]·.comment··········PROGBITS········00000000·180ecc·00001e·01··MS··0···0··1 |
| 32 | ··[28]·.debug_aranges····PROGBITS········00000000·18 | 32 | ··[28]·.debug_aranges····PROGBITS········00000000·180eec·002fdf·00···C··0···0··4 |
| 33 | ··[29]·.debug_info·······PROGBITS········00000000·18 | 33 | ··[29]·.debug_info·······PROGBITS········00000000·183ecc·c47940·00···C··0···0··4 |
| 34 | ··[30]·.debug_abbrev·····PROGBITS········00000000·d | 34 | ··[30]·.debug_abbrev·····PROGBITS········00000000·dcb80c·021ada·00···C··0···0··4 |
| 35 | ··[31]·.debug_line·······PROGBITS········00000000·e | 35 | ··[31]·.debug_line·······PROGBITS········00000000·ded2e8·226688·00···C··0···0··4 |
| 36 | ··[32]·.debug_str········PROGBITS········00000000·102b59c·00041e·01·MSC··0···0··4 | ||
| 37 | ··[3 | 36 | ··[32]·.debug_line_str···PROGBITS········00000000·1013970·0012ad·01·MSC··0···0··4 |
| 38 | ··[3 | 37 | ··[33]·.debug_loclists···PROGBITS········00000000·1014c20·447877·00···C··0···0··4 |
| 39 | ··[3 | 38 | ··[34]·.debug_rnglists···PROGBITS········00000000·145c498·0fe9ee·00···C··0···0··4 |
| 40 | ··[3 | 39 | ··[35]·.gnu_debugaltlink·PROGBITS········00000000·155ae86·000044·00······0···0··1 |
| 41 | ··[3 | 40 | ··[36]·.symtab···········SYMTAB··········00000000·155aecc·0260f0·10·····37·3518··4 |
| 42 | ··[3 | 41 | ··[37]·.strtab···········STRTAB··········00000000·1580fbc·0765c0·00······0···0··1 |
| 43 | ··[3 | 42 | ··[38]·.shstrtab·········STRTAB··········00000000·15f757c·000192·00······0···0··1 |
| 44 | Key·to·Flags: | 43 | Key·to·Flags: |
| 45 | ··W·(write),·A·(alloc),·X·(execute),·M·(merge),·S·(strings),·I·(info), | 44 | ··W·(write),·A·(alloc),·X·(execute),·M·(merge),·S·(strings),·I·(info), |
| 46 | ··L·(link·order),·O·(extra·OS·processing·required),·G·(group),·T·(TLS), | 45 | ··L·(link·order),·O·(extra·OS·processing·required),·G·(group),·T·(TLS), |
| 47 | ··C·(compressed),·x·(unknown),·o·(OS·specific),·E·(exclude), | 46 | ··C·(compressed),·x·(unknown),·o·(OS·specific),·E·(exclude), |
| 48 | ··R·(retain),·D·(mbind),·p·(processor·specific) | 47 | ··R·(retain),·D·(mbind),·p·(processor·specific) |
| Offset 1, 9777 lines modified | Offset 1, 9746 lines modified | ||
| 1 | Symbol·table·'.symtab'·contains·97 | 1 | Symbol·table·'.symtab'·contains·9743·entries: |
| 2 | ···Num:····Value··Size·Type····Bind···Vis······Ndx·Name | 2 | ···Num:····Value··Size·Type····Bind···Vis······Ndx·Name |
| 3 | ·····0:·00000000·····0·NOTYPE··LOCAL··DEFAULT··UND· | 3 | ·····0:·00000000·····0·NOTYPE··LOCAL··DEFAULT··UND· |
| 4 | ·····1:·00000000·····0·FILE····LOCAL··DEFAULT··ABS·Scrt1.o | 4 | ·····1:·00000000·····0·FILE····LOCAL··DEFAULT··ABS·Scrt1.o |
| 5 | ·····2:·0069 | 5 | ·····2:·00692eac····32·OBJECT··LOCAL··DEFAULT···19·__abi_tag |
| 6 | ·····3:·00000000·····0·FILE····LOCAL··DEFAULT··ABS·parsmultistate.cpp | 6 | ·····3:·00000000·····0·FILE····LOCAL··DEFAULT··ABS·parsmultistate.cpp |
| 7 | ·····4:·00081 | 7 | ·····4:·00081280···182·FUNC····LOCAL··DEFAULT···13·_Z16doParsMultiStateR6Params.cold |
| 8 | ·····5:·00000000·····0·FILE····LOCAL··DEFAULT··ABS·alignment.cpp | 8 | ·····5:·00000000·····0·FILE····LOCAL··DEFAULT··ABS·alignment.cpp |
| 9 | ·····6:·000e8 | 9 | ·····6:·000e84a0···423·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment12convertStateEcN3PML7SeqTypeE.part.0 |
| 10 | ·····7:·000e8 | 10 | ·····7:·000e8690····46·FUNC····LOCAL··DEFAULT···13·_ZN5Eigen15PlainObjectBaseINS_6MatrixIdLin1ELin1ELi0ELin1ELin1EEEE6resizeEii.part.0 |
| 11 | ·····8:·000e8 | 11 | ·····8:·000e86c0····46·FUNC····LOCAL··DEFAULT···13·_ZN5Eigen15PlainObjectBaseINS_6MatrixIiLin1ELi1ELi0ELin1ELi1EEEE6resizeEi.part.0 |
| 12 | ·····9:·000e8 | 12 | ·····9:·000e86f0····46·FUNC····LOCAL··DEFAULT···13·_ZN5Eigen8internal17resize_if_allowedINS_6MatrixIdLin1ELin1ELi0ELin1ELin1EEENS_14CwiseNullaryOpINS0_18scalar_constant_opIdEES3_EEddEEvRT_RKT0_RKNS0_9assign_opIT1_T2_EE.part.0 |
| 13 | ····10:·000e8 | 13 | ····10:·000e8720····46·FUNC····LOCAL··DEFAULT···13·_ZN5Eigen15PlainObjectBaseINS_6MatrixIdLi1ELin1ELi1ELi1ELin1EEEE6resizeEii.part.0 |
| 14 | ····11:·000e8 | 14 | ····11:·000e8750····46·FUNC····LOCAL··DEFAULT···13·_ZNK5Eigen10SolverBaseINS_9FullPivLUINS_6MatrixIdLin1ELin1ELi0ELin1ELin1EEEEEE22_check_solve_assertionILb0ENS_10MatrixBaseINS_14CwiseNullaryOpINS_8internal18scalar_identity_opIdEES3_EEEEEEvRKT0_.part.0 |
| 15 | ····12:·00120 | 15 | ····12:·00120540···564·FUNC····LOCAL··DEFAULT···13·_ZN5Eigen8internal13gemm_pack_rhsIdiNS0_22const_blas_data_mapperIdiLi0EEELi4ELi0ELb0ELb0EEclEPdRKS3_iiii.isra.0 |
| 16 | ····13:·00120 | 16 | ····13:·00120780··2227·FUNC····LOCAL··DEFAULT···13·_ZN5Eigen8internal29general_matrix_vector_productIidNS0_22const_blas_data_mapperIdiLi0EEELi0ELb0EdNS2_IdiLi1EEELb0ELi0EE3runEiiRKS3_RKS4_Pdid.isra.0 |
| 17 | ····14:·000e8 | 17 | ····14:·000e8780···363·FUNC····LOCAL··DEFAULT···13·_ZN5Eigen8internal13gemm_pack_lhsIdiNS0_22const_blas_data_mapperIdiLi0EEELi2ELi2EDv2_dLi0ELb0ELb0EEclEPdRKS3_iiii.isra.0 |
| 18 | ····15:·000e8 | 18 | ····15:·000e88f0···652·FUNC····LOCAL··DEFAULT···13·_ZN5Eigen8internal13gemm_pack_rhsIdiNS0_16blas_data_mapperIdiLi0ELi0ELi1EEELi4ELi0ELb0ELb1EEclEPdRKS3_iiii.isra.0 |
| 19 | ····16:·000e | 19 | ····16:·000e8b80··1482·FUNC····LOCAL··DEFAULT···13·_ZN5boost4math5tools6detail23evaluate_rational_c_impIeyeEET1_PKT_PKT0_RKS4_PKSt17integral_constantIiLi17EE.isra.0 |
| 20 | ····17:·000e9 | 20 | ····17:·000e9150···167·FUNC····LOCAL··DEFAULT···13·_ZNSt7__cxx1112basic_stringIcSt11char_traitsIcESaIcEE12_M_constructIPKcEEvT_S8_St20forward_iterator_tag.isra.0 |
| 21 | ····18:·000e9 | 21 | ····18:·000e92a0··2435·FUNC····LOCAL··DEFAULT···13·_ZN5Eigen8internal22lhs_process_one_packetILi4ELi2ELi1EdddDv2_dS2_S2_S2_NS0_11gebp_traitsIddLb0ELb0ELi1ELi0EEENS0_16BlasLinearMapperIdiLi0ELi1EEENS0_16blas_data_mapperIdiLi0ELi0ELi1EEEEclERKS8_PKdSD_diiiiiiiiiiii.isra.0 |
| 22 | ····19:·000e | 22 | ····19:·000e9c30··1092·FUNC····LOCAL··DEFAULT···13·_ZN5Eigen8internal11gebp_kernelIddiNS0_16blas_data_mapperIdiLi0ELi0ELi1EEELi2ELi4ELb0ELb0EEclERKS3_PKdS8_iiidiiii.isra.0 |
| 23 | ····20:·000ea | 23 | ····20:·000ea080···257·FUNC····LOCAL··DEFAULT···13·_ZNSt3tr110_HashtableISt6vectorIjSaIjEESt4pairIKS3_iESaIS6_ESt10_Select1stIS6_ESt8equal_toIS3_E11hashPatternNS_8__detail18_Mod_range_hashingENSD_20_Default_ranged_hashENSD_20_Prime_rehash_policyELb0ELb0ELb1EE4findERS5_.isra.0 |
| 24 | ····21:·000ea | 24 | ····21:·000ea190···167·FUNC····LOCAL··DEFAULT···13·_ZNSt7__cxx1112basic_stringIcSt11char_traitsIcESaIcEE12_M_constructIPcEEvT_S7_St20forward_iterator_tag.isra.0 |
| 25 | ····22:·000ea | 25 | ····22:·000ea240···389·FUNC····LOCAL··DEFAULT···13·_ZNSt6vectorIiSaIiEEaSERKS1_.isra.0 |
| 26 | ····23:·000ea | 26 | ····23:·000ea4a0···176·FUNC····LOCAL··DEFAULT···13·_ZNSt7__cxx1112basic_stringIcSt11char_traitsIcESaIcEEC2EPKcRKS3_.isra.0 |
| 27 | ····24:·00081 | 27 | ····24:·0008170a····33·FUNC····LOCAL··DEFAULT···13·_ZNSt7__cxx1112basic_stringIcSt11char_traitsIcESaIcEEC2EPKcRKS3_.isra.0.cold |
| 28 | ····25:·000ea | 28 | ····25:·000ea550···704·FUNC····LOCAL··DEFAULT···13·_ZNSt3tr18__detail9_Map_baseIjSt4pairIKjjESt10_Select1stIS4_ELb1ENS_10_HashtableIjS4_SaIS4_ES6_St8equal_toIjENS_4hashIjEENS0_18_Mod_range_hashingENS0_20_Default_ranged_hashENS0_20_Prime_rehash_policyELb0ELb0ELb1EEEEixERS3_.isra.0 |
| 29 | ····26:·00081 | 29 | ····26:·0008172c····48·FUNC····LOCAL··DEFAULT···13·_ZNSt3tr18__detail9_Map_baseIjSt4pairIKjjESt10_Select1stIS4_ELb1ENS_10_HashtableIjS4_SaIS4_ES6_St8equal_toIjENS_4hashIjEENS0_18_Mod_range_hashingENS0_20_Default_ranged_hashENS0_20_Prime_rehash_policyELb0ELb0ELb1EEEEixERS3_.isra.0.cold |
| 30 | ····27:·00081 | 30 | ····27:·0008175c···192·FUNC····LOCAL··DEFAULT···13·_ZStplIcSt11char_traitsIcESaIcEENSt7__cxx1112basic_stringIT_T0_T1_EEPKS5_RKS8_.isra.0 |
| 31 | ····28:·000ea | 31 | ····28:·000ea810···329·FUNC····LOCAL··DEFAULT···13·_ZNSt8_Rb_treeINSt7__cxx1112basic_stringIcSt11char_traitsIcESaIcEEESt4pairIKS5_iESt10_Select1stIS8_ESt4lessIS5_ESaIS8_EE24_M_get_insert_unique_posERS7_.isra.0 |
| 32 | ····29:·00081 | 32 | ····29:·0008181c···130·FUNC····LOCAL··DEFAULT···13·_ZStplIcSt11char_traitsIcESaIcEENSt7__cxx1112basic_stringIT_T0_T1_EEOS8_RKS8_.isra.0 |
| 33 | ····30:·000ea | 33 | ····30:·000ea960···620·FUNC····LOCAL··DEFAULT···13·_ZNSt6vectorINSt7__cxx1112basic_stringIcSt11char_traitsIcESaIcEEESaIS5_EEaSERKS7_.isra.0 |
| 34 | ····31:·00081 | 34 | ····31:·0008189e···168·FUNC····LOCAL··DEFAULT···13·_ZNSt6vectorINSt7__cxx1112basic_stringIcSt11char_traitsIcESaIcEEESaIS5_EEaSERKS7_.isra.0.cold |
| 35 | ····32:·000e | 35 | ····32:·000eabd0···636·FUNC····LOCAL··DEFAULT···13·_ZNSt8_Rb_treeINSt7__cxx1112basic_stringIcSt11char_traitsIcESaIcEEESt4pairIKS5_iESt10_Select1stIS8_ESt4lessIS5_ESaIS8_EE8_M_eraseEPSt13_Rb_tree_nodeIS8_E.isra.0 |
| 36 | ····33:·000e | 36 | ····33:·000eae50···768·FUNC····LOCAL··DEFAULT···13·_ZSt25__unguarded_linear_insertIN9__gnu_cxx17__normal_iteratorIPNSt7__cxx1112basic_stringIcSt11char_traitsIcESaIcEEESt6vectorIS7_SaIS7_EEEENS0_5__ops14_Val_less_iterEEvT_T0_.isra.0 |
| 37 | ····34:·000eb | 37 | ····34:·000eb150··1230·FUNC····LOCAL··DEFAULT···13·_ZSt16__insertion_sortIN9__gnu_cxx17__normal_iteratorIPNSt7__cxx1112basic_stringIcSt11char_traitsIcESaIcEEESt6vectorIS7_SaIS7_EEEENS0_5__ops15_Iter_less_iterEEvT_SF_T0_.isra.0 |
| 38 | ····35:·000eb | 38 | ····35:·000eb620··2044·FUNC····LOCAL··DEFAULT···13·_ZSt13__adjust_heapIN9__gnu_cxx17__normal_iteratorIPNSt7__cxx1112basic_stringIcSt11char_traitsIcESaIcEEESt6vectorIS7_SaIS7_EEEEiS7_NS0_5__ops15_Iter_less_iterEEvT_T0_SG_T1_T2_.isra.0 |
| 39 | ····36:·000e | 39 | ····36:·000ebe20···866·FUNC····LOCAL··DEFAULT···13·_ZN5boost4math6detail16lgamma_small_impIeNS0_8policies6policyINS3_13promote_floatILb0EEENS3_14promote_doubleILb0EEENS3_14default_policyES9_S9_S9_S9_S9_S9_S9_S9_S9_S9_EENS0_7lanczos12lanczos17m64EEET_SD_SD_SD_RKSt17integral_constantIiLi64EERKT0_RKT1_.isra.0 |
| 40 | ····37:·000ec | 40 | ····37:·000ec190···965·FUNC····LOCAL··DEFAULT···13·_ZNSt8_Rb_treeINSt7__cxx1112basic_stringIcSt11char_traitsIcESaIcEEESt4pairIKS5_iESt10_Select1stIS8_ESt4lessIS5_ESaIS8_EE22_M_emplace_hint_uniqueIJRKSt21piecewise_construct_tSt5tupleIJRS7_EESJ_IJEEEEESt17_Rb_tree_iteratorIS8_ESt23_Rb_tree_const_iteratorIS8_EDpOT_.isra.0 |
| 41 | ····38:·00081 | 41 | ····38:·00081946····93·FUNC····LOCAL··DEFAULT···13·_ZNSt8_Rb_treeINSt7__cxx1112basic_stringIcSt11char_traitsIcESaIcEEESt4pairIKS5_iESt10_Select1stIS8_ESt4lessIS5_ESaIS8_EE22_M_emplace_hint_uniqueIJRKSt21piecewise_construct_tSt5tupleIJRS7_EESJ_IJEEEEESt17_Rb_tree_iteratorIS8_ESt23_Rb_tree_const_iteratorIS8_EDpOT_.isra.0.cold |
| 42 | ····39:·000ec | 42 | ····39:·000ec560··1477·FUNC····LOCAL··DEFAULT···13·_ZN5boost4math6detail7erf_impIeNS0_8policies6policyINS3_13promote_floatILb0EEENS3_14promote_doubleILb0EEENS3_14default_policyES9_S9_S9_S9_S9_S9_S9_S9_S9_S9_EEEET_SB_bRKT0_RKSt17integral_constantIiLi64EE.isra.0 |
| 43 | ····40:·000e | 43 | ····40:·000ecb30····41·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment10getSeqNameB5cxx11Ei.part.0 |
| 44 | ····41:·000e | 44 | ····41:·000ecb60···726·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment16convertPomoStateEi.part.0 |
| 45 | ····42:·00081 | 45 | ····42:·000819a4·····5·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment16convertPomoStateEi.part.0.cold |
| 46 | ····43:·00081 | 46 | ····43:·000819aa···221·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment14computeObsDistEii.cold |
| 47 | ····44:·00081 | 47 | ····44:·00081a88····28·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment23computeDivergenceMatrixEPdS0_b.cold |
| 48 | ····45:·00081 | 48 | ····45:·00081aa4···161·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment13checkGappySeqEb.cold |
| 49 | ····46:·00081 | 49 | ····46:·00081b45···323·FUNC····LOCAL··DEFAULT···13·_Z23getDataBlockMorphStatesP18NxsCharactersBlock.cold |
| 50 | ····47:·00081 | 50 | ····47:·00081c88·····5·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment19printSiteInfoHeaderERSoPKcb.cold |
| 51 | ····48:·00081 | 51 | ····48:·00081c8e···133·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment19convertStateBackStrB5cxx11Ej.cold |
| 52 | ····49:·00081 | 52 | ····49:·00081d14···379·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment17checkAbsentStatesENSt7__cxx1112basic_stringIcSt11char_traitsIcESaIcEEE.cold |
| 53 | ····50:·00081 | 53 | ····50:·00081e90····78·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment9initCodonEPc.cold |
| 54 | ····51:·00081 | 54 | ····51:·00081ede····32·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment18getSiteFromResidueEiRiS0_.cold |
| 55 | ····52:·00081 | 55 | ····52:·00081efe···304·FUNC····LOCAL··DEFAULT···13·_Z13convert_rangePKcRiS1_S1_RPc.cold |
| 56 | ····53:·00082 | 56 | ····53:·0008202e·····5·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment9printDistERSoPd.cold |
| 57 | ····54:·00082 | 57 | ····54:·00082034····19·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment21countStatePerSequenceEPj.cold |
| 58 | ····55:·00082 | 58 | ····55:·00082048····28·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment27computeStateFreqPerSequenceEPd.cold |
| 59 | ····56:·00082 | 59 | ····56:·00082064·····9·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment18convertCountToFreqEPjPd.cold |
| 60 | ····57:·00082 | 60 | ····57:·0008206e····10·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment16computeStateFreqEPdj.cold |
| 61 | ····58:·00082 | 61 | ····58:·00082078····64·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment16computeCodonFreqE13StateFreqTypePdS1_.cold |
| 62 | ····59:·00082 | 62 | ····59:·000820b8····39·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment15multinomialProbES_Rd.cold |
| 63 | ····60:·00082 | 63 | ····60:·000820e0····17·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment15multinomialProbERSt6vectorIiSaIiEE.cold |
| 64 | ····61:·00082 | 64 | ····61:·000820f1···676·FUNC····LOCAL··DEFAULT···13·_Z10processSeqRNSt7__cxx1112basic_stringIcSt11char_traitsIcESaIcEEES5_i.cold |
| 65 | ····62:·00082 | 65 | ····62:·00082396···228·FUNC····LOCAL··DEFAULT···13·_ZN9AlignmentC2Ev.cold |
| 66 | ····63:·00082 | 66 | ····63:·0008247a···537·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment13printSiteGapsEPKc.cold |
| 67 | ····64:·0052 | 67 | ····64:·00520768····22·OBJECT··LOCAL··DEFAULT···15·_ZL16ERR_WRITE_OUTPUT |
| 68 | ····65:·00082 | 68 | ····65:·00082694···368·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment9printDistEPKcPd.cold |
| 69 | ····66:·00082 | 69 | ····66:·00082804···400·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment14printAlignmentE9InputTypePKcbS2_iS2_.cold |
| 70 | ····67:·00082 | 70 | ····67:·00082994····23·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment24createBootstrapAlignmentERSt6vectorIiSaIiEEPKc.cold |
| 71 | ····68:·00082 | 71 | ····68:·000829ac····83·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment17checkIdenticalSeqEv.cold |
| 72 | ····69:·00082 | 72 | ····69:·00082a00···198·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment15multinomialProbEPdRd.cold |
| 73 | ····70:·00082 | 73 | ····70:·00082ac6···199·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment15multinomialProbESt6vectorIdSaIdEERd.cold |
| 74 | ····71:·00082 | 74 | ····71:·00082b8e··1004·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment19buildRetainingSitesEPKcRSt6vectorIiSaIiEEiS1_.cold |
| 75 | ····72:·0052 | 75 | ····72:·00520780····55·OBJECT··LOCAL··DEFAULT···15·_ZL14ERR_READ_INPUT |
| 76 | ····73:·0008 | 76 | ····73:·00082f7a···169·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment11printPhylipERSobPKciS2_b.cold |
| 77 | ····74:·00083 | 77 | ····74:·00083024···169·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment10printFastaERSobPKciS2_.cold |
| 78 | ····75:·00083 | 78 | ····75:·000830ce···320·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment10printNexusERSobPKciS2_b.cold |
| 79 | ····76:·00083 | 79 | ····76:·0008320e···873·FUNC····LOCAL··DEFAULT···13·_Z13extractSiteIDP9AlignmentPKcRSt6vectorIiSaIiEE.cold |
| 80 | ····77:·00083 | 80 | ····77:·00083578···407·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment24createBootstrapAlignmentEPiPKcS0_.cold |
| 81 | ····78:·00083 | 81 | ····78:·00083710···872·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment8readDistERSiPd.cold |
| 82 | ····79:·00083 | 82 | ····79:·00083a78···759·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment8readDistEPKcPd.cold |
| 83 | ····80:·000f9 | 83 | ····80:·000f96a0··1522·FUNC····LOCAL··DEFAULT···13·_ZSt16__introsort_loopIN9__gnu_cxx17__normal_iteratorIPNSt7__cxx1112basic_stringIcSt11char_traitsIcESaIcEEESt6vectorIS7_SaIS7_EEEEiNS0_5__ops15_Iter_less_iterEEvT_SF_T0_T1_.isra.0 |
| 84 | ····81:·000f | 84 | ····81:·000f9ca0··2200·FUNC····LOCAL··DEFAULT···13·_ZNSt6vectorINSt7__cxx1112basic_stringIcSt11char_traitsIcESaIcEEESaIS5_EE15_M_range_insertIN9__gnu_cxx17__normal_iteratorIPS5_S7_EEEEvSC_T_SD_St20forward_iterator_tag.isra.0 |
| 85 | ····82:·00083 | 85 | ····82:·00083d70···110·FUNC····LOCAL··DEFAULT···13·_ZNSt6vectorINSt7__cxx1112basic_stringIcSt11char_traitsIcESaIcEEESaIS5_EE15_M_range_insertIN9__gnu_cxx17__normal_iteratorIPS5_S7_EEEEvSC_T_SD_St20forward_iterator_tag.isra.0.cold |
| 86 | ····83:·00083 | 86 | ····83:·00083dde···532·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment12checkSeqNameEv.cold |
| 87 | ····84:·0008 | 87 | ····84:·00083ff2····56·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment10addPatternER7Patternii.cold |
| 88 | ····85:·000e | 88 | ····85:·000e3f80····84·FUNC····LOCAL··DEFAULT···13·_ZN5boost4math3erfIeNS0_8policies6policyINS2_13promote_floatILb0EEENS2_14promote_doubleILb0EEENS2_14default_policyES8_S8_S8_S8_S8_S8_S8_S8_S8_S8_EEEENS0_5tools12promote_argsIT_fffffE4typeESC_RKT0_.isra.0 |
| 89 | ····86:·000fc | 89 | ····86:·000fc050···482·FUNC····LOCAL··DEFAULT···13·_ZN5boost4math6detail18full_igamma_prefixIeNS0_8policies6policyINS3_13promote_floatILb0EEENS3_14promote_doubleILb0EEENS3_14default_policyES9_S9_S9_S9_S9_S9_S9_S9_S9_S9_EEEET_SB_SB_RKT0_.isra.0 |
| 90 | ····87:·000fc | 90 | ····87:·000fc240··1045·FUNC····LOCAL··DEFAULT···13·_ZN5boost4math6detail8beta_impIeNS0_7lanczos12lanczos17m64ENS0_8policies6policyINS5_13promote_floatILb0EEENS5_14promote_doubleILb0EEENS5_14default_policyESB_SB_SB_SB_SB_SB_SB_SB_SB_SB_EEEET_SD_SD_RKT0_RKT1_.isra.0 |
| 91 | ····88:·000fc | 91 | ····88:·000fc660····98·FUNC····LOCAL··DEFAULT···13·_ZN5boost4math6detail4betaIeeNS0_8policies6policyINS3_13promote_floatILb0EEENS3_14promote_doubleILb0EEENS3_14default_policyES9_S9_S9_S9_S9_S9_S9_S9_S9_S9_EEEENS0_5tools12promote_argsIT_T0_ffffE4typeESD_SE_RKT1_PKSt17integral_constantIbLb1EE.isra.0 |
| 92 | ····89:·000fc | 92 | ····89:·000fc6d0···542·FUNC····LOCAL··DEFAULT···13·_ZN5boost4math20binomial_coefficientIeNS0_8policies6policyINS2_13promote_floatILb0EEENS2_14promote_doubleILb0EEENS2_14default_policyES8_S8_S8_S8_S8_S8_S8_S8_S8_S8_EEEET_jjRKT0_.isra.0 |
| 93 | ····90:·000fc | 93 | ····90:·000fc8f0··4044·FUNC····LOCAL··DEFAULT···13·_ZN5boost4math6detail17ibeta_power_termsIeNS0_7lanczos12lanczos17m64ENS0_8policies6policyINS5_13promote_floatILb0EEENS5_14promote_doubleILb0EEENS5_14default_policyESB_SB_SB_SB_SB_SB_SB_SB_SB_SB_EEEET_SD_SD_SD_SD_RKT0_bRKT1_SD_PKc.isra.0 |
| 94 | ····91:·000fd | 94 | ····91:·000fd8c0···769·FUNC····LOCAL··DEFAULT···13·_ZN5boost4math6detail15ibeta_fraction2IeNS0_8policies6policyINS3_13promote_floatILb0EEENS3_14promote_doubleILb0EEENS3_14default_policyES9_S9_S9_S9_S9_S9_S9_S9_S9_S9_EEEET_SB_SB_SB_SB_RKT0_bPSB_.isra.0 |
| 95 | ····92:·000f | 95 | ····92:·000fdbd0··1124·FUNC····LOCAL··DEFAULT···13·_ZN5boost4math6detail9powm1_impIeNS0_8policies6policyINS3_13promote_floatILb0EEENS3_14promote_doubleILb0EEENS3_14default_policyES9_S9_S9_S9_S9_S9_S9_S9_S9_S9_EEEET_SB_SB_RKT0_.isra.0 |
| 96 | ····93:·000fe | 96 | ····93:·000fe040···849·FUNC····LOCAL··DEFAULT···13·_ZN5boost4math6detail9gamma_impIeNS0_8policies6policyINS3_13promote_floatILb0EEENS3_14promote_doubleILb0EEENS3_14default_policyES9_S9_S9_S9_S9_S9_S9_S9_S9_S9_EENS0_7lanczos12lanczos17m64EEET_SD_RKT0_RKT1_.isra.0 |
| 97 | ····94:·000fe | 97 | ····94:·000fe3a0···796·FUNC····LOCAL··DEFAULT···13·_ZN5boost4math6detail10lgamma_impIeNS0_8policies6policyINS3_13promote_floatILb0EEENS3_14promote_doubleILb0EEENS3_14default_policyES9_S9_S9_S9_S9_S9_S9_S9_S9_S9_EENS0_7lanczos12lanczos17m64EEET_SD_RKT0_RKT1_Pi.isra.0 |
| 98 | ····95:·000e | 98 | ····95:·000e3fe0····86·FUNC····LOCAL··DEFAULT···13·_ZN5boost4math6lgammaIeNS0_8policies6policyINS2_13promote_floatILb0EEENS2_14promote_doubleILb0EEENS2_14default_policyES8_S8_S8_S8_S8_S8_S8_S8_S8_S8_EEEENS0_5tools12promote_argsIT_fffffE4typeESC_PiRKT0_.isra.0 |
| 99 | ····96:·000fe | 99 | ····96:·000fe6c0···697·FUNC····LOCAL··DEFAULT···13·_ZN5boost4math6detail30tgamma_delta_ratio_imp_lanczosIeNS0_8policies6policyINS3_13promote_floatILb0EEENS3_14promote_doubleILb0EEENS3_14default_policyES9_S9_S9_S9_S9_S9_S9_S9_S9_S9_EENS0_7lanczos12lanczos17m64EEET_SD_SD_RKT0_RKT1_.isra.0 |
| 100 | ····97:·000fe | 100 | ····97:·000fe980···114·FUNC····LOCAL··DEFAULT···13·_ZN5boost4math8policies23check_series_iterationsIeNS1_6policyINS1_13promote_floatILb0EEENS1_14promote_doubleILb0EEENS1_14default_policyES8_S8_S8_S8_S8_S8_S8_S8_S8_S8_EEEEvPKcyRKT0_.part.0 |
| 101 | ····98:·000f | 101 | ····98:·000fea00··1595·FUNC····LOCAL··DEFAULT···13·_ZN5boost4math6detail24regularised_gamma_prefixIeNS0_8policies6policyINS3_13promote_floatILb0EEENS3_14promote_doubleILb0EEENS3_14default_policyES9_S9_S9_S9_S9_S9_S9_S9_S9_S9_EENS0_7lanczos12lanczos17m64EEET_SD_SD_RKT0_RKT1_.isra.0 |
| 102 | ····99:·000ff | 102 | ····99:·000ff040··1767·FUNC····LOCAL··DEFAULT···13·_ZN5boost4math6detail12ibeta_seriesIeNS0_7lanczos12lanczos17m64ENS0_8policies6policyINS5_13promote_floatILb0EEENS5_14promote_doubleILb0EEENS5_14default_policyESB_SB_SB_SB_SB_SB_SB_SB_SB_SB_EEEET_SD_SD_SD_SD_RKT0_bPSD_SD_RKT1_.isra.0 |
| 103 | ···100:·000ff | 103 | ···100:·000ff730··9796·FUNC····LOCAL··DEFAULT···13·_ZN5boost4math6detail20gamma_incomplete_impIeNS0_8policies6policyINS3_13promote_floatILb0EEENS3_14promote_doubleILb0EEENS3_14default_policyES9_S9_S9_S9_S9_S9_S9_S9_S9_S9_EEEET_SB_SB_bbRKT0_PSB_.isra.0 |
| 104 | ···101:·00084 | 104 | ···101:·0008402a···105·FUNC····LOCAL··DEFAULT···13·_ZN5boost4math6detail20gamma_incomplete_impIeNS0_8policies6policyINS3_13promote_floatILb0EEENS3_14promote_doubleILb0EEENS3_14default_policyES9_S9_S9_S9_S9_S9_S9_S9_S9_S9_EEEET_SB_SB_bbRKT0_PSB_.isra.0.cold |
| 105 | ···102:·0010 | 105 | ···102:·00101d80··2045·FUNC····LOCAL··DEFAULT···13·_ZN5boost4math6detail27beta_small_b_large_a_seriesIeNS0_8policies6policyINS3_13promote_floatILb0EEENS3_14promote_doubleILb0EEENS3_14default_policyES9_S9_S9_S9_S9_S9_S9_S9_S9_S9_EEEET_SB_SB_SB_SB_SB_SB_RKT0_b.isra.0 |
| 106 | ···103:·00102 | 106 | ···103:·00102580··7962·FUNC····LOCAL··DEFAULT···13·_ZN13SymTestResult13computePvalueEv.part.0 |
| 107 | ···104:·00084 | 107 | ···104:·00084094····96·FUNC····LOCAL··DEFAULT···13·_ZN13SymTestResult13computePvalueEv.part.0.cold |
| 108 | ···105:·00104 | 108 | ···105:·001044c0···362·FUNC····LOCAL··DEFAULT···13·_ZN5Eigen8internal19gemv_dense_selectorILi2ELi1ELb1EE3runINS_9TransposeIKNS_6MatrixIdLin1ELin1ELi0ELin1ELin1EEEEENS4_IKNS4_INS5_IdLin1ELi1ELi0ELin1ELi1EEEEEEENS4_INS5_IdLi1ELin1ELi1ELi1ELin1EEEEEEEvRKT_RKT0_RT1_RKNSL_6ScalarE.isra.0 |
| 109 | ···106:·00084 | 109 | ···106:·000840f4····22·FUNC····LOCAL··DEFAULT···13·_ZN5Eigen8internal19gemv_dense_selectorILi2ELi1ELb1EE3runINS_9TransposeIKNS_6MatrixIdLin1ELin1ELi0ELin1ELin1EEEEENS4_IKNS4_INS5_IdLin1ELi1ELi0ELin1ELi1EEEEEEENS4_INS5_IdLi1ELin1ELi1ELi1ELin1EEEEEEEvRKT_RKT0_RT1_RKNSL_6ScalarE.isra.0.cold |
| 110 | ···107:·001 | 110 | ···107:·0012fa30···437·FUNC····LOCAL··DEFAULT···13·_ZN5Eigen8internal16parallelize_gemmILb1ENS0_12gemm_functorIdiNS0_29general_matrix_matrix_productIidLi0ELb0EdLi0ELb0ELi0ELi1EEENS_5BlockIKNS_6MatrixIdLin1ELin1ELi0ELin1ELin1EEELin1ELin1ELb0EEENS5_IS7_Lin1ELin1ELb0EEES7_NS0_19gemm_blocking_spaceILi0EddLin1ELin1ELin1ELi1ELb0EEEEEiEEvRKT0_T1_SH_SH_b._omp_fn.0 |
| 111 | ···108:·00104 | 111 | ···108:·00104630··1509·FUNC····LOCAL··DEFAULT···13·_ZNK5Eigen9DenseBaseINS_13CwiseBinaryOpINS_8internal17scalar_product_opIddEEKNS_9TransposeIKNS_7ProductINS5_INS_6MatrixIdLin1ELi1ELi0ELin1ELi1EEEEENS_7InverseINS_9FullPivLUINS7_IdLin1ELin1ELi0ELin1ELin1EEEEEEELi0EEEEEKS8_EEE5reduxINS2_13scalar_sum_opIddEEEEdRKT_.isra.0 |
| 112 | ···109:·00084 | 112 | ···109:·0008410a···285·FUNC····LOCAL··DEFAULT···13·_ZNK5Eigen9DenseBaseINS_13CwiseBinaryOpINS_8internal17scalar_product_opIddEEKNS_9TransposeIKNS_7ProductINS5_INS_6MatrixIdLin1ELi1ELi0ELin1ELi1EEEEENS_7InverseINS_9FullPivLUINS7_IdLin1ELin1ELi0ELin1ELin1EEEEEEELi0EEEEEKS8_EEE5reduxINS2_13scalar_sum_opIddEEEEdRKT_.isra.0.cold |
| 113 | ···110:·000e4 | 113 | ···110:·000e4040···388·FUNC····LOCAL··DEFAULT···13·_GLOBAL__sub_I_symbols_protein |
| 114 | ···111:·00084 | 114 | ···111:·00084228···307·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment16extractDataBlockEP18NxsCharactersBlock.cold |
| 115 | ···112:·00084 | 115 | ···112:·0008435c···273·FUNC····LOCAL··DEFAULT···13·_ZN9AlignmentC2EP12NxsDataBlockPcNSt7__cxx1112basic_stringIcSt11char_traitsIcESaIcEEE.cold |
| 116 | ···113:·00084 | 116 | ···113:·0008446e···483·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment9readNexusEPc.cold |
| 117 | ···114:·00084 | 117 | ···114:·00084652···102·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment13printSiteInfoERSoi.cold |
| 118 | ···115:·00084 | 118 | ···115:·000846b8···209·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment13printSiteInfoEPKc.cold |
| 119 | ···116:·00084 | 119 | ···116:·0008478a····68·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment16addConstPatternsEPc.cold |
| 120 | ···117:·00084 | 120 | ···117:·000847ce···199·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment22orderPatternByNumCharsEi.cold |
| 121 | ···118:·00084 | 121 | ···118:·00084896···155·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment18ungroupSitePatternEv.cold |
| 122 | ···119:·00084 | 122 | ···119:·00084932···180·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment18regroupSitePatternEiRSt6vectorIiSaIiEE.cold |
| 123 | ···120:·00084 | 123 | ···120:·000849e6··1403·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment17readSiteStateFreqEPKc.cold |
| 124 | ···121:·0008 | 124 | ···121:·00084f62··1418·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment12buildPatternERSt6vectorINSt7__cxx1112basic_stringIcSt11char_traitsIcESaIcEEESaIS6_EEPcii.cold |
| 125 | ···122:·00085 | 125 | ···122:·000854ec··1052·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment10readPhylipEPcS0_.cold |
| 126 | ···123:·00085 | 126 | ···123:·00085908··1859·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment20readPhylipSequentialEPcS0_.cold |
| Max diff block lines reached; 2026462/2082889 bytes (97.29%) of diff not shown. | |||
| Offset 1, 8 lines modified | Offset 1, 8 lines modified | ||
| 1 | Displaying·notes·found·in:·.note.gnu.build-id | 1 | Displaying·notes·found·in:·.note.gnu.build-id |
| 2 | ··Owner················Data·size·» Description | 2 | ··Owner················Data·size·» Description |
| 3 | ··GNU··················0x00000014» NT_GNU_BUILD_ID·(unique·build·ID·bitstring)» ····Build·ID:· | 3 | ··GNU··················0x00000014» NT_GNU_BUILD_ID·(unique·build·ID·bitstring)» ····Build·ID:·24050f60278d2c0a2b2ce267779cd6da32fb3014 |
| 4 | Displaying·notes·found·in:·.note.ABI-tag | 4 | Displaying·notes·found·in:·.note.ABI-tag |
| 5 | ··Owner················Data·size·» Description | 5 | ··Owner················Data·size·» Description |
| 6 | ··GNU··················0x00000010» NT_GNU_ABI_TAG·(ABI·version·tag)» ····OS:·Linux,·ABI:·3.2.0 | 6 | ··GNU··················0x00000010» NT_GNU_ABI_TAG·(ABI·version·tag)» ····OS:·Linux,·ABI:·3.2.0 |
| Offset 25, 15 lines modified | Offset 25, 15 lines modified | ||
| 25 | ··Opcode·9·has·1·arg | 25 | ··Opcode·9·has·1·arg |
| 26 | ··Opcode·10·has·0·args | 26 | ··Opcode·10·has·0·args |
| 27 | ··Opcode·11·has·0·args | 27 | ··Opcode·11·has·0·args |
| 28 | ··Opcode·12·has·1·arg | 28 | ··Opcode·12·has·1·arg |
| 29 | ·The·Directory·Table·(offset·0x22,·lines·22,·columns·1): | 29 | ·The·Directory·Table·(offset·0x22,·lines·22,·columns·1): |
| 30 | ··Entry» Name | 30 | ··Entry» Name |
| 31 | ··0» (line_strp)» (offset:·0x1e):·./build.mp | 31 | ··0» (line_strp)» (offset:·0x1e):·./build.omp |
| 32 | ··1» (line_strp)» (offset:·0x2a):·./obsolete | 32 | ··1» (line_strp)» (offset:·0x2a):·./obsolete |
| 33 | ··2» (line_strp)» (offset:·0x35):·/usr/include/c++/14/bits | 33 | ··2» (line_strp)» (offset:·0x35):·/usr/include/c++/14/bits |
| 34 | ··3» (line_strp)» (offset:·0x4e):·/usr/include/c++/14 | 34 | ··3» (line_strp)» (offset:·0x4e):·/usr/include/c++/14 |
| 35 | ··4» (line_strp)» (offset:·0x62):·/usr/include/c++/14/debug | 35 | ··4» (line_strp)» (offset:·0x62):·/usr/include/c++/14/debug |
| 36 | ··5» (line_strp)» (offset:·0x7c):·/usr/include/i386-linux-gnu/c++/14/bits | 36 | ··5» (line_strp)» (offset:·0x7c):·/usr/include/i386-linux-gnu/c++/14/bits |
| 37 | ··6» (line_strp)» (offset:·0xa4):·/usr/include/c++/14/tr1 | 37 | ··6» (line_strp)» (offset:·0xa4):·/usr/include/c++/14/tr1 |
| 38 | ··7» (line_strp)» (offset:·0xbc):·/usr/include/c++/14/ext | 38 | ··7» (line_strp)» (offset:·0xbc):·/usr/include/c++/14/ext |
| Offset 130, 89 lines modified | Offset 130, 89 lines modified | ||
| 130 | ··73» (udata)» 11» (line_strp)» (offset:·0x4b2):·wctype-wchar.h | 130 | ··73» (udata)» 11» (line_strp)» (offset:·0x4b2):·wctype-wchar.h |
| 131 | ··74» (udata)» 9» (line_strp)» (offset:·0x4c1):·wctype.h | 131 | ··74» (udata)» 9» (line_strp)» (offset:·0x4c1):·wctype.h |
| 132 | ··75» (udata)» 3» (line_strp)» (offset:·0x44c):·stdlib.h | 132 | ··75» (udata)» 3» (line_strp)» (offset:·0x44c):·stdlib.h |
| 133 | ··76» (udata)» 9» (line_strp)» (offset:·0x4ca):·math.h | 133 | ··76» (udata)» 9» (line_strp)» (offset:·0x4ca):·math.h |
| 134 | ··77» (udata)» 9» (line_strp)» (offset:·0x4d1):·time.h | 134 | ··77» (udata)» 9» (line_strp)» (offset:·0x4d1):·time.h |
| 135 | ··78» (udata)» 12» (line_strp)» (offset:·0x4d8):·ncl.h | 135 | ··78» (udata)» 12» (line_strp)» (offset:·0x4d8):·ncl.h |
| 136 | ··79» (udata)» 9» (line_strp)» (offset:·0x1f1):·string.h | 136 | ··79» (udata)» 9» (line_strp)» (offset:·0x1f1):·string.h |
| 137 | ··80» (udata)» 13» (line_strp)» (offset:·0x27 | 137 | ··80» (udata)» 13» (line_strp)» (offset:·0x2726):·tools.h |
| 138 | ··81» (udata)» 14» (line_strp)» (offset:·0x4de):·split.h | 138 | ··81» (udata)» 14» (line_strp)» (offset:·0x4de):·split.h |
| 139 | ··82» (udata)» 15» (line_strp)» (offset:·0x57d):·node.h | 139 | ··82» (udata)» 15» (line_strp)» (offset:·0x57d):·node.h |
| 140 | ··83» (udata)» 14» (line_strp)» (offset:·0x4e6):·hashsplitset.h | 140 | ··83» (udata)» 14» (line_strp)» (offset:·0x4e6):·hashsplitset.h |
| 141 | ··84» (udata)» 15» (line_strp)» (offset:·0x4f5):·mtree.h | 141 | ··84» (udata)» 15» (line_strp)» (offset:·0x4f5):·mtree.h |
| 142 | ··85» (udata)» 16» (line_strp)» (offset:·0x2 | 142 | ··85» (udata)» 16» (line_strp)» (offset:·0x21d0):·parser.h |
| 143 | ··86» (udata)» 16» (line_strp)» (offset:·0x4fd):·exceptions.h | 143 | ··86» (udata)» 16» (line_strp)» (offset:·0x4fd):·exceptions.h |
| 144 | ··87» (udata)» 17» (line_strp)» (offset:·0x50a):·bool_type.h | 144 | ··87» (udata)» 17» (line_strp)» (offset:·0x50a):·bool_type.h |
| 145 | ··88» (udata)» 18» (line_strp)» (offset:·0x516):·statespace.h | 145 | ··88» (udata)» 18» (line_strp)» (offset:·0x516):·statespace.h |
| 146 | ··89» (udata)» 19» (line_strp)» (offset:·0x523):·pattern.h | 146 | ··89» (udata)» 19» (line_strp)» (offset:·0x523):·pattern.h |
| 147 | ··90» (udata)» 19» (line_strp)» (offset:·0x1d | 147 | ··90» (udata)» 19» (line_strp)» (offset:·0x1d21):·alignment.h |
| 148 | ··91» (udata)» 13» (line_strp)» (offset:·0x52d):·checkpoint.h | 148 | ··91» (udata)» 13» (line_strp)» (offset:·0x52d):·checkpoint.h |
| 149 | ··92» (udata)» 20» (line_strp)» (offset:·0x53a):·modelsubst.h | 149 | ··92» (udata)» 20» (line_strp)» (offset:·0x53a):·modelsubst.h |
| 150 | ··93» (udata)» 20» (line_strp)» (offset:·0x547):·rateheterogeneity.h | 150 | ··93» (udata)» 20» (line_strp)» (offset:·0x547):·rateheterogeneity.h |
| 151 | ··94» (udata)» 21» (line_strp)» (offset:·0x55b):·modelsblock.h | 151 | ··94» (udata)» 21» (line_strp)» (offset:·0x55b):·modelsblock.h |
| 152 | ··95» (udata)» 20» (line_strp)» (offset:·0x569):·modelfactory.h | 152 | ··95» (udata)» 20» (line_strp)» (offset:·0x569):·modelfactory.h |
| 153 | ··96» (udata)» 15» (line_strp)» (offset:·0x578):·phylonode.h | 153 | ··96» (udata)» 15» (line_strp)» (offset:·0x578):·phylonode.h |
| 154 | ··97» (udata)» 14» (line_strp)» (offset:·0x584):·splitgraph.h | 154 | ··97» (udata)» 14» (line_strp)» (offset:·0x584):·splitgraph.h |
| 155 | ··98» (udata)» 15» (line_strp)» (offset:·0x591):·phylotree.h | 155 | ··98» (udata)» 15» (line_strp)» (offset:·0x591):·phylotree.h |
| 156 | ··99» (udata)» 3» (line_strp)» (offset:·0x59d):·new | 156 | ··99» (udata)» 3» (line_strp)» (offset:·0x59d):·new |
| 157 | ··100» (udata)» 15» (line_strp)»(offset:·0x5a1):·parstree.h | 157 | ··100» (udata)» 15» (line_strp)»(offset:·0x5a1):·parstree.h |
| 158 | ··101» (udata)» 3» (line_strp)» (offset:·0x5ac):·system_error | 158 | ··101» (udata)» 3» (line_strp)» (offset:·0x5ac):·system_error |
| 159 | ·Line·Number·Statements: | 159 | ·Line·Number·Statements: |
| 160 | ··[0x0000027e]··Set·column·to·7 | 160 | ··[0x0000027e]··Set·column·to·7 |
| 161 | ··[0x00000280]··Extended·opcode·2:·set·Address·to·0xe8 | 161 | ··[0x00000280]··Extended·opcode·2:·set·Address·to·0xe8360 |
| 162 | ··[0x00000287]··Advance·Line·by·1091·to·1092 | 162 | ··[0x00000287]··Advance·Line·by·1091·to·1092 |
| 163 | ··[0x0000028a]··Copy | 163 | ··[0x0000028a]··Copy |
| 164 | ··[0x0000028b]··Set·column·to·9 | 164 | ··[0x0000028b]··Set·column·to·9 |
| 165 | ··[0x0000028d]··Special·opcode·6:·advance·Address·by·0·to·0xe8 | 165 | ··[0x0000028d]··Special·opcode·6:·advance·Address·by·0·to·0xe8360·and·Line·by·1·to·1093·(view·1) |
| 166 | ··[0x0000028e]··Set·column·to·21 | 166 | ··[0x0000028e]··Set·column·to·21 |
| 167 | ··[0x00000290]··Set·is_stmt·to·0 | 167 | ··[0x00000290]··Set·is_stmt·to·0 |
| 168 | ··[0x00000291]··Copy·(view·2) | 168 | ··[0x00000291]··Copy·(view·2) |
| 169 | ··[0x00000292]··Advance·PC·by·6·to·0xe8 | 169 | ··[0x00000292]··Advance·PC·by·6·to·0xe8366 |
| 170 | ··[0x00000294]··Extended·opcode·1:·End·of·Sequence | 170 | ··[0x00000294]··Extended·opcode·1:·End·of·Sequence |
| 171 | ··[0x00000297]··Set·File·Name·to·entry·2·in·the·File·Name·Table | 171 | ··[0x00000297]··Set·File·Name·to·entry·2·in·the·File·Name·Table |
| 172 | ··[0x00000299]··Set·column·to·39 | 172 | ··[0x00000299]··Set·column·to·39 |
| 173 | ··[0x0000029b]··Extended·opcode·2:·set·Address·to·0xe | 173 | ··[0x0000029b]··Extended·opcode·2:·set·Address·to·0xe7f60 |
| 174 | ··[0x000002a2]··Advance·Line·by·26·to·27 | 174 | ··[0x000002a2]··Advance·Line·by·26·to·27 |
| 175 | ··[0x000002a4]··Copy | 175 | ··[0x000002a4]··Copy |
| 176 | ··[0x000002a5]··Set·is_stmt·to·0 | 176 | ··[0x000002a5]··Set·is_stmt·to·0 |
| 177 | ··[0x000002a6]··Copy·(view·1) | 177 | ··[0x000002a6]··Copy·(view·1) |
| 178 | ··[0x000002a7]··Set·File·Name·to·entry·3·in·the·File·Name·Table | 178 | ··[0x000002a7]··Set·File·Name·to·entry·3·in·the·File·Name·Table |
| 179 | ··[0x000002a9]··Set·column·to·25 | 179 | ··[0x000002a9]··Set·column·to·25 |
| 180 | ··[0x000002ab]··Extended·opcode·4:·set·Discriminator·to·1 | 180 | ··[0x000002ab]··Extended·opcode·4:·set·Discriminator·to·1 |
| 181 | ··[0x000002af]··Advance·Line·by·167·to·194 | 181 | ··[0x000002af]··Advance·Line·by·167·to·194 |
| 182 | ··[0x000002b2]··Special·opcode·75:·advance·Address·by·5·to·0xe | 182 | ··[0x000002b2]··Special·opcode·75:·advance·Address·by·5·to·0xe7f65·and·Line·by·0·to·194 |
| 183 | ··[0x000002b3]··Set·File·Name·to·entry·2·in·the·File·Name·Table | 183 | ··[0x000002b3]··Set·File·Name·to·entry·2·in·the·File·Name·Table |
| 184 | ··[0x000002b5]··Set·column·to·39 | 184 | ··[0x000002b5]··Set·column·to·39 |
| 185 | ··[0x000002b7]··Advance·Line·by·-167·to·27 | 185 | ··[0x000002b7]··Advance·Line·by·-167·to·27 |
| 186 | ··[0x000002ba]··Advance·PC·by·constant·17·to·0xe | 186 | ··[0x000002ba]··Advance·PC·by·constant·17·to·0xe7f76 |
| 187 | ··[0x000002bb]··Special·opcode·5:·advance·Address·by·0·to·0xe | 187 | ··[0x000002bb]··Special·opcode·5:·advance·Address·by·0·to·0xe7f76·and·Line·by·0·to·27 |
| 188 | ··[0x000002bc]··Special·opcode·103:·advance·Address·by·7·to·0xe | 188 | ··[0x000002bc]··Special·opcode·103:·advance·Address·by·7·to·0xe7f7d·and·Line·by·0·to·27 |
| 189 | ··[0x000002bd]··Set·column·to·71 | 189 | ··[0x000002bd]··Set·column·to·71 |
| 190 | ··[0x000002bf]··Extended·opcode·4:·set·Discriminator·to·2 | 190 | ··[0x000002bf]··Extended·opcode·4:·set·Discriminator·to·2 |
| 191 | ··[0x000002c3]··Special·opcode·132:·advance·Address·by·9·to·0xe | 191 | ··[0x000002c3]··Special·opcode·132:·advance·Address·by·9·to·0xe7f86·and·Line·by·1·to·28 |
| 192 | ··[0x000002c4]··Set·column·to·81 | 192 | ··[0x000002c4]··Set·column·to·81 |
| 193 | ··[0x000002c6]··Extended·opcode·4:·set·Discriminator·to·2 | 193 | ··[0x000002c6]··Extended·opcode·4:·set·Discriminator·to·2 |
| 194 | ··[0x000002ca]··Special·opcode·89:·advance·Address·by·6·to·0xe | 194 | ··[0x000002ca]··Special·opcode·89:·advance·Address·by·6·to·0xe7f8c·and·Line·by·0·to·28 |
| 195 | ··[0x000002cb]··Set·File·Name·to·entry·3·in·the·File·Name·Table | 195 | ··[0x000002cb]··Set·File·Name·to·entry·3·in·the·File·Name·Table |
| 196 | ··[0x000002cd]··Set·column·to·25 | 196 | ··[0x000002cd]··Set·column·to·25 |
| 197 | ··[0x000002cf]··Extended·opcode·4:·set·Discriminator·to·1 | 197 | ··[0x000002cf]··Extended·opcode·4:·set·Discriminator·to·1 |
| 198 | ··[0x000002d3]··Advance·Line·by·166·to·194 | 198 | ··[0x000002d3]··Advance·Line·by·166·to·194 |
| 199 | ··[0x000002d6]··Special·opcode·33:·advance·Address·by·2·to·0xe | 199 | ··[0x000002d6]··Special·opcode·33:·advance·Address·by·2·to·0xe7f8e·and·Line·by·0·to·194 |
| 200 | ··[0x000002d7]··Extended·opcode·4:·set·Discriminator·to·1 | 200 | ··[0x000002d7]··Extended·opcode·4:·set·Discriminator·to·1 |
| 201 | ··[0x000002db]··Advance·PC·by·constant·17·to·0xe | 201 | ··[0x000002db]··Advance·PC·by·constant·17·to·0xe7f9f |
| 202 | ··[0x000002dc]··Special·opcode·159:·advance·Address·by·11·to·0xe | 202 | ··[0x000002dc]··Special·opcode·159:·advance·Address·by·11·to·0xe7faa·and·Line·by·0·to·194 |
| 203 | ··[0x000002dd]··Set·File·Name·to·entry·4·in·the·File·Name·Table | 203 | ··[0x000002dd]··Set·File·Name·to·entry·4·in·the·File·Name·Table |
| 204 | ··[0x000002df]··Set·column·to·7 | 204 | ··[0x000002df]··Set·column·to·7 |
| 205 | ··[0x000002e1]··Set·is_stmt·to·1 | 205 | ··[0x000002e1]··Set·is_stmt·to·1 |
| 206 | ··[0x000002e2]··Advance·Line·by·191·to·385 | 206 | ··[0x000002e2]··Advance·Line·by·191·to·385 |
| 207 | ··[0x000002e5]··Copy·(view·1) | 207 | ··[0x000002e5]··Copy·(view·1) |
| 208 | ··[0x000002e6]··Set·column·to·2 | 208 | ··[0x000002e6]··Set·column·to·2 |
| 209 | ··[0x000002e8]··Special·opcode·11:·advance·Address·by·0·to·0xe | 209 | ··[0x000002e8]··Special·opcode·11:·advance·Address·by·0·to·0xe7faa·and·Line·by·6·to·391·(view·2) |
| 210 | ··[0x000002e9]··Set·is_stmt·to·0 | 210 | ··[0x000002e9]··Set·is_stmt·to·0 |
| 211 | ··[0x000002ea]··Copy·(view·3) | 211 | ··[0x000002ea]··Copy·(view·3) |
| 212 | ··[0x000002eb]··Set·File·Name·to·entry·5·in·the·File·Name·Table | 212 | ··[0x000002eb]··Set·File·Name·to·entry·5·in·the·File·Name·Table |
| 213 | ··[0x000002ed]··Set·column·to·7 | 213 | ··[0x000002ed]··Set·column·to·7 |
| 214 | ··[0x000002ef]··Set·is_stmt·to·1 | 214 | ··[0x000002ef]··Set·is_stmt·to·1 |
| 215 | ··[0x000002f0]··Advance·Line·by·-170·to·221 | 215 | ··[0x000002f0]··Advance·Line·by·-170·to·221 |
| 216 | ··[0x000002f3]··Copy·(view·4) | 216 | ··[0x000002f3]··Copy·(view·4) |
| Offset 233, 27 lines modified | Offset 233, 27 lines modified | ||
| 233 | ··[0x0000030a]··Extended·opcode·4:·set·Discriminator·to·2 | 233 | ··[0x0000030a]··Extended·opcode·4:·set·Discriminator·to·2 |
| 234 | ··[0x0000030e]··Set·is_stmt·to·0 | 234 | ··[0x0000030e]··Set·is_stmt·to·0 |
| 235 | ··[0x0000030f]··Advance·Line·by·-194·to·28 | 235 | ··[0x0000030f]··Advance·Line·by·-194·to·28 |
| 236 | ··[0x00000312]··Copy·(view·9) | 236 | ··[0x00000312]··Copy·(view·9) |
| 237 | ··[0x00000313]··Set·File·Name·to·entry·3·in·the·File·Name·Table | 237 | ··[0x00000313]··Set·File·Name·to·entry·3·in·the·File·Name·Table |
| 238 | ··[0x00000315]··Set·column·to·26 | 238 | ··[0x00000315]··Set·column·to·26 |
| 239 | ··[0x00000317]··Advance·Line·by·195·to·223 | 239 | ··[0x00000317]··Advance·Line·by·195·to·223 |
| 240 | ··[0x0000031a]··Special·opcode·89:·advance·Address·by·6·to·0xe | 240 | ··[0x0000031a]··Special·opcode·89:·advance·Address·by·6·to·0xe7fb0·and·Line·by·0·to·223 |
| 241 | ··[0x0000031b]··Special·opcode·145:·advance·Address·by·10·to·0xe | 241 | ··[0x0000031b]··Special·opcode·145:·advance·Address·by·10·to·0xe7fba·and·Line·by·0·to·223 |
| 242 | ··[0x0000031c]··Set·File·Name·to·entry·4·in·the·File·Name·Table | 242 | ··[0x0000031c]··Set·File·Name·to·entry·4·in·the·File·Name·Table |
| 243 | ··[0x0000031e]··Set·column·to·7 | 243 | ··[0x0000031e]··Set·column·to·7 |
| 244 | ··[0x00000320]··Set·is_stmt·to·1 | 244 | ··[0x00000320]··Set·is_stmt·to·1 |
| 245 | ··[0x00000321]··Advance·Line·by·120·to·343 | 245 | ··[0x00000321]··Advance·Line·by·120·to·343 |
| 246 | ··[0x00000324]··Copy·(view·1) | 246 | ··[0x00000324]··Copy·(view·1) |
| 247 | ··[0x00000325]··Set·column·to·2 | 247 | ··[0x00000325]··Set·column·to·2 |
| 248 | ··[0x00000327]··Special·opcode·12:·advance·Address·by·0·to·0xe | 248 | ··[0x00000327]··Special·opcode·12:·advance·Address·by·0·to·0xe7fba·and·Line·by·7·to·350·(view·2) |
| 249 | ··[0x00000328]··Set·column·to·7 | 249 | ··[0x00000328]··Set·column·to·7 |
| 250 | ··[0x0000032a]··Set·is_stmt·to·0 | 250 | ··[0x0000032a]··Set·is_stmt·to·0 |
| 251 | ··[0x0000032b]··Copy·(view·3) | 251 | ··[0x0000032b]··Copy·(view·3) |
| 252 | ··[0x0000032c]··Special·opcode·103:·advance·Address·by·7·to·0xe | 252 | ··[0x0000032c]··Special·opcode·103:·advance·Address·by·7·to·0xe7fc1·and·Line·by·0·to·350 |
| 253 | ··[0x0000032d]··Set·File·Name·to·entry·5·in·the·File·Name·Table | 253 | ··[0x0000032d]··Set·File·Name·to·entry·5·in·the·File·Name·Table |
| Max diff block lines reached; 404678767/404686815 bytes (100.00%) of diff not shown. | |||
| Offset 1, 4194304 lines modified | Offset 1, 4194304 lines modified | ||
| 1 | Contents·of·the·.debug_info·section: | 1 | Contents·of·the·.debug_info·section: |
| 2 | ··Compilation·Unit·@·offset·0: | 2 | ··Compilation·Unit·@·offset·0: |
| 3 | ···Length:········0x14·(32-bit) | 3 | ···Length:········0x14·(32-bit) |
| 4 | ···Version:·······5 | 4 | ···Version:·······5 |
| 5 | ···Unit·Type:·····DW_UT_partial·(3) | 5 | ···Unit·Type:·····DW_UT_partial·(3) |
| 6 | ···Abbrev·Offset:·0x11 | 6 | ···Abbrev·Offset:·0x112b |
| 7 | ···Pointer·Size:··4 | 7 | ···Pointer·Size:··4 |
| 8 | ·<0><c>:·Abbrev·Number:· | 8 | ·<0><c>:·Abbrev·Number:·92·(DW_TAG_partial_unit) |
| 9 | ·<1><d>:·Abbrev·Number:· | 9 | ·<1><d>:·Abbrev·Number:·41·(DW_TAG_imported_unit) |
| 10 | ····<e>···DW_AT_import······:·(GNU_ref_alt)·<0xc> | 10 | ····<e>···DW_AT_import······:·(GNU_ref_alt)·<0xc> |
| 11 | ·<1><12>:·Abbrev·Number:· | 11 | ·<1><12>:·Abbrev·Number:·41·(DW_TAG_imported_unit) |
| 12 | ····<13>···DW_AT_import······:·(GNU_ref_alt)·<0x14555b6> | 12 | ····<13>···DW_AT_import······:·(GNU_ref_alt)·<0x14555b6> |
| 13 | ·<1><17>:·Abbrev·Number:·0 | 13 | ·<1><17>:·Abbrev·Number:·0 |
| 14 | ··Compilation·Unit·@·offset·0x18: | 14 | ··Compilation·Unit·@·offset·0x18: |
| 15 | ···Length:········0x14·(32-bit) | 15 | ···Length:········0x14·(32-bit) |
| 16 | ···Version:·······5 | 16 | ···Version:·······5 |
| 17 | ···Unit·Type:·····DW_UT_partial·(3) | 17 | ···Unit·Type:·····DW_UT_partial·(3) |
| 18 | ···Abbrev·Offset:·0x11 | 18 | ···Abbrev·Offset:·0x112b |
| 19 | ···Pointer·Size:··4 | 19 | ···Pointer·Size:··4 |
| 20 | ·<0><24>:·Abbrev·Number:· | 20 | ·<0><24>:·Abbrev·Number:·92·(DW_TAG_partial_unit) |
| 21 | ·<1><25>:·Abbrev·Number:· | 21 | ·<1><25>:·Abbrev·Number:·41·(DW_TAG_imported_unit) |
| 22 | ····<26>···DW_AT_import······:·(GNU_ref_alt)·<0xc> | 22 | ····<26>···DW_AT_import······:·(GNU_ref_alt)·<0xc> |
| 23 | ·<1><2a>:·Abbrev·Number:· | 23 | ·<1><2a>:·Abbrev·Number:·41·(DW_TAG_imported_unit) |
| 24 | ····<2b>···DW_AT_import······:·(GNU_ref_alt)·<0x14533a8> | 24 | ····<2b>···DW_AT_import······:·(GNU_ref_alt)·<0x14533a8> |
| 25 | ·<1><2f>:·Abbrev·Number:·0 | 25 | ·<1><2f>:·Abbrev·Number:·0 |
| 26 | ··Compilation·Unit·@·offset·0x30: | 26 | ··Compilation·Unit·@·offset·0x30: |
| 27 | ···Length:········0x14·(32-bit) | 27 | ···Length:········0x14·(32-bit) |
| 28 | ···Version:·······5 | 28 | ···Version:·······5 |
| 29 | ···Unit·Type:·····DW_UT_partial·(3) | 29 | ···Unit·Type:·····DW_UT_partial·(3) |
| 30 | ···Abbrev·Offset:·0x11 | 30 | ···Abbrev·Offset:·0x112b |
| 31 | ···Pointer·Size:··4 | 31 | ···Pointer·Size:··4 |
| 32 | ·<0><3c>:·Abbrev·Number:· | 32 | ·<0><3c>:·Abbrev·Number:·92·(DW_TAG_partial_unit) |
| 33 | ·<1><3d>:·Abbrev·Number:· | 33 | ·<1><3d>:·Abbrev·Number:·41·(DW_TAG_imported_unit) |
| 34 | ····<3e>···DW_AT_import······:·(GNU_ref_alt)·<0xc> | 34 | ····<3e>···DW_AT_import······:·(GNU_ref_alt)·<0xc> |
| 35 | ·<1><42>:·Abbrev·Number:· | 35 | ·<1><42>:·Abbrev·Number:·41·(DW_TAG_imported_unit) |
| 36 | ····<43>···DW_AT_import······:·(GNU_ref_alt)·<0x145564c> | 36 | ····<43>···DW_AT_import······:·(GNU_ref_alt)·<0x145564c> |
| 37 | ·<1><47>:·Abbrev·Number:·0 | 37 | ·<1><47>:·Abbrev·Number:·0 |
| 38 | ··Compilation·Unit·@·offset·0x48: | 38 | ··Compilation·Unit·@·offset·0x48: |
| 39 | ···Length:········0x14·(32-bit) | 39 | ···Length:········0x14·(32-bit) |
| 40 | ···Version:·······5 | 40 | ···Version:·······5 |
| 41 | ···Unit·Type:·····DW_UT_partial·(3) | 41 | ···Unit·Type:·····DW_UT_partial·(3) |
| 42 | ···Abbrev·Offset:·0x11 | 42 | ···Abbrev·Offset:·0x112b |
| 43 | ···Pointer·Size:··4 | 43 | ···Pointer·Size:··4 |
| 44 | ·<0><54>:·Abbrev·Number:· | 44 | ·<0><54>:·Abbrev·Number:·92·(DW_TAG_partial_unit) |
| 45 | ·<1><55>:·Abbrev·Number:· | 45 | ·<1><55>:·Abbrev·Number:·41·(DW_TAG_imported_unit) |
| 46 | ····<56>···DW_AT_import······:·(GNU_ref_alt)·<0xc> | 46 | ····<56>···DW_AT_import······:·(GNU_ref_alt)·<0xc> |
| 47 | ·<1><5a>:·Abbrev·Number:· | 47 | ·<1><5a>:·Abbrev·Number:·41·(DW_TAG_imported_unit) |
| 48 | ····<5b>···DW_AT_import······:·(GNU_ref_alt)·<0xb38e3> | 48 | ····<5b>···DW_AT_import······:·(GNU_ref_alt)·<0xb38e3> |
| 49 | ·<1><5f>:·Abbrev·Number:·0 | 49 | ·<1><5f>:·Abbrev·Number:·0 |
| 50 | ··Compilation·Unit·@·offset·0x60: | 50 | ··Compilation·Unit·@·offset·0x60: |
| 51 | ···Length:········0x14·(32-bit) | 51 | ···Length:········0x14·(32-bit) |
| 52 | ···Version:·······5 | 52 | ···Version:·······5 |
| 53 | ···Unit·Type:·····DW_UT_partial·(3) | 53 | ···Unit·Type:·····DW_UT_partial·(3) |
| 54 | ···Abbrev·Offset:·0x11 | 54 | ···Abbrev·Offset:·0x112b |
| 55 | ···Pointer·Size:··4 | 55 | ···Pointer·Size:··4 |
| 56 | ·<0><6c>:·Abbrev·Number:· | 56 | ·<0><6c>:·Abbrev·Number:·92·(DW_TAG_partial_unit) |
| 57 | ·<1><6d>:·Abbrev·Number:· | 57 | ·<1><6d>:·Abbrev·Number:·41·(DW_TAG_imported_unit) |
| 58 | ····<6e>···DW_AT_import······:·(GNU_ref_alt)·<0x14555b6> | 58 | ····<6e>···DW_AT_import······:·(GNU_ref_alt)·<0x14555b6> |
| 59 | ·<1><72>:·Abbrev·Number:· | 59 | ·<1><72>:·Abbrev·Number:·41·(DW_TAG_imported_unit) |
| 60 | ····<73>···DW_AT_import······:·(GNU_ref_alt)·<0x14533a8> | 60 | ····<73>···DW_AT_import······:·(GNU_ref_alt)·<0x14533a8> |
| 61 | ·<1><77>:·Abbrev·Number:·0 | 61 | ·<1><77>:·Abbrev·Number:·0 |
| 62 | ··Compilation·Unit·@·offset·0x78: | 62 | ··Compilation·Unit·@·offset·0x78: |
| 63 | ···Length:········0x14·(32-bit) | 63 | ···Length:········0x14·(32-bit) |
| 64 | ···Version:·······5 | 64 | ···Version:·······5 |
| 65 | ···Unit·Type:·····DW_UT_partial·(3) | 65 | ···Unit·Type:·····DW_UT_partial·(3) |
| 66 | ···Abbrev·Offset:·0x11 | 66 | ···Abbrev·Offset:·0x112b |
| 67 | ···Pointer·Size:··4 | 67 | ···Pointer·Size:··4 |
| 68 | ·<0><84>:·Abbrev·Number:· | 68 | ·<0><84>:·Abbrev·Number:·92·(DW_TAG_partial_unit) |
| 69 | ·<1><85>:·Abbrev·Number:· | 69 | ·<1><85>:·Abbrev·Number:·41·(DW_TAG_imported_unit) |
| 70 | ····<86>···DW_AT_import······:·(GNU_ref_alt)·<0x14533a8> | 70 | ····<86>···DW_AT_import······:·(GNU_ref_alt)·<0x14533a8> |
| 71 | ·<1><8a>:·Abbrev·Number:· | 71 | ·<1><8a>:·Abbrev·Number:·41·(DW_TAG_imported_unit) |
| 72 | ····<8b>···DW_AT_import······:·(GNU_ref_alt)·<0x1453358> | 72 | ····<8b>···DW_AT_import······:·(GNU_ref_alt)·<0x1453358> |
| 73 | ·<1><8f>:·Abbrev·Number:·0 | 73 | ·<1><8f>:·Abbrev·Number:·0 |
| 74 | ··Compilation·Unit·@·offset·0x90: | 74 | ··Compilation·Unit·@·offset·0x90: |
| 75 | ···Length:········0x14·(32-bit) | 75 | ···Length:········0x14·(32-bit) |
| 76 | ···Version:·······5 | 76 | ···Version:·······5 |
| 77 | ···Unit·Type:·····DW_UT_partial·(3) | 77 | ···Unit·Type:·····DW_UT_partial·(3) |
| 78 | ···Abbrev·Offset:·0x11 | 78 | ···Abbrev·Offset:·0x112b |
| 79 | ···Pointer·Size:··4 | 79 | ···Pointer·Size:··4 |
| 80 | ·<0><9c>:·Abbrev·Number:· | 80 | ·<0><9c>:·Abbrev·Number:·92·(DW_TAG_partial_unit) |
| 81 | ·<1><9d>:·Abbrev·Number:· | 81 | ·<1><9d>:·Abbrev·Number:·41·(DW_TAG_imported_unit) |
| 82 | ····<9e>···DW_AT_import······:·(GNU_ref_alt)·<0x14533a8> | 82 | ····<9e>···DW_AT_import······:·(GNU_ref_alt)·<0x14533a8> |
| 83 | ·<1><a2>:·Abbrev·Number:· | 83 | ·<1><a2>:·Abbrev·Number:·41·(DW_TAG_imported_unit) |
| 84 | ····<a3>···DW_AT_import······:·(GNU_ref_alt)·<0x1453338> | 84 | ····<a3>···DW_AT_import······:·(GNU_ref_alt)·<0x1453338> |
| 85 | ·<1><a7>:·Abbrev·Number:·0 | 85 | ·<1><a7>:·Abbrev·Number:·0 |
| 86 | ··Compilation·Unit·@·offset·0xa8: | 86 | ··Compilation·Unit·@·offset·0xa8: |
| 87 | ···Length:········0x14·(32-bit) | 87 | ···Length:········0x14·(32-bit) |
| 88 | ···Version:·······5 | 88 | ···Version:·······5 |
| 89 | ···Unit·Type:·····DW_UT_partial·(3) | 89 | ···Unit·Type:·····DW_UT_partial·(3) |
| 90 | ···Abbrev·Offset:·0x11 | 90 | ···Abbrev·Offset:·0x112b |
| 91 | ···Pointer·Size:··4 | 91 | ···Pointer·Size:··4 |
| 92 | ·<0><b4>:·Abbrev·Number:· | 92 | ·<0><b4>:·Abbrev·Number:·92·(DW_TAG_partial_unit) |
| 93 | ·<1><b5>:·Abbrev·Number:· | 93 | ·<1><b5>:·Abbrev·Number:·41·(DW_TAG_imported_unit) |
| 94 | ····<b6>···DW_AT_import······:·(GNU_ref_alt)·<0x1453358> | 94 | ····<b6>···DW_AT_import······:·(GNU_ref_alt)·<0x1453358> |
| 95 | ·<1><ba>:·Abbrev·Number:· | 95 | ·<1><ba>:·Abbrev·Number:·41·(DW_TAG_imported_unit) |
| 96 | ····<bb>···DW_AT_import······:·(GNU_ref_alt)·<0x1453338> | 96 | ····<bb>···DW_AT_import······:·(GNU_ref_alt)·<0x1453338> |
| 97 | ·<1><bf>:·Abbrev·Number:·0 | 97 | ·<1><bf>:·Abbrev·Number:·0 |
| 98 | ··Compilation·Unit·@·offset·0xc0: | 98 | ··Compilation·Unit·@·offset·0xc0: |
| 99 | ···Length:········0x14·(32-bit) | 99 | ···Length:········0x14·(32-bit) |
| 100 | ···Version:·······5 | 100 | ···Version:·······5 |
| 101 | ···Unit·Type:·····DW_UT_partial·(3) | 101 | ···Unit·Type:·····DW_UT_partial·(3) |
| 102 | ···Abbrev·Offset:·0x11 | 102 | ···Abbrev·Offset:·0x112b |
| 103 | ···Pointer·Size:··4 | 103 | ···Pointer·Size:··4 |
| 104 | ·<0><cc>:·Abbrev·Number:· | 104 | ·<0><cc>:·Abbrev·Number:·92·(DW_TAG_partial_unit) |
| 105 | ·<1><cd>:·Abbrev·Number:· | 105 | ·<1><cd>:·Abbrev·Number:·41·(DW_TAG_imported_unit) |
| 106 | ····<ce>···DW_AT_import······:·(GNU_ref_alt)·<0x1453358> | 106 | ····<ce>···DW_AT_import······:·(GNU_ref_alt)·<0x1453358> |
| 107 | ·<1><d2>:·Abbrev·Number:· | 107 | ·<1><d2>:·Abbrev·Number:·41·(DW_TAG_imported_unit) |
| 108 | ····<d3>···DW_AT_import······:·(GNU_ref_alt)·<0xb38e3> | 108 | ····<d3>···DW_AT_import······:·(GNU_ref_alt)·<0xb38e3> |
| 109 | ·<1><d7>:·Abbrev·Number:·0 | 109 | ·<1><d7>:·Abbrev·Number:·0 |
| 110 | ··Compilation·Unit·@·offset·0xd8: | 110 | ··Compilation·Unit·@·offset·0xd8: |
| 111 | ···Length:········0x1e·(32-bit) | 111 | ···Length:········0x1e·(32-bit) |
| 112 | ···Version:·······5 | 112 | ···Version:·······5 |
| 113 | ···Unit·Type:·····DW_UT_partial·(3) | 113 | ···Unit·Type:·····DW_UT_partial·(3) |
| 114 | ···Abbrev·Offset:·0x11 | 114 | ···Abbrev·Offset:·0x112b |
| 115 | ···Pointer·Size:··4 | 115 | ···Pointer·Size:··4 |
| 116 | ·<0><e4>:·Abbrev·Number:· | 116 | ·<0><e4>:·Abbrev·Number:·92·(DW_TAG_partial_unit) |
| 117 | ·<1><e5>:·Abbrev·Number:· | 117 | ·<1><e5>:·Abbrev·Number:·41·(DW_TAG_imported_unit) |
| 118 | ····<e6>···DW_AT_import······:·(GNU_ref_alt)·<0x1453338> | 118 | ····<e6>···DW_AT_import······:·(GNU_ref_alt)·<0x1453338> |
| 119 | ·<1><ea>:·Abbrev·Number:· | 119 | ·<1><ea>:·Abbrev·Number:·41·(DW_TAG_imported_unit) |
| 120 | ····<eb>···DW_AT_import······:·(GNU_ref_alt)·<0xb38e3> | 120 | ····<eb>···DW_AT_import······:·(GNU_ref_alt)·<0xb38e3> |
| 121 | ·<1><ef>:·Abbrev·Number:· | 121 | ·<1><ef>:·Abbrev·Number:·8·(DW_TAG_imported_unit) |
| 122 | ····<f0>···DW_AT_import······:·(ref_addr)·<0xc>» [Abbrev·Number:· | 122 | ····<f0>···DW_AT_import······:·(ref_addr)·<0xc>» [Abbrev·Number:·92·(DW_TAG_partial_unit)] |
| 123 | ·<1><f4>:·Abbrev·Number:· | 123 | ·<1><f4>:·Abbrev·Number:·8·(DW_TAG_imported_unit) |
| 124 | ····<f5>···DW_AT_import······:·(ref_addr)·<0x84>» [Abbrev·Number:· | 124 | ····<f5>···DW_AT_import······:·(ref_addr)·<0x84>» [Abbrev·Number:·92·(DW_TAG_partial_unit)] |
| 125 | ·<1><f9>:·Abbrev·Number:·0 | 125 | ·<1><f9>:·Abbrev·Number:·0 |
| 126 | ··Compilation·Unit·@·offset·0xfa: | 126 | ··Compilation·Unit·@·offset·0xfa: |
| Max diff block lines reached; 463059946/463067146 bytes (100.00%) of diff not shown. | |||
| Offset 1, 953 lines modified | Offset 1, 929 lines modified | ||
| 1 | Contents·of·the·.debug_abbrev·section: | 1 | Contents·of·the·.debug_abbrev·section: |
| 2 | ··Number·TAG·(0) | 2 | ··Number·TAG·(0) |
| 3 | ···1······DW_TAG_subprogram····[has·children] | 3 | ···1······DW_TAG_subprogram····[has·children] |
| 4 | ····DW_AT_specification·DW_FORM_ref1 | ||
| 4 | ····DW_AT_external·····DW_FORM_flag_present | ||
| 5 | ····DW_AT_name·········DW_FORM_GNU_strp_alt | ||
| 6 | ····DW_AT_decl_file····DW_FORM_data1 | ||
| 7 | ····DW_AT_ | 5 | ····DW_AT_inline·······DW_FORM_data1 |
| 8 | ····DW_AT_decl_column··DW_FORM_data1 | ||
| 9 | ····DW_AT_linkage_name·DW_FORM_GNU_strp_alt | ||
| 10 | ····DW_AT_type·········DW_FORM_GNU_ref_alt | ||
| 11 | ····DW_AT_virtuality···DW_FORM_implicit_const:·1 | ||
| 12 | ····DW_AT_vtable_elem_location·DW_FORM_exprloc | ||
| 13 | ····DW_AT_containing_type·DW_FORM_ref_udata | ||
| 14 | ····DW_AT_accessibility·DW_FORM_data1 | ||
| 15 | ····DW_AT_declaration··DW_FORM_flag_present | ||
| 16 | ····DW_AT_object_pointer·DW_FORM_ref_udata | ||
| 17 | ····DW_AT_sibling······DW_FORM_ref_udata | ||
| 18 | ····DW_AT·value:·0·····DW_FORM·value:·0 | ||
| 19 | ···2······DW_TAG_imported_unit····[no·children] | ||
| 20 | ····DW_AT_import·······DW_FORM_ref_addr | ||
| 21 | ····DW_AT·value:·0·····DW_FORM·value:·0 | ||
| 22 | ···3······DW_TAG_partial_unit····[has·children] | ||
| 23 | ····DW_AT_stmt_list····DW_FORM_sec_offset | ||
| 24 | ····DW_AT_comp_dir·····DW_FORM_line_strp | ||
| 25 | ····DW_AT·value:·0·····DW_FORM·value:·0 | ||
| 26 | ···4······DW_TAG_formal_parameter····[no·children] | ||
| 27 | ····DW_AT_type·········DW_FORM_GNU_ref_alt | ||
| 28 | ····DW_AT·value:·0·····DW_FORM·value:·0 | 6 | ····DW_AT·value:·0·····DW_FORM·value:·0 |
| 29 | ··· | 7 | ···2······DW_TAG_reference_type····[no·children] |
| 8 | ····DW_AT_byte_size····DW_FORM_implicit_const:·4 | ||
| 30 | ····DW_AT_type·········DW_FORM_ref_ | 9 | ····DW_AT_type·········DW_FORM_ref_addr |
| 31 | ····DW_AT·value:·0·····DW_FORM·value:·0 | 10 | ····DW_AT·value:·0·····DW_FORM·value:·0 |
| 11 | ···3······DW_TAG_variable····[no·children] | ||
| 32 | ···6······DW_TAG_subprogram····[has·children] | ||
| 33 | ····DW_AT_external·····DW_FORM_flag_present | ||
| 34 | ····DW_AT_name·········DW_FORM_GNU_strp_alt | 12 | ····DW_AT_name·········DW_FORM_GNU_strp_alt |
| 35 | ····DW_AT_decl_file····DW_FORM_data1 | 13 | ····DW_AT_decl_file····DW_FORM_data1 |
| 36 | ····DW_AT_decl_line····DW_FORM_data | 14 | ····DW_AT_decl_line····DW_FORM_data2 |
| 37 | ····DW_AT_decl_column··DW_FORM_data1 | 15 | ····DW_AT_decl_column··DW_FORM_data1 |
| 16 | ····DW_AT_type·········DW_FORM_ref1 | ||
| 17 | ····DW_AT_external·····DW_FORM_flag_present | ||
| 38 | ····DW_AT_linkage_name·DW_FORM_GNU_strp_alt | ||
| 39 | ····DW_AT_virtuality···DW_FORM_implicit_const:·1 | ||
| 40 | ····DW_AT_vtable_elem_location·DW_FORM_exprloc | ||
| 41 | ····DW_AT_containing_type·DW_FORM_ref_udata | ||
| 42 | ····DW_AT_accessibility·DW_FORM_implicit_const:·1 | ||
| 43 | ····DW_AT_declaration··DW_FORM_flag_present | 18 | ····DW_AT_declaration··DW_FORM_flag_present |
| 44 | ····DW_AT_object_pointer·DW_FORM_ref_udata | ||
| 45 | ····DW_AT·value:·0·····DW_FORM·value:·0 | 19 | ····DW_AT·value:·0·····DW_FORM·value:·0 |
| 46 | ··· | 20 | ···4······DW_TAG_subprogram····[has·children] |
| 47 | ····DW_AT_external·····DW_FORM_flag_present | 21 | ····DW_AT_external·····DW_FORM_flag_present |
| 48 | ····DW_AT_name·········DW_FORM_GNU_strp_alt | 22 | ····DW_AT_name·········DW_FORM_GNU_strp_alt |
| 49 | ····DW_AT_decl_file····DW_FORM_data1 | 23 | ····DW_AT_decl_file····DW_FORM_data1 |
| 50 | ····DW_AT_decl_line····DW_FORM_data | 24 | ····DW_AT_decl_line····DW_FORM_data1 |
| 51 | ····DW_AT_decl_column··DW_FORM_data1 | 25 | ····DW_AT_decl_column··DW_FORM_data1 |
| 52 | ····DW_AT_linkage_name·DW_FORM_GNU_strp_alt | 26 | ····DW_AT_linkage_name·DW_FORM_GNU_strp_alt |
| 53 | ····DW_AT_type·········DW_FORM_ | 27 | ····DW_AT_type·········DW_FORM_ref1 |
| 54 | ····DW_AT_declaration··DW_FORM_flag_present | 28 | ····DW_AT_declaration··DW_FORM_flag_present |
| 55 | ····DW_AT·value:·0·····DW_FORM·value:·0 | 29 | ····DW_AT·value:·0·····DW_FORM·value:·0 |
| 56 | ··· | 30 | ···5······DW_TAG_partial_unit····[has·children] |
| 31 | ····DW_AT_stmt_list····DW_FORM_sec_offset | ||
| 32 | ····DW_AT_comp_dir·····DW_FORM_line_strp | ||
| 57 | ····DW_AT_name·········DW_FORM_GNU_strp_alt | ||
| 58 | ····DW_AT_declaration··DW_FORM_flag_present | ||
| 59 | ····DW_AT_sibling······DW_FORM_ref_udata | ||
| 60 | ····DW_AT·value:·0·····DW_FORM·value:·0 | 33 | ····DW_AT·value:·0·····DW_FORM·value:·0 |
| 61 | ··· | 34 | ···6······DW_TAG_formal_parameter····[no·children] |
| 62 | ····DW_AT_byte_size····DW_FORM_implicit_const:·4 | ||
| 63 | ····DW_AT_type·········DW_FORM_ref_ | 35 | ····DW_AT_type·········DW_FORM_GNU_ref_alt |
| 64 | ····DW_AT·value:·0·····DW_FORM·value:·0 | 36 | ····DW_AT·value:·0·····DW_FORM·value:·0 |
| 65 | ··· | 37 | ···7······DW_TAG_template_type_param····[no·children] |
| 38 | ····DW_AT_name·········DW_FORM_string | ||
| 66 | ····DW_AT_type·········DW_FORM_ref | 39 | ····DW_AT_type·········DW_FORM_ref1 |
| 67 | ····DW_AT_artificial···DW_FORM_flag_present | ||
| 68 | ····DW_AT·value:·0·····DW_FORM·value:·0 | 40 | ····DW_AT·value:·0·····DW_FORM·value:·0 |
| 41 | ···8······DW_TAG_const_type····[no·children] | ||
| 69 | ···11······DW_TAG_subprogram····[has·children] | ||
| 70 | ····DW_AT_specification·DW_FORM_ref1 | ||
| 71 | ····DW_AT_inline·······DW_FORM_data1 | ||
| 72 | ····DW_AT_ | 42 | ····DW_AT_type·········DW_FORM_ref1 |
| 73 | ····DW_AT·value:·0·····DW_FORM·value:·0 | 43 | ····DW_AT·value:·0·····DW_FORM·value:·0 |
| 74 | ··· | 44 | ···9······DW_TAG_enumeration_type····[has·children] |
| 75 | ····DW_AT_name·········DW_FORM_GNU_strp_alt | 45 | ····DW_AT_name·········DW_FORM_GNU_strp_alt |
| 46 | ····DW_AT_encoding·····DW_FORM_implicit_const:·7 | ||
| 47 | ····DW_AT_byte_size····DW_FORM_implicit_const:·4 | ||
| 48 | ····DW_AT_type·········DW_FORM_GNU_ref_alt | ||
| 49 | ····DW_AT_decl_file····DW_FORM_implicit_const:·33 | ||
| 50 | ····DW_AT_decl_line····DW_FORM_data2 | ||
| 51 | ····DW_AT_decl_column··DW_FORM_implicit_const:·6 | ||
| 76 | ····DW_AT_sibling······DW_FORM_ref1 | 52 | ····DW_AT_sibling······DW_FORM_ref1 |
| 77 | ····DW_AT·value:·0·····DW_FORM·value:·0 | 53 | ····DW_AT·value:·0·····DW_FORM·value:·0 |
| 78 | ···1 | 54 | ···10······DW_TAG_enumerator····[no·children] |
| 79 | ····DW_AT_name·········DW_FORM_GNU_strp_alt | ||
| 80 | ····DW_AT·value:·0·····DW_FORM·value:·0 | ||
| 81 | ···14······DW_TAG_subprogram····[has·children] | ||
| 82 | ····DW_AT_external·····DW_FORM_flag_present | ||
| 83 | ····DW_AT_name·········DW_FORM_GNU_strp_alt | 55 | ····DW_AT_name·········DW_FORM_GNU_strp_alt |
| 84 | ····DW_AT_decl_file····DW_FORM_data1 | ||
| 85 | ····DW_AT_decl_line····DW_FORM_data1 | ||
| 86 | ····DW_AT_ | 56 | ····DW_AT_const_value··DW_FORM_data1 |
| 87 | ····DW_AT_linkage_name·DW_FORM_GNU_strp_alt | ||
| 88 | ····DW_AT_type·········DW_FORM_ref_addr | ||
| 89 | ····DW_AT_declaration··DW_FORM_flag_present | ||
| 90 | ····DW_AT·value:·0·····DW_FORM·value:·0 | 57 | ····DW_AT·value:·0·····DW_FORM·value:·0 |
| 91 | ···1 | 58 | ···11······DW_TAG_formal_parameter····[no·children] |
| 92 | ····DW_AT_name·········DW_FORM_string | 59 | ····DW_AT_name·········DW_FORM_string |
| 93 | ····DW_AT_decl_file····DW_FORM_data1 | 60 | ····DW_AT_decl_file····DW_FORM_data1 |
| 94 | ····DW_AT_decl_line····DW_FORM_data1 | 61 | ····DW_AT_decl_line····DW_FORM_data1 |
| 95 | ····DW_AT_decl_column··DW_FORM_data1 | 62 | ····DW_AT_decl_column··DW_FORM_data1 |
| 96 | ····DW_AT_type·········DW_FORM_ref | 63 | ····DW_AT_type·········DW_FORM_ref1 |
| 97 | ····DW_AT·value:·0·····DW_FORM·value:·0 | 64 | ····DW_AT·value:·0·····DW_FORM·value:·0 |
| 65 | ···12······DW_TAG_reference_type····[no·children] | ||
| 66 | ····DW_AT_byte_size····DW_FORM_implicit_const:·4 | ||
| 67 | ····DW_AT_type·········DW_FORM_ref1 | ||
| 68 | ····DW_AT·value:·0·····DW_FORM·value:·0 | ||
| 98 | ···1 | 69 | ···13······DW_TAG_subprogram····[has·children] |
| 99 | ····DW_AT_external·····DW_FORM_flag_present | 70 | ····DW_AT_external·····DW_FORM_flag_present |
| 100 | ····DW_AT_name·········DW_FORM_GNU_strp_alt | 71 | ····DW_AT_name·········DW_FORM_GNU_strp_alt |
| 101 | ····DW_AT_decl_file····DW_FORM_data1 | 72 | ····DW_AT_decl_file····DW_FORM_data1 |
| 102 | ····DW_AT_decl_line····DW_FORM_data | 73 | ····DW_AT_decl_line····DW_FORM_data2 |
| 103 | ····DW_AT_decl_column··DW_FORM_data1 | 74 | ····DW_AT_decl_column··DW_FORM_data1 |
| 104 | ····DW_AT_linkage_name·DW_FORM_GNU_strp_alt | 75 | ····DW_AT_linkage_name·DW_FORM_GNU_strp_alt |
| 105 | ····DW_AT_type·········DW_FORM_ref_addr | ||
| 106 | ····DW_AT_declaration··DW_FORM_flag_present | 76 | ····DW_AT_declaration··DW_FORM_flag_present |
| 107 | ····DW_AT_sibling······DW_FORM_ref1 | 77 | ····DW_AT_sibling······DW_FORM_ref1 |
| Max diff block lines reached; 2963001/2969375 bytes (99.79%) of diff not shown. | |||
| Offset 1, 5203 lines modified | Offset 1, 5198 lines modified | ||
| 1 | Contents·of·the·.debug_aranges·section: | 1 | Contents·of·the·.debug_aranges·section: |
| 2 | ··Length:···················44 | 2 | ··Length:···················44 |
| 3 | ··Version:··················2 | 3 | ··Version:··················2 |
| 4 | ··Offset·into·.debug_info:··0x2 | 4 | ··Offset·into·.debug_info:··0x22a5e |
| 5 | ··Pointer·Size:·············4 | 5 | ··Pointer·Size:·············4 |
| 6 | ··Segment·Size:·············0 | 6 | ··Segment·Size:·············0 |
| 7 | ····Address····Length | 7 | ····Address····Length |
| 8 | ····000e | 8 | ····000e7f60·000003f7 |
| 9 | ····00081 | 9 | ····00081280·000000b6 |
| 10 | ····000e8 | 10 | ····000e8360·00000006 |
| 11 | ····00000000·00000000 | 11 | ····00000000·00000000 |
| 12 | ··Length:···················1164 | 12 | ··Length:···················1164 |
| 13 | ··Version:··················2 | 13 | ··Version:··················2 |
| 14 | ··Offset·into·.debug_info:··0x2 | 14 | ··Offset·into·.debug_info:··0x24b36 |
| 15 | ··Pointer·Size:·············4 | 15 | ··Pointer·Size:·············4 |
| 16 | ··Segment·Size:·············0 | 16 | ··Segment·Size:·············0 |
| 17 | ····Address····Length | 17 | ····Address····Length |
| 18 | ····000e8 | 18 | ····000e8380·00037e03 |
| 19 | ····00081 | 19 | ····0008170a·00008ad9 |
| 20 | ····000e8 | 20 | ····000e8360·00000006 |
| 21 | ····00120 | 21 | ····00120190·00000003 |
| 22 | ····00120 | 22 | ····001201a0·0000000b |
| 23 | ····001207f0·00000001 | ||
| 24 | ····00120800·00000001 | ||
| 25 | ····00120 | 23 | ····001201b0·00000001 |
| 26 | ····00120 | 24 | ····001201c0·00000001 |
| 27 | ····00120830·000000ab | ||
| 28 | ····001208e0·00000026 | ||
| 29 | ····00120 | 25 | ····001201d0·00000001 |
| 30 | ····00120 | 26 | ····001201e0·00000001 |
| 27 | ····001201f0·000000ab | ||
| 31 | ····00120 | 28 | ····001202a0·00000026 |
| 32 | ····00120ac0·00000030 | ||
| 33 | ····00120af0·00000026 | ||
| 34 | ····00120 | 29 | ····001202d0·00000030 |
| 30 | ····00120300·00000067 | ||
| 31 | ····00120450·00000026 | ||
| 32 | ····00120480·00000030 | ||
| 33 | ····001204b0·00000026 | ||
| 34 | ····001204e0·00000030 | ||
| 35 | ····00120 | 35 | ····00120540·00000234 |
| 36 | ····00120 | 36 | ····00120780·000008b3 |
| 37 | ····00081 | 37 | ····00081336·000000f1 |
| 38 | ····00081 | 38 | ····00081428·000000f1 |
| 39 | ····00081 | 39 | ····0008151a·000000f7 |
| 40 | ····00081 | 40 | ····00081612·000000f7 |
| 41 | ····00121 | 41 | ····00121040·00000013 |
| 42 | ····00121 | 42 | ····00121060·00000073 |
| 43 | ····00121 | 43 | ····001210e0·0000006e |
| 44 | ····00120 | 44 | ····00120370·0000006c |
| 45 | ····00120 | 45 | ····001203e0·00000064 |
| 46 | ····00121 | 46 | ····00121150·00000078 |
| 47 | ····00121 | 47 | ····001211d0·0000005d |
| 48 | ····00121930·0000005d | ||
| 49 | ····00121a50·00000063 | ||
| 50 | ····00121ac0·00000065 | ||
| 51 | ····00121ba0·00000063 | ||
| 52 | ····00121c10·00000065 | ||
| 53 | ····00121870·0000005b | ||
| 54 | ····001218d0·0000005d | ||
| 55 | ····00121990·0000005b | ||
| 56 | ····00121 | 48 | ····001212f0·0000005d |
| 57 | ····00121 | 49 | ····00121410·00000063 |
| 58 | ····00121 | 50 | ····00121480·00000065 |
| 59 | ····00121cf0·0000006c | ||
| 60 | ····00121e40·0000006c | ||
| 61 | ····00121 | 51 | ····00121560·00000063 |
| 62 | ····001220e0·00000063 | ||
| 63 | ····00121d60·0000006d | ||
| 64 | ····00121dd0·0000006f | ||
| 65 | ····00121eb0·0000006d | ||
| 66 | ····00121f20·0000006f | ||
| 67 | ····00122000·00000065 | ||
| 68 | ····00122070·00000067 | ||
| 69 | ····0012 | 52 | ····001215d0·00000065 |
| 53 | ····00121230·0000005b | ||
| 54 | ····00121290·0000005d | ||
| 55 | ····00121350·0000005b | ||
| 56 | ····001213b0·0000005d | ||
| 57 | ····001214f0·00000065 | ||
| 58 | ····00121640·00000065 | ||
| 59 | ····001216b0·0000006c | ||
| 60 | ····00121800·0000006c | ||
| 61 | ····00121950·00000063 | ||
| 62 | ····00121aa0·00000063 | ||
| 63 | ····00121720·0000006d | ||
| 64 | ····00121790·0000006f | ||
| 65 | ····00121870·0000006d | ||
| 66 | ····001218e0·0000006f | ||
| 70 | ····0012 | 67 | ····001219c0·00000065 |
| 68 | ····00121a30·00000067 | ||
| 69 | ····00121b10·00000065 | ||
| 70 | ····00121b80·00000067 | ||
| 71 | ····0012 | 71 | ····00121bf0·00000121 |
| 72 | ····0012 | 72 | ····00121d20·00000129 |
| 73 | ····0012 | 73 | ····00121e50·000000f4 |
| 74 | ····0012 | 74 | ····00121f50·00000114 |
| 75 | ····00122 | 75 | ····00122070·0000009f |
| 76 | ····0008a | 76 | ····0008a1e3·00000036 |
| 77 | ····00122 | 77 | ····00122110·00000046 |
| 78 | ····00122 | 78 | ····00122160·000003e1 |
| 79 | ····00122 | 79 | ····00122550·000002df |
| 80 | ····00122 | 80 | ····00122830·000000bc |
| 81 | ····00122 | 81 | ····001228f0·000000a0 |
| 82 | ····00122 | 82 | ····00122990·000001a2 |
| 83 | ····0012 | 83 | ····00122b40·00000005 |
| 84 | ····0012 | 84 | ····00122b50·00000082 |
| 85 | ····0012 | 85 | ····00122be0·000000e9 |
| 86 | ····0012 | 86 | ····00122cd0·00000053 |
| 87 | ····0012 | 87 | ····00122d30·0000005a |
| 88 | ····0012 | 88 | ····00122d90·0000004e |
| 89 | ····0012 | 89 | ····00122de0·00000088 |
| 90 | ····0012 | 90 | ····00122e70·00000057 |
| 91 | ····0012 | 91 | ····00122ed0·00000205 |
| 92 | ····00123 | 92 | ····001230e0·00000173 |
| 93 | ····00123 | 93 | ····00123260·0000008f |
| 94 | ····00123 | 94 | ····001232f0·000000c3 |
| 95 | ····00123a00·0000002c | ||
| 96 | ····00123 | 95 | ····001233c0·0000002c |
| 97 | ····00123 | 96 | ····001233f0·0000002c |
| 97 | ····00123420·0000002c | ||
| 98 | ····00123 | 98 | ····00123450·0000038e |
| 99 | ····00123 | 99 | ····001237e0·00000029 |
| 100 | ····00123 | 100 | ····00123810·0000010a |
| Max diff block lines reached; 206151/213428 bytes (96.59%) of diff not shown. | |||
| Offset 10, 527 lines modified | Offset 10, 527 lines modified | ||
| 10 | ····Offset···Begin············End··············Expression | 10 | ····Offset···Begin············End··············Expression |
| 11 | ····0000000c·v0000000·v0000000·location·view·pair | 11 | ····0000000c·v0000000·v0000000·location·view·pair |
| 12 | ····0000000e·v0000000·v0000000·location·view·pair | 12 | ····0000000e·v0000000·v0000000·location·view·pair |
| 13 | ····00000010·v0000000·v0000000·location·view·pair | 13 | ····00000010·v0000000·v0000000·location·view·pair |
| 14 | ····00000012·v0000000·v0000000·views·at·0000000c·for: | 14 | ····00000012·v0000000·v0000000·views·at·0000000c·for: |
| 15 | ·············000e | 15 | ·············000e7f60·000e8357·(DW_OP_fbreg:·0) |
| 16 | ····0000001c·00081 | 16 | ····0000001c·00081280·(base·address) |
| 17 | ····00000021·v0000000·v0000000·views·at·0000000e·for: | 17 | ····00000021·v0000000·v0000000·views·at·0000000e·for: |
| 18 | ·············00081 | 18 | ·············00081280·000812e9·(DW_OP_fbreg:·0) |
| 19 | ····00000027·v0000000·v0000000·views·at·00000010·for: | 19 | ····00000027·v0000000·v0000000·views·at·00000010·for: |
| 20 | ·············00081 | 20 | ·············000812ee·00081336·(DW_OP_fbreg:·0) |
| 21 | ····0000002e·<End·of·list> | 21 | ····0000002e·<End·of·list> |
| 22 | ····0000002f·v0000000·v0000000·location·view·pair | 22 | ····0000002f·v0000000·v0000000·location·view·pair |
| 23 | ····00000031·v0000000·v0000000·location·view·pair | 23 | ····00000031·v0000000·v0000000·location·view·pair |
| 24 | ····00000033·v0000000·v0000000·location·view·pair | 24 | ····00000033·v0000000·v0000000·location·view·pair |
| 25 | ····00000035·v0000000·v0000000·location·view·pair | 25 | ····00000035·v0000000·v0000000·location·view·pair |
| 26 | ····00000037·v0000000·v0000000·location·view·pair | 26 | ····00000037·v0000000·v0000000·location·view·pair |
| 27 | ····00000039·000e8 | 27 | ····00000039·000e8096·(base·address) |
| 28 | ····0000003e·v0000000·v0000000·views·at·0000002f·for: | 28 | ····0000003e·v0000000·v0000000·views·at·0000002f·for: |
| 29 | ·············000e8 | 29 | ·············000e8096·000e809c·(DW_OP_reg0·(eax)) |
| 30 | ····00000043·v0000000·v0000000·views·at·00000031·for: | 30 | ····00000043·v0000000·v0000000·views·at·00000031·for: |
| 31 | ·············000e8 | 31 | ·············000e809c·000e8148·(DW_OP_fbreg:·-4016) |
| 32 | ····0000004b·v0000000·v0000000·views·at·00000033·for: | 32 | ····0000004b·v0000000·v0000000·views·at·00000033·for: |
| 33 | ·············000e8 | 33 | ·············000e8233·000e8293·(DW_OP_fbreg:·-4016) |
| 34 | ····00000054·00081 | 34 | ····00000054·000812ee·(base·address) |
| 35 | ····00000059·v0000000·v0000000·views·at·00000035·for: | 35 | ····00000059·v0000000·v0000000·views·at·00000035·for: |
| 36 | ·············00081 | 36 | ·············000812ee·000812ff·(DW_OP_fbreg:·-4016) |
| 37 | ····00000060·v0000000·v0000000·views·at·00000037·for: | 37 | ····00000060·v0000000·v0000000·views·at·00000037·for: |
| 38 | ·············00081 | 38 | ·············00081327·0008132c·(DW_OP_fbreg:·-4016) |
| 39 | ····00000067·<End·of·list> | 39 | ····00000067·<End·of·list> |
| 40 | ····00000068·v0000000·v0000000·location·view·pair | 40 | ····00000068·v0000000·v0000000·location·view·pair |
| 41 | ····0000006a·v0000000·v0000000·views·at·00000068·for: | 41 | ····0000006a·v0000000·v0000000·views·at·00000068·for: |
| 42 | ·············000e8 | 42 | ·············000e8111·000e8117·(DW_OP_fbreg:·-4020) |
| 43 | ····00000074·<End·of·list> | 43 | ····00000074·<End·of·list> |
| 44 | ····00000075·v0000003·v0000002·location·view·pair | 44 | ····00000075·v0000003·v0000002·location·view·pair |
| 45 | ····00000077·v0000003·v0000002·views·at·00000075·for: | 45 | ····00000077·v0000003·v0000002·views·at·00000075·for: |
| 46 | ·············000e | 46 | ·············000e7faa·000e7fc1·(DW_OP_implicit_pointer:·<0x24b30>·0) |
| 47 | ····00000084·<End·of·list> | 47 | ····00000084·<End·of·list> |
| 48 | ····00000085·v0000000·v0000003·location·view·pair | 48 | ····00000085·v0000000·v0000003·location·view·pair |
| 49 | ····00000087·v0000000·v0000003·views·at·00000085·for: | 49 | ····00000087·v0000000·v0000003·views·at·00000085·for: |
| 50 | ·············000e | 50 | ·············000e7faa·000e7faa·(DW_OP_implicit_pointer:·<0x24b30>·0) |
| 51 | ····00000094·<End·of·list> | 51 | ····00000094·<End·of·list> |
| 52 | ····00000095·v0000003·v0000002·location·view·pair | 52 | ····00000095·v0000003·v0000002·location·view·pair |
| 53 | ····00000097·v0000003·v0000002·views·at·00000095·for: | 53 | ····00000097·v0000003·v0000002·views·at·00000095·for: |
| 54 | ·············000e | 54 | ·············000e7faa·000e7fc1·(DW_OP_reg7·(edi)) |
| 55 | ····0000009f·<End·of·list> | 55 | ····0000009f·<End·of·list> |
| 56 | ····000000a0·v0000005·v0000002·location·view·pair | 56 | ····000000a0·v0000005·v0000002·location·view·pair |
| 57 | ····000000a2·v0000005·v0000002·views·at·000000a0·for: | 57 | ····000000a2·v0000005·v0000002·views·at·000000a0·for: |
| 58 | ·············000e | 58 | ·············000e7faa·000e7fc1·(DW_OP_lit0;·DW_OP_stack_value) |
| 59 | ····000000ab·<End·of·list> | 59 | ····000000ab·<End·of·list> |
| 60 | ····000000ac·v0000005·v0000006·location·view·pair | 60 | ····000000ac·v0000005·v0000006·location·view·pair |
| 61 | ····000000ae·v0000005·v0000006·views·at·000000ac·for: | 61 | ····000000ae·v0000005·v0000006·views·at·000000ac·for: |
| 62 | ·············000e | 62 | ·············000e7faa·000e7faa·(DW_OP_implicit_pointer:·<0x24234>·0) |
| 63 | ····000000bb·<End·of·list> | 63 | ····000000bb·<End·of·list> |
| 64 | ····000000bc·v0000005·v0000006·location·view·pair | 64 | ····000000bc·v0000005·v0000006·location·view·pair |
| 65 | ····000000be·v0000005·v0000006·views·at·000000bc·for: | 65 | ····000000be·v0000005·v0000006·views·at·000000bc·for: |
| 66 | ·············000e | 66 | ·············000e7faa·000e7faa·(DW_OP_reg7·(edi)) |
| 67 | ····000000c6·<End·of·list> | 67 | ····000000c6·<End·of·list> |
| 68 | ····000000c7·v0000006·v0000000·location·view·pair | 68 | ····000000c7·v0000006·v0000000·location·view·pair |
| 69 | ····000000c9·v0000006·v0000000·views·at·000000c7·for: | 69 | ····000000c9·v0000006·v0000000·views·at·000000c7·for: |
| 70 | ·············000e | 70 | ·············000e7faa·000e7fc1·(DW_OP_reg7·(edi)) |
| 71 | ····000000d1·<End·of·list> | 71 | ····000000d1·<End·of·list> |
| 72 | ····000000d2·v0000006·v0000000·location·view·pair | 72 | ····000000d2·v0000006·v0000000·location·view·pair |
| 73 | ····000000d4·v0000006·v0000000·views·at·000000d2·for: | 73 | ····000000d4·v0000006·v0000000·views·at·000000d2·for: |
| 74 | ·············000e | 74 | ·············000e7faa·000e7fc1·(DW_OP_lit0;·DW_OP_stack_value) |
| 75 | ····000000dd·<End·of·list> | 75 | ····000000dd·<End·of·list> |
| 76 | ····000000de·v0000008·v0000000·location·view·pair | 76 | ····000000de·v0000008·v0000000·location·view·pair |
| 77 | ····000000e0·v0000008·v0000000·views·at·000000de·for: | 77 | ····000000e0·v0000008·v0000000·views·at·000000de·for: |
| 78 | ·············000e | 78 | ·············000e7faa·000e7fba·(DW_OP_reg7·(edi)) |
| 79 | ····000000e8·<End·of·list> | 79 | ····000000e8·<End·of·list> |
| 80 | ····000000e9·v0000008·v0000000·location·view·pair | 80 | ····000000e9·v0000008·v0000000·location·view·pair |
| 81 | ····000000eb·v0000008·v0000000·views·at·000000e9·for: | 81 | ····000000eb·v0000008·v0000000·views·at·000000e9·for: |
| 82 | ·············000e | 82 | ·············000e7faa·000e7fba·(DW_OP_lit0;·DW_OP_stack_value) |
| 83 | ····000000f4·<End·of·list> | 83 | ····000000f4·<End·of·list> |
| 84 | ····000000f5·v0000000·v0000000·location·view·pair | 84 | ····000000f5·v0000000·v0000000·location·view·pair |
| 85 | ····000000f7·v0000000·v0000000·views·at·000000f5·for: | 85 | ····000000f7·v0000000·v0000000·views·at·000000f5·for: |
| 86 | ·············000e | 86 | ·············000e7fba·000e7fc1·(DW_OP_breg7·(edi):·0) |
| 87 | ····00000100·<End·of·list> | 87 | ····00000100·<End·of·list> |
| 88 | ····00000101·v0000000·v0000002·location·view·pair | 88 | ····00000101·v0000000·v0000002·location·view·pair |
| 89 | ····00000103·v0000000·v0000002·views·at·00000101·for: | 89 | ····00000103·v0000000·v0000002·views·at·00000101·for: |
| 90 | ·············000e | 90 | ·············000e7fc1·000e7fc1·(DW_OP_implicit_pointer:·<0x24234>·0) |
| 91 | ····00000110·<End·of·list> | 91 | ····00000110·<End·of·list> |
| 92 | ····00000111·v0000000·v0000004·location·view·pair | 92 | ····00000111·v0000000·v0000004·location·view·pair |
| 93 | ····00000113·v0000000·v0000004·views·at·00000111·for: | 93 | ····00000113·v0000000·v0000004·views·at·00000111·for: |
| 94 | ·············000e | 94 | ·············000e7fea·000e7ffa·(DW_OP_reg7·(edi)) |
| 95 | ····0000011b·<End·of·list> | 95 | ····0000011b·<End·of·list> |
| 96 | ····0000011c·v0000001·v0000000·location·view·pair | 96 | ····0000011c·v0000001·v0000000·location·view·pair |
| 97 | ····0000011e·v0000001·v0000000·views·at·0000011c·for: | 97 | ····0000011e·v0000001·v0000000·views·at·0000011c·for: |
| 98 | ·············000e | 98 | ·············000e7fea·000e7ffa·(DW_OP_reg7·(edi)) |
| 99 | ····00000126·<End·of·list> | 99 | ····00000126·<End·of·list> |
| 100 | ····00000127·v0000002·v0000000·location·view·pair | 100 | ····00000127·v0000002·v0000000·location·view·pair |
| Max diff block lines reached; 327510570/327516563 bytes (100.00%) of diff not shown. | |||
| Offset 1, 5203 lines modified | Offset 1, 5198 lines modified | ||
| 1 | Contents·of·the·.debug_aranges·section: | 1 | Contents·of·the·.debug_aranges·section: |
| 2 | ··Length:···················44 | 2 | ··Length:···················44 |
| 3 | ··Version:··················2 | 3 | ··Version:··················2 |
| 4 | ··Offset·into·.debug_info:··0x2 | 4 | ··Offset·into·.debug_info:··0x22a5e |
| 5 | ··Pointer·Size:·············4 | 5 | ··Pointer·Size:·············4 |
| 6 | ··Segment·Size:·············0 | 6 | ··Segment·Size:·············0 |
| 7 | ····Address····Length | 7 | ····Address····Length |
| 8 | ····000e | 8 | ····000e7f60·000003f7 |
| 9 | ····00081 | 9 | ····00081280·000000b6 |
| 10 | ····000e8 | 10 | ····000e8360·00000006 |
| 11 | ····00000000·00000000 | 11 | ····00000000·00000000 |
| 12 | ··Length:···················1164 | 12 | ··Length:···················1164 |
| 13 | ··Version:··················2 | 13 | ··Version:··················2 |
| 14 | ··Offset·into·.debug_info:··0x2 | 14 | ··Offset·into·.debug_info:··0x24b36 |
| 15 | ··Pointer·Size:·············4 | 15 | ··Pointer·Size:·············4 |
| 16 | ··Segment·Size:·············0 | 16 | ··Segment·Size:·············0 |
| 17 | ····Address····Length | 17 | ····Address····Length |
| 18 | ····000e8 | 18 | ····000e8380·00037e03 |
| 19 | ····00081 | 19 | ····0008170a·00008ad9 |
| 20 | ····000e8 | 20 | ····000e8360·00000006 |
| 21 | ····00120 | 21 | ····00120190·00000003 |
| 22 | ····00120 | 22 | ····001201a0·0000000b |
| 23 | ····001207f0·00000001 | ||
| 24 | ····00120800·00000001 | ||
| 25 | ····00120 | 23 | ····001201b0·00000001 |
| 26 | ····00120 | 24 | ····001201c0·00000001 |
| 27 | ····00120830·000000ab | ||
| 28 | ····001208e0·00000026 | ||
| 29 | ····00120 | 25 | ····001201d0·00000001 |
| 30 | ····00120 | 26 | ····001201e0·00000001 |
| 27 | ····001201f0·000000ab | ||
| 31 | ····00120 | 28 | ····001202a0·00000026 |
| 32 | ····00120ac0·00000030 | ||
| 33 | ····00120af0·00000026 | ||
| 34 | ····00120 | 29 | ····001202d0·00000030 |
| 30 | ····00120300·00000067 | ||
| 31 | ····00120450·00000026 | ||
| 32 | ····00120480·00000030 | ||
| 33 | ····001204b0·00000026 | ||
| 34 | ····001204e0·00000030 | ||
| 35 | ····00120 | 35 | ····00120540·00000234 |
| 36 | ····00120 | 36 | ····00120780·000008b3 |
| 37 | ····00081 | 37 | ····00081336·000000f1 |
| 38 | ····00081 | 38 | ····00081428·000000f1 |
| 39 | ····00081 | 39 | ····0008151a·000000f7 |
| 40 | ····00081 | 40 | ····00081612·000000f7 |
| 41 | ····00121 | 41 | ····00121040·00000013 |
| 42 | ····00121 | 42 | ····00121060·00000073 |
| 43 | ····00121 | 43 | ····001210e0·0000006e |
| 44 | ····00120 | 44 | ····00120370·0000006c |
| 45 | ····00120 | 45 | ····001203e0·00000064 |
| 46 | ····00121 | 46 | ····00121150·00000078 |
| 47 | ····00121 | 47 | ····001211d0·0000005d |
| 48 | ····00121930·0000005d | ||
| 49 | ····00121a50·00000063 | ||
| 50 | ····00121ac0·00000065 | ||
| 51 | ····00121ba0·00000063 | ||
| 52 | ····00121c10·00000065 | ||
| 53 | ····00121870·0000005b | ||
| 54 | ····001218d0·0000005d | ||
| 55 | ····00121990·0000005b | ||
| 56 | ····00121 | 48 | ····001212f0·0000005d |
| 57 | ····00121 | 49 | ····00121410·00000063 |
| 58 | ····00121 | 50 | ····00121480·00000065 |
| 59 | ····00121cf0·0000006c | ||
| 60 | ····00121e40·0000006c | ||
| 61 | ····00121 | 51 | ····00121560·00000063 |
| 62 | ····001220e0·00000063 | ||
| 63 | ····00121d60·0000006d | ||
| 64 | ····00121dd0·0000006f | ||
| 65 | ····00121eb0·0000006d | ||
| 66 | ····00121f20·0000006f | ||
| 67 | ····00122000·00000065 | ||
| 68 | ····00122070·00000067 | ||
| 69 | ····0012 | 52 | ····001215d0·00000065 |
| 53 | ····00121230·0000005b | ||
| 54 | ····00121290·0000005d | ||
| 55 | ····00121350·0000005b | ||
| 56 | ····001213b0·0000005d | ||
| 57 | ····001214f0·00000065 | ||
| 58 | ····00121640·00000065 | ||
| 59 | ····001216b0·0000006c | ||
| 60 | ····00121800·0000006c | ||
| 61 | ····00121950·00000063 | ||
| 62 | ····00121aa0·00000063 | ||
| 63 | ····00121720·0000006d | ||
| 64 | ····00121790·0000006f | ||
| 65 | ····00121870·0000006d | ||
| 66 | ····001218e0·0000006f | ||
| 70 | ····0012 | 67 | ····001219c0·00000065 |
| 68 | ····00121a30·00000067 | ||
| 69 | ····00121b10·00000065 | ||
| 70 | ····00121b80·00000067 | ||
| 71 | ····0012 | 71 | ····00121bf0·00000121 |
| 72 | ····0012 | 72 | ····00121d20·00000129 |
| 73 | ····0012 | 73 | ····00121e50·000000f4 |
| 74 | ····0012 | 74 | ····00121f50·00000114 |
| 75 | ····00122 | 75 | ····00122070·0000009f |
| 76 | ····0008a | 76 | ····0008a1e3·00000036 |
| 77 | ····00122 | 77 | ····00122110·00000046 |
| 78 | ····00122 | 78 | ····00122160·000003e1 |
| 79 | ····00122 | 79 | ····00122550·000002df |
| 80 | ····00122 | 80 | ····00122830·000000bc |
| 81 | ····00122 | 81 | ····001228f0·000000a0 |
| 82 | ····00122 | 82 | ····00122990·000001a2 |
| 83 | ····0012 | 83 | ····00122b40·00000005 |
| 84 | ····0012 | 84 | ····00122b50·00000082 |
| 85 | ····0012 | 85 | ····00122be0·000000e9 |
| 86 | ····0012 | 86 | ····00122cd0·00000053 |
| 87 | ····0012 | 87 | ····00122d30·0000005a |
| 88 | ····0012 | 88 | ····00122d90·0000004e |
| 89 | ····0012 | 89 | ····00122de0·00000088 |
| 90 | ····0012 | 90 | ····00122e70·00000057 |
| 91 | ····0012 | 91 | ····00122ed0·00000205 |
| 92 | ····00123 | 92 | ····001230e0·00000173 |
| 93 | ····00123 | 93 | ····00123260·0000008f |
| 94 | ····00123 | 94 | ····001232f0·000000c3 |
| 95 | ····00123a00·0000002c | ||
| 96 | ····00123 | 95 | ····001233c0·0000002c |
| 97 | ····00123 | 96 | ····001233f0·0000002c |
| 97 | ····00123420·0000002c | ||
| 98 | ····00123 | 98 | ····00123450·0000038e |
| 99 | ····00123 | 99 | ····001237e0·00000029 |
| 100 | ····00123 | 100 | ····00123810·0000010a |
| Max diff block lines reached; 206151/213428 bytes (96.59%) of diff not shown. | |||
| Offset 1, 5223 lines modified | Offset 1, 5125 lines modified | Diff chunk too large, falling back to line-by-line diff (2981 lines added, 2992 lines removed) | |
| 1 | GCC:·(Debian·14.2.0-8)·14.2.0 | 1 | GCC:·(Debian·14.2.0-8)·14.2.0 |
| 2 | 2 | :» >X>t*> | |
| 3 | 3 | lgF7lgG/l' | |
| 4 | 4 | .0}G`z~` | |
| 5 | 5 | aH_`H_aH | |
| 6 | 6 | _8V·'H(x | |
| 7 | 7 | jNmoBNkb3 | |
| 8 | 8 | K3s`aeKln | |
| 9 | 9 | cy-s4jU8 | |
| 10 | 10 | [<SDIO2Y | |
| 11 | 11 | )mfpm<c_ | |
| 12 | 12 | uLUq=7q% | |
| 13 | 13 | ?*#r·"iZ | |
| 14 | 14 | C6)h.·j5' | |
| 15 | 15 | WE#3d;·s | |
| 16 | 16 | &rdWQuH· | |
| 17 | 17 | G^a1+8Ih | |
| 18 | 18 | Zg9j?.1f | |
| 19 | 19 | 7\-K>ev:( | |
| 20 | 20 | ?x:_0j"Lg | |
| 21 | 21 | \W\S*R(# | |
| 22 | 22 | Udm|l"!O}>p | |
| 23 | 23 | k}.n/#TW | |
| 24 | 24 | 'CYU$9Tm | |
| 25 | 25 | UdQScooE | |
| 26 | 26 | Oc62"!7R | |
| 27 | 27 | "*<WOL^F | |
| 28 | 28 | x]%!WGIi | |
| 29 | 29 | I>s» wi0S` | |
| 30 | 30 | HLJ];>+KQkB | |
| 31 | 31 | ][CyE's?+X | |
| 32 | 32 | » jQYlbo; | |
| 33 | 33 | nNg^#Q~:p | |
| 34 | 34 | d*Xv5<w' | |
| 35 | 35 | \nq!v]Xn | |
| 36 | 36 | Lu;Yl,)C | |
| 37 | 37 | L6dqo*oY | |
| 38 | 38 | SOQ"#·(0B6 | |
| 39 | 39 | (sZqO6H- | |
| 40 | 40 | |Xf}is?/I | |
| 41 | 41 | ^;.:)\Co· | |
| 42 | 42 | @FTc!J4V | |
| 43 | 43 | 5@:e·yG: | |
| 44 | 44 | K}3Y>%KB]t | |
| 45 | 45 | ;K$Wb$Oes | |
| 46 | 46 | B^}xAc$-D | |
| 47 | 47 | 6:_·J%I4 | |
| 48 | 48 | &G5iwJ{? | |
| 49 | 49 | +@XzMNC( | |
| 50 | 50 | G$(mSe{Dr{ | |
| 51 | 51 | Co1osFsRRS | |
| 52 | 52 | +pAxp'x>Q | |
| 53 | 53 | %9L}c·;< | |
| 54 | 54 | @D9\KMOZ0d1l | |
| 55 | 55 | t]Qyp.d\ | |
| 56 | 56 | @F<])mp. | |
| 57 | 57 | 4:E2&Ran | |
| 58 | 58 | <a_Z*'lQO | |
| 59 | 59 | riV^s@>I | |
| 60 | 60 | Y9rB?K}'F9 | |
| 61 | 61 | ou?MkUNJ | |
| 62 | 62 | 'YW;`J·E | |
| 63 | 63 | Tk:&s_i` | |
| 64 | 64 | GL{#]zQ= | |
| 65 | 65 | &yDq(_R' | |
| 66 | 66 | h0QH!_VSh | |
| 67 | 67 | (<aEa^·sg | |
| 68 | 68 | (e9NY>H}U? | |
| 69 | 69 | %uOP3zI] | |
| 70 | 70 | #Y~$-uaI' | |
| 71 | 71 | \c8{gID= | |
| 72 | 72 | [·_RbtzO | |
| 73 | 73 | » X4>>xxero | |
| 74 | 74 | gf|p[8v+j | |
| 75 | 75 | 7GTn`|A~ | |
| 76 | 76 | J{fj9tI2S | |
| 77 | 77 | k!jCdN!q | |
| 78 | 78 | {az)|#7U | |
| 79 | 79 | V4k1rC·v;2 | |
| 80 | 80 | e» "zTB1^ | |
| 81 | 81 | QM*dt_@} | |
| 82 | 82 | ^)Qv5RJTrm | |
| 83 | 83 | PZytVhRMDl | |
| 84 | 84 | p^J%zo5I | |
| 85 | 85 | Yh<grH2.N | |
| 86 | 86 | OOQgd5/K | |
| 87 | 87 | c8/iSN9) | |
| 88 | 88 | HO!lG`+} | |
| 89 | 89 | eQ}uQdtc% | |
| 90 | 90 | ~Poz+VRP | |
| 91 | 91 | ],SPO'4R» | |
| 92 | 92 | l{"H6I:k | |
| 93 | 93 | _CzXaO9C | |
| 94 | 94 | M!<G)^F·@ | |
| 95 | 95 | E#Q*xUjub | |
| 96 | 96 | S>']R^Rk· | |
| 97 | 97 | J[t» [Ll={ | |
| 98 | 98 | F5X)EdF} | |
| 99 | 99 | \U3*|~&J | |
| 100 | 100 | !;#[Ch^CvF | |
| 101 | 101 | !25Y;!lo$_ | |
| 102 | 102 | (B,wjB» 6* | |
| 103 | 103 | j5%4.CM»Y | |
| 104 | 104 | '9L1xhjN^ | |
| 105 | 105 | &t\wf\E> | |
| 106 | 106 | {!_3E[#& | |
| 107 | 107 | ·.!Okf5# | |
| 108 | 108 | -O+J3+>yZe | |
| 109 | 109 | R<FC)0Kd | |
| 110 | 110 | x7t9Y·2H | |
| 111 | 111 | 1WY#N@56 | |
| 112 | 112 | Ic9{INm[P | |
| 113 | 113 | [G/&hfge | |
| 114 | 114 | ·J;-NUHZ@ | |
| 115 | 115 | R*$s-E:o | |
| 116 | 116 | 2Fmi`Azo | |
| 117 | 117 | A4m$+"5x | |
| 118 | 118 | J`4'@~:J | |
| 119 | 119 | M5:$-L5:$ | |
| 120 | 120 | 6{k<5;&6 | |
| 121 | 121 | ,PgP[Z^Y» c | |
| 122 | 122 | |OvcJ77OZ+ | |
| 123 | 123 | d"{2Q{2k | |
| 124 | 124 | m`YFO>bO> | |
| 125 | 125 | rU\W|qC- | |
| 126 | 126 | BjCOJlUOrv | |
| Max diff block lines reached; 71314/134973 bytes (52.84%) of diff not shown. | |||
| Offset 1, 7 lines modified | Offset 1, 7 lines modified | ||
| 1 | Disassembly·of·section·.plt.got: | 1 | Disassembly·of·section·.plt.got: |
| 2 | 00081 | 2 | 00081260·<.plt.got>: |
| 3 | » ... | 3 | » ... |
| Offset 1, 23491 lines modified | Offset 1, 23443 lines modified | ||
| 1 | Disassembly·of·section·.text: | 1 | Disassembly·of·section·.text: |
| 2 | 00081 | 2 | 00081280·<doParsMultiState(Params&)·[clone·.cold]>: |
| 3 | » ... | 3 | » ... |
| 4 | 00081 | 4 | 00081336·<boost::wrapexcept<std::overflow_error>::rethrow()·const>: |
| 5 | » ... | 5 | » ... |
| 6 | 00081 | 6 | 00081428·<boost::wrapexcept<std::domain_error>::rethrow()·const>: |
| 7 | » ... | 7 | » ... |
| 8 | 00081 | 8 | 0008151a·<boost::wrapexcept<boost::math::rounding_error>::rethrow()·const>: |
| 9 | » ... | 9 | » ... |
| 10 | 00081 | 10 | 00081612·<boost::wrapexcept<boost::math::evaluation_error>::rethrow()·const>: |
| 11 | » ... | 11 | » ... |
| 12 | 00081 | 12 | 0008170a·<std::__cxx11::basic_string<char,·std::char_traits<char>,·std::allocator<char>·>::basic_string(char·const*,·std::allocator<char>·const&)·[clone·.isra.0]·[clone·.cold]>: |
| 13 | » ... | 13 | » ... |
| 14 | 00081 | 14 | 0008172c·<std::tr1::__detail::_Map_base<unsigned·int,·std::pair<unsigned·int·const,·unsigned·int>,·std::_Select1st<std::pair<unsigned·int·const,·unsigned·int>·>,·true,·std::tr1::_Hashtable<unsigned·int,·std::pair<unsigned·int·const,·unsigned·int>,·std::allocator<std::pair<unsigned·int·const,·unsigned·int>·>,·std::_Select1st<std::pair<unsigned·int·const,·unsigned·int>·>,·std::equal_to<unsigned·int>,·std::tr1::hash<unsigned·int>,·std::tr1::__detail::_Mod_range_hashing,·std::tr1::__detail::_Default_ranged_hash,·std::tr1::__detail::_Prime_rehash_policy,·false,·false,·true>·>::operator[](unsigned·int·const&)·[clone·.isra.0]·[clone·.cold]>: |
| 15 | » ... | 15 | » ... |
| 16 | 00081 | 16 | 0008175c·<std::__cxx11::basic_string<char,·std::char_traits<char>,·std::allocator<char>·>·std::operator+<char,·std::char_traits<char>,·std::allocator<char>·>(char·const*,·std::__cxx11::basic_string<char,·std::char_traits<char>,·std::allocator<char>·>·const&)·[clone·.isra.0]>: |
| 17 | » ... | 17 | » ... |
| 18 | 00081 | 18 | 0008181c·<std::__cxx11::basic_string<char,·std::char_traits<char>,·std::allocator<char>·>·std::operator+<char,·std::char_traits<char>,·std::allocator<char>·>(std::__cxx11::basic_string<char,·std::char_traits<char>,·std::allocator<char>·>&&,·std::__cxx11::basic_string<char,·std::char_traits<char>,·std::allocator<char>·>·const&)·[clone·.isra.0]>: |
| 19 | » ... | 19 | » ... |
| 20 | 00081 | 20 | 0008189e·<std::vector<std::__cxx11::basic_string<char,·std::char_traits<char>,·std::allocator<char>·>,·std::allocator<std::__cxx11::basic_string<char,·std::char_traits<char>,·std::allocator<char>·>·>·>::operator=(std::vector<std::__cxx11::basic_string<char,·std::char_traits<char>,·std::allocator<char>·>,·std::allocator<std::__cxx11::basic_string<char,·std::char_traits<char>,·std::allocator<char>·>·>·>·const&)·[clone·.isra.0]·[clone·.cold]>: |
| 21 | » ... | 21 | » ... |
| 22 | 00081 | 22 | 00081946·<std::_Rb_tree_iterator<std::pair<std::__cxx11::basic_string<char,·std::char_traits<char>,·std::allocator<char>·>·const,·int>·>·std::_Rb_tree<std::__cxx11::basic_string<char,·std::char_traits<char>,·std::allocator<char>·>,·std::pair<std::__cxx11::basic_string<char,·std::char_traits<char>,·std::allocator<char>·>·const,·int>,·std::_Select1st<std::pair<std::__cxx11::basic_string<char,·std::char_traits<char>,·std::allocator<char>·>·const,·int>·>,·std::less<std::__cxx11::basic_string<char,·std::char_traits<char>,·std::allocator<char>·>·>,·std::allocator<std::pair<std::__cxx11::basic_string<char,·std::char_traits<char>,·std::allocator<char>·>·const,·int>·>·>::_M_emplace_hint_unique<std::piecewise_construct_t·const&,·std::tuple<std::__cxx11::basic_string<char,·std::char_traits<char>,·std::allocator<char>·>·const&>,·std::tuple<>·>(std::_Rb_tree_const_iterator<std::pair<std::__cxx11::basic_string<char,·std::char_traits<char>,·std::allocator<char>·>·const,·int>·>,·std::piecewise_construct_t·const&,·std::tuple<std::__cxx11::basic_string<char,·std::char_traits<char>,·std::allocator<char>·>·const&>&&,·std::tuple<>&&)·[clone·.isra.0]·[clone·.cold]>: |
| 23 | » ... | 23 | » ... |
| 24 | 00081 | 24 | 000819a4·<Alignment::convertPomoState(int)·[clone·.part.0]·[clone·.cold]>: |
| 25 | Alignment::convertPomoState(int)·[clone·.part.0]·[clone·.cold]: | 25 | Alignment::convertPomoState(int)·[clone·.part.0]·[clone·.cold]: |
| 26 | /usr/include/c++/14/bits/basic_ios.h:50 | 26 | /usr/include/c++/14/bits/basic_ios.h:50 |
| 27 | » add····%al,(%eax) | 27 | » add····%al,(%eax) |
| 28 | » add····%al,(%eax) | 28 | » add····%al,(%eax) |
| 29 | » ... | 29 | » ... |
| 30 | 00081 | 30 | 000819aa·<Alignment::computeObsDist(int,·int)·[clone·.cold]>: |
| 31 | » ... | 31 | » ... |
| 32 | 00081 | 32 | 00081a88·<Alignment::computeDivergenceMatrix(double*,·double*,·bool)·[clone·.cold]>: |
| 33 | » ... | 33 | » ... |
| 34 | 00081 | 34 | 00081aa4·<Alignment::checkGappySeq(bool)·[clone·.cold]>: |
| 35 | » ... | 35 | » ... |
| 36 | 00081 | 36 | 00081b45·<getDataBlockMorphStates(NxsCharactersBlock*)·[clone·.cold]>: |
| 37 | » ... | 37 | » ... |
| 38 | 00081 | 38 | 00081c88·<Alignment::printSiteInfoHeader(std::ostream&,·char·const*,·bool)·[clone·.cold]>: |
| 39 | Alignment::printSiteInfoHeader(std::ostream&,·char·const*,·bool)·[clone·.cold]: | 39 | Alignment::printSiteInfoHeader(std::ostream&,·char·const*,·bool)·[clone·.cold]: |
| 40 | /usr/include/c++/14/bits/basic_ios.h:50 | 40 | /usr/include/c++/14/bits/basic_ios.h:50 |
| 41 | » add····%al,(%eax) | 41 | » add····%al,(%eax) |
| 42 | » add····%al,(%eax) | 42 | » add····%al,(%eax) |
| 43 | » ... | 43 | » ... |
| 44 | 00081 | 44 | 00081c8e·<Alignment::convertStateBackStr[abi:cxx11](unsigned·int)·[clone·.cold]>: |
| 45 | » ... | 45 | » ... |
| 46 | 00081 | 46 | 00081d14·<Alignment::checkAbsentStates(std::__cxx11::basic_string<char,·std::char_traits<char>,·std::allocator<char>·>)·[clone·.cold]>: |
| 47 | » ... | 47 | » ... |
| 48 | 00081 | 48 | 00081e90·<Alignment::initCodon(char*)·[clone·.cold]>: |
| 49 | » ... | 49 | » ... |
| 50 | 00081 | 50 | 00081ede·<Alignment::getSiteFromResidue(int,·int&,·int&)·[clone·.cold]>: |
| 51 | » ... | 51 | » ... |
| 52 | 00081 | 52 | 00081efe·<convert_range(char·const*,·int&,·int&,·int&,·char*&)·[clone·.cold]>: |
| 53 | » ... | 53 | » ... |
| 54 | 00082 | 54 | 0008202e·<Alignment::printDist(std::ostream&,·double*)·[clone·.cold]>: |
| 55 | Alignment::printDist(std::ostream&,·double*)·[clone·.cold]: | 55 | Alignment::printDist(std::ostream&,·double*)·[clone·.cold]: |
| 56 | /usr/include/c++/14/bits/basic_ios.h:50 | 56 | /usr/include/c++/14/bits/basic_ios.h:50 |
| 57 | » add····%al,(%eax) | 57 | » add····%al,(%eax) |
| 58 | » add····%al,(%eax) | 58 | » add····%al,(%eax) |
| 59 | » ... | 59 | » ... |
| 60 | 00082 | 60 | 00082034·<Alignment::countStatePerSequence(unsigned·int*)·[clone·.cold]>: |
| 61 | » ... | 61 | » ... |
| 62 | 00082 | 62 | 00082048·<Alignment::computeStateFreqPerSequence(double*)·[clone·.cold]>: |
| 63 | » ... | 63 | » ... |
| 64 | 00082 | 64 | 00082064·<Alignment::convertCountToFreq(unsigned·int*,·double*)·[clone·.cold]>: |
| 65 | » ... | 65 | » ... |
| 66 | 00082 | 66 | 0008206e·<Alignment::computeStateFreq(double*,·unsigned·int)·[clone·.cold]>: |
| 67 | » ... | 67 | » ... |
| 68 | 00082 | 68 | 00082078·<Alignment::computeCodonFreq(StateFreqType,·double*,·double*)·[clone·.cold]>: |
| 69 | » ... | 69 | » ... |
| 70 | 00082 | 70 | 000820b8·<Alignment::multinomialProb(Alignment,·double&)·[clone·.cold]>: |
| 71 | » ... | 71 | » ... |
| 72 | 00082 | 72 | 000820e0·<Alignment::multinomialProb(std::vector<int,·std::allocator<int>·>&)·[clone·.cold]>: |
| 73 | » ... | 73 | » ... |
| 74 | 00082 | 74 | 000820f1·<processSeq(std::__cxx11::basic_string<char,·std::char_traits<char>,·std::allocator<char>·>&,·std::__cxx11::basic_string<char,·std::char_traits<char>,·std::allocator<char>·>&,·int)·[clone·.cold]>: |
| 75 | » ... | 75 | » ... |
| 76 | 00082 | 76 | 00082396·<Alignment::Alignment()·[clone·.cold]>: |
| 77 | » ... | 77 | » ... |
| 78 | 00082 | 78 | 0008247a·<Alignment::printSiteGaps(char·const*)·[clone·.cold]>: |
| 79 | » ... | 79 | » ... |
| 80 | 00082 | 80 | 00082694·<Alignment::printDist(char·const*,·double*)·[clone·.cold]>: |
| 81 | » ... | 81 | » ... |
| 82 | 00082 | 82 | 00082804·<Alignment::printAlignment(InputType,·char·const*,·bool,·char·const*,·int,·char·const*)·[clone·.cold]>: |
| 83 | » ... | 83 | » ... |
| 84 | 00082 | 84 | 00082994·<Alignment::createBootstrapAlignment(std::vector<int,·std::allocator<int>·>&,·char·const*)·[clone·.cold]>: |
| 85 | » ... | 85 | » ... |
| 86 | 00082 | 86 | 000829ac·<Alignment::checkIdenticalSeq()·[clone·.cold]>: |
| 87 | » ... | 87 | » ... |
| Max diff block lines reached; 2723896/2735903 bytes (99.56%) of diff not shown. | |||
| Offset 1, 7 lines modified | Offset 1, 7 lines modified | ||
| 1 | Disassembly·of·section·.fini: | 1 | Disassembly·of·section·.fini: |
| 2 | 0051 | 2 | 00512e54·<_fini>: |
| 3 | » ... | 3 | » ... |
| Offset 1, 11 lines modified | Offset 1, 11 lines modified | ||
| 1 | String·dump·of·section·'.debug_line_str': | 1 | String·dump·of·section·'.debug_line_str': |
| 2 | ··[·····0]··./obsolete/parsmultistate.cpp | 2 | ··[·····0]··./obsolete/parsmultistate.cpp |
| 3 | ··[····1e]··./build.mp | 3 | ··[····1e]··./build.omp |
| 4 | ··[····2a]··./obsolete | 4 | ··[····2a]··./obsolete |
| 5 | ··[····35]··/usr/include/c++/14/bits | 5 | ··[····35]··/usr/include/c++/14/bits |
| 6 | ··[····4e]··/usr/include/c++/14 | 6 | ··[····4e]··/usr/include/c++/14 |
| 7 | ··[····62]··/usr/include/c++/14/debug | 7 | ··[····62]··/usr/include/c++/14/debug |
| 8 | ··[····7c]··/usr/include/i386-linux-gnu/c++/14/bits | 8 | ··[····7c]··/usr/include/i386-linux-gnu/c++/14/bits |
| 9 | ··[····a4]··/usr/include/c++/14/tr1 | 9 | ··[····a4]··/usr/include/c++/14/tr1 |
| 10 | ··[····bc]··/usr/include/c++/14/ext | 10 | ··[····bc]··/usr/include/c++/14/ext |
| Offset 103, 15 lines modified | Offset 103, 15 lines modified | ||
| 103 | ··[···578]··phylonode.h | 103 | ··[···578]··phylonode.h |
| 104 | ··[···584]··splitgraph.h | 104 | ··[···584]··splitgraph.h |
| 105 | ··[···591]··phylotree.h | 105 | ··[···591]··phylotree.h |
| 106 | ··[···59d]··new | 106 | ··[···59d]··new |
| 107 | ··[···5a1]··parstree.h | 107 | ··[···5a1]··parstree.h |
| 108 | ··[···5ac]··system_error | 108 | ··[···5ac]··system_error |
| 109 | ··[···5b9]··./alignment/alignment.cpp | 109 | ··[···5b9]··./alignment/alignment.cpp |
| 110 | ··[···5d3]··./build.mp | 110 | ··[···5d3]··./build.omp/alignment |
| 111 | ··[···5e9]··/usr/include/boost/math/policies | 111 | ··[···5e9]··/usr/include/boost/math/policies |
| 112 | ··[···60a]··/usr/include/eigen3/Eigen/src/Core | 112 | ··[···60a]··/usr/include/eigen3/Eigen/src/Core |
| 113 | ··[···62d]··/usr/include/eigen3/Eigen/src/Core/products | 113 | ··[···62d]··/usr/include/eigen3/Eigen/src/Core/products |
| 114 | ··[···659]··/usr/include/eigen3/Eigen/src/Core/util | 114 | ··[···659]··/usr/include/eigen3/Eigen/src/Core/util |
| 115 | ··[···681]··/usr/include/eigen3/Eigen/src/Core/arch/SSE | 115 | ··[···681]··/usr/include/eigen3/Eigen/src/Core/arch/SSE |
| 116 | ··[···6ad]··/usr/include/eigen3/Eigen/src/Core/arch/Default | 116 | ··[···6ad]··/usr/include/eigen3/Eigen/src/Core/arch/Default |
| 117 | ··[···6dd]··/usr/include/boost/math/tools/detail | 117 | ··[···6dd]··/usr/include/boost/math/tools/detail |
| Offset 384, 468 lines modified | Offset 384, 464 lines modified | ||
| 384 | ··[··17ec]··arg.hpp | 384 | ··[··17ec]··arg.hpp |
| 385 | ··[··17f4]··swap.hpp | 385 | ··[··17f4]··swap.hpp |
| 386 | ··[··17fd]··mathcalls.h | 386 | ··[··17fd]··mathcalls.h |
| 387 | ··[··1809]··omp.h | 387 | ··[··1809]··omp.h |
| 388 | ··[··180f]··mygsl.h | 388 | ··[··180f]··mygsl.h |
| 389 | ··[··1817]··assert.h | 389 | ··[··1817]··assert.h |
| 390 | ··[··1820]··./alignment/pattern.cpp | 390 | ··[··1820]··./alignment/pattern.cpp |
| 391 | ··[··1838]··./build.mpi/tree | ||
| 392 | ··[··18 | 391 | ··[··1838]··./tree/phylotree.cpp |
| 392 | ··[··184d]··./build.omp/tree | Diff chunk too large, falling back to line-by-line diff (453 lines added, 457 lines removed) | |
| 393 | ··[··185e]··./pll | 393 | ··[··185e]··./pll |
| 394 | ··[··1864]·· | 394 | ··[··1864]··optimization.h |
| 395 | ··[··18 | 395 | ··[··1873]··mexttree.h |
| 396 | ··[··18 | 396 | ··[··187e]··bionj.h |
| 397 | ··[··18 | 397 | ··[··1886]··memslot.h |
| 398 | ··[··18 | 398 | ··[··1890]··stl_multimap.h |
| 399 | ··[··18 | 399 | ··[··189f]··unordered_set.h |
| 400 | ··[··18 | 400 | ··[··18af]··newick.h |
| 401 | ··[··18 | 401 | ··[··18b8]··pll.h |
| 402 | ··[··18 | 402 | ··[··18be]··supernode.h |
| 403 | ··[··18 | 403 | ··[··18ca]··MPIHelper.h |
| 404 | ··[··18 | 404 | ··[··18d6]··eigendecomposition.h |
| 405 | ··[··18 | 405 | ··[··18eb]··modelmarkov.h |
| 406 | ··[··18f | 406 | ··[··18f9]··modelmixture.h |
| 407 | ··[··190 | 407 | ··[··1908]··constrainttree.h |
| 408 | ··[··19 | 408 | ··[··1919]··phylonodemixlen.h |
| 409 | ··[··192 | 409 | ··[··192b]··stdio2-decl.h |
| 410 | ··[··193 | 410 | ··[··1939]··mm_malloc.h |
| 411 | ··[··194 | 411 | ··[··1945]··phylotreemixlen.h |
| 412 | ··[··19 | 412 | ··[··1957]··phylosupertree.h |
| 413 | ··[··196 | 413 | ··[··1968]··superalignment.h |
| 414 | ··[··197 | 414 | ··[··1979]··./tree/phylotreepars.cpp |
| 415 | ··[··19 | 415 | ··[··1992]··./tree/phylotreesse.cpp |
| 416 | ··[··19 | 416 | ··[··19aa]··modelset.h |
| 417 | ··[··19 | 417 | ··[··19b5]··./tree/parstree.cpp |
| 418 | ··[··19c | 418 | ··[··19c9]··iqtree.h |
| 419 | ··[··19d | 419 | ··[··19d2]··./tree/discordance.cpp |
| 420 | ··[··19e | 420 | ··[··19e9]··./tree/constrainttree.cpp |
| 421 | ··[··1 | 421 | ··[··1a03]··./tree/iqtree.cpp |
| 422 | ··[··1a | 422 | ··[··1a15]··pllnni.h |
| 423 | ··[··1a1e]·· | 423 | ··[··1a1e]··stl_multiset.h |
| 424 | ··[··1a | 424 | ··[··1a2d]··timeutil.h |
| 425 | ··[··1a | 425 | ··[··1a38]··stoprule.h |
| 426 | ··[··1a | 426 | ··[··1a43]··candidateset.h |
| 427 | ··[··1a | 427 | ··[··1a52]··mtreeset.h |
| 428 | ··[··1a | 428 | ··[··1a5d]··partitionmodel.h |
| 429 | ··[··1a | 429 | ··[··1a6e]··phylosupertreeplen.h |
| 430 | ··[··1a8 | 430 | ··[··1a83]··partitionmodelplen.h |
| 431 | ··[··1a9 | 431 | ··[··1a98]··pllInternal.h |
| 432 | ··[··1a | 432 | ··[··1aa6]··./tree/memslot.cpp |
| 433 | ··[··1a | 433 | ··[··1ab9]··./tree/mexttree.cpp |
| 434 | ··[··1ac | 434 | ··[··1acd]··./tree/mtree.cpp |
| 435 | ··[··1ad | 435 | ··[··1ade]··mpdablock.h |
| 436 | ··[··1ae | 436 | ··[··1aea]··msplitsblock.h |
| 437 | ··[··1af | 437 | ··[··1af9]··./tree/mtreeset.cpp |
| 438 | ··[··1b0 | 438 | ··[··1b0d]··./tree/node.cpp |
| 439 | ··[··1b1 | 439 | ··[··1b1d]··./tree/phylonode.cpp |
| 440 | ··[··1b | 440 | ··[··1b32]··./tree/phylosupertree.cpp |
| 441 | ··[··1b | 441 | ··[··1b4c]··./main |
| 442 | ··[··1b | 442 | ··[··1b53]··phylotesting.h |
| 443 | ··[··1b | 443 | ··[··1b62]··superalignmentpairwise.h |
| 444 | ··[··1b7 | 444 | ··[··1b7b]··./tree/phylosupertreeplen.cpp |
| 445 | ··[··1b | 445 | ··[··1b99]··superalignmentpairwiseplen.h |
| 446 | ··[··1b | 446 | ··[··1bb6]··./tree/phylotreemixlen.cpp |
| 447 | ··[··1b | 447 | ··[··1bd1]··ratefree.h |
| 448 | ··[··1b | 448 | ··[··1bdc]··modelfactorymixlen.h |
| 449 | ··[··1b | 449 | ··[··1bf1]··./tree/supernode.cpp |
| 450 | ··[··1 | 450 | ··[··1c06]··./tree/candidateset.cpp |
| 451 | ··[··1c1 | 451 | ··[··1c1e]··stl_deque.h |
| 452 | ··[··1c | 452 | ··[··1c2a]··deque.tcc |
| 453 | ··[··1c3 | 453 | ··[··1c34]··stl_stack.h |
| 454 | ··[··1c4 | 454 | ··[··1c40]··./tree/phylonodemixlen.cpp |
| 455 | ··[··1c5 | 455 | ··[··1c5b]··./phylo-yaml/statespace.cpp |
| 456 | ··[··1c | 456 | ··[··1c77]··./build.omp/phylo-yaml |
| 457 | ··[··1c | 457 | ··[··1c8e]··/usr/include/i386-linux-gnu/sys |
| 458 | ··[··1c | 458 | ··[··1cae]··atomicity.h |
| 459 | ··[··1c | 459 | ··[··1cba]··convert.h |
| 460 | ··[··1c | 460 | ··[··1cc4]··single_threaded.h |
| 461 | ··[··1c | 461 | ··[··1cd6]··parse.h |
| 462 | ··[··1c | 462 | ··[··1cde]··./main/main.cpp |
| 463 | ··[··1c | 463 | ··[··1cee]··./build.omp/main |
| 464 | ··[··1 | 464 | ··[··1cff]··./vectorclass |
| 465 | ··[··1d | 465 | ··[··1d0d]··matree.h |
| 466 | ··[··1d1 | 466 | ··[··1d16]··pdtree.h |
| 467 | ··[··1d | 467 | ··[··1d1f]··maalignment.h |
| 468 | ··[··1d | 468 | ··[··1d2d]··pruning.h |
| 469 | ··[··1d | 469 | ··[··1d37]··greedy.h |
| 470 | ··[··1d | 470 | ··[··1d40]··pdnetwork.h |
| 471 | ··[··1d | 471 | ··[··1d4c]··circularnetwork.h |
| 472 | ··[··1d | 472 | ··[··1d5e]··unistd.h |
| 473 | ··[··1d | 473 | ··[··1d67]··struct_timeval.h |
| 474 | ··[··1d | 474 | ··[··1d78]··struct_rusage.h |
| 475 | ··[··1d8 | 475 | ··[··1d88]··resource.h |
| 476 | ··[··1d9 | 476 | ··[··1d93]··signal.h |
| 477 | ··[··1d | 477 | ··[··1d9c]··confname.h |
| 478 | ··[··1d | 478 | ··[··1da7]··ncbitree.h |
| 479 | ··[··1d | 479 | ··[··1db2]··unistd-decl.h |
| 480 | ··[··1d | 480 | ··[··1dc0]··phyloanalysis.h |
| Max diff block lines reached; 0/30948 bytes (0.00%) of diff not shown. | |||
| Offset 1, 8 lines modified | Offset 1, 8 lines modified | ||
| 1 | Hex·dump·of·section·'.gnu_debugaltlink': | 1 | Hex·dump·of·section·'.gnu_debugaltlink': |
| 2 | ··0x00000000·2f757372·2f6c6962·2f646562·75672f2e·/usr/lib/debug/. | 2 | ··0x00000000·2f757372·2f6c6962·2f646562·75672f2e·/usr/lib/debug/. |
| 3 | ··0x00000010·64777a2f·69333836·2d6c696e·75782d67·dwz/i386-linux-g | 3 | ··0x00000010·64777a2f·69333836·2d6c696e·75782d67·dwz/i386-linux-g |
| 4 | ··0x00000020·6e752f69·71747265·652e6465·62756700·nu/iqtree.debug. | 4 | ··0x00000020·6e752f69·71747265·652e6465·62756700·nu/iqtree.debug. |
| 5 | ··0x00000030· | 5 | ··0x00000030·6b572d48·6c5a52d6·d5a227cc·ab12a58e·kW-HlZR...'..... |
| 6 | ··0x00000040· | 6 | ··0x00000040·b8e8e5e8····························.... |
| Offset 1743, 28616 lines modified | Offset 1743, 28561 lines modified | ||
| 1743 | ··0x00006cc0·5a4e5374·385f5262·5f747265·65496953·ZNSt8_Rb_treeIiS | 1743 | ··0x00006cc0·5a4e5374·385f5262·5f747265·65496953·ZNSt8_Rb_treeIiS |
| 1744 | ··0x00006cd0·74347061·6972494b·6953305f·4950344e·t4pairIKiS0_IP4N | 1744 | ··0x00006cd0·74347061·6972494b·6953305f·4950344e·t4pairIKiS0_IP4N |
| 1745 | ··0x00006ce0·6f646553·335f4545·53743130·5f53656c·odeS3_EESt10_Sel | 1745 | ··0x00006ce0·6f646553·335f4545·53743130·5f53656c·odeS3_EESt10_Sel |
| 1746 | ··0x00006cf0·65637431·73744953·355f4553·74346c65·ect1stIS5_ESt4le | 1746 | ··0x00006cf0·65637431·73744953·355f4553·74346c65·ect1stIS5_ESt4le |
| 1747 | ··0x00006d00·73734969·45536149·53355f45·45385f4d·ssIiESaIS5_EE8_M | 1747 | ··0x00006d00·73734969·45536149·53355f45·45385f4d·ssIiESaIS5_EE8_M |
| 1748 | ··0x00006d10·5f657261·73654550·53743133·5f52625f·_eraseEPSt13_Rb_ | 1748 | ··0x00006d10·5f657261·73654550·53743133·5f52625f·_eraseEPSt13_Rb_ |
| 1749 | ··0x00006d20·74726565·5f6e6f64·65495335·5f452e69·tree_nodeIS5_E.i | 1749 | ··0x00006d20·74726565·5f6e6f64·65495335·5f452e69·tree_nodeIS5_E.i |
| 1750 | ··0x00006d30·7372612e·30005f5a·4e537438·5f52625f·sra.0._ZNSt8_Rb_ | ||
| 1751 | ··0x00006d40·74726565·494e5374·375f5f63·78783131·treeINSt7__cxx11 | ||
| 1752 | ··0x00006d50·31326261·7369635f·73747269·6e674963·12basic_stringIc | ||
| 1753 | ··0x00006d60·53743131·63686172·5f747261·69747349·St11char_traitsI | ||
| 1754 | ··0x00006d70·63455361·49634545·45537434·70616972·cESaIcEEESt4pair | ||
| 1755 | ··0x00006d80·494b5335·5f53355f·45537431·305f5365·IKS5_S5_ESt10_Se | ||
| 1756 | ··0x00006d90·6c656374·31737449·53385f45·5374346c·lect1stIS8_ESt4l | ||
| 1757 | ··0x00006da0·65737349·53355f45·53614953·385f4545·essIS5_ESaIS8_EE | ||
| 1758 | ··0x00006db0·385f4d5f·65726173·65455053·7431335f·8_M_eraseEPSt13_ | ||
| 1759 | ··0x00006dc0·52625f74·7265655f·6e6f6465·4953385f·Rb_tree_nodeIS8_ | ||
| 1760 | ··0x00006d | 1750 | ··0x00006d30·7372612e·30005f5a·4e364951·54726565·sra.0._ZN6IQTree |
| 1761 | ··0x00006d | 1751 | ··0x00006d40·31357072·696e7452·6573756c·74547265·15printResultTre |
| 1762 | ··0x00006d | 1752 | ··0x00006d50·65454e53·74375f5f·63787831·31313262·eENSt7__cxx1112b |
| 1763 | ··0x00006e00·31326261·7369635f·73747269·6e674963·12basic_stringIc | ||
| 1764 | ··0x00006e10·53743131·63686172·5f747261·69747349·St11char_traitsI | ||
| 1765 | ··0x00006e20·63455361·49634545·452e636f·6c64005f·cESaIcEEE.cold._ | ||
| 1766 | ··0x00006e30·5a4e3649·51547265·65313569·6e697469·ZN6IQTree15initi | ||
| 1767 | ··0x00006e40·616c697a·654d6f64·656c4552·36506172·alizeModelER6Par | ||
| 1768 | ··0x00006e50·616d734e·5374375f·5f637878·31313132·amsNSt7__cxx1112 | ||
| 1769 | ··0x00006 | 1753 | ··0x00006d60·61736963·5f737472·696e6749·63537431·asic_stringIcSt1 |
| 1770 | ··0x00006 | 1754 | ··0x00006d70·31636861·725f7472·61697473·49634553·1char_traitsIcES |
| 1755 | ··0x00006d80·61496345·45452e63·6f6c6400·5f5a4e36·aIcEEE.cold._ZN6 | ||
| 1771 | ··0x00006e80·53614963·45454550·31314d6f·64656c73·SaIcEEEP11Models | ||
| 1772 | ··0x00006e90·426c6f63·6b2e636f·6c64005f·5a4e3649·Block.cold._ZN6I | ||
| 1773 | ··0x00006ea0·51547265·6534696e·69744576·2e636f6c·QTree4initEv.col | ||
| 1774 | ··0x00006eb0·64005f5a·4e364951·54726565·32316765·d._ZN6IQTree21ge | ||
| 1775 | ··0x00006ec0·6e657261·74655061·7273696d·6f6e7954·nerateParsimonyT | ||
| 1776 | ··0x00006ed0·72656542·35637878·31314569·2e636f6c·reeB5cxx11Ei.col | ||
| 1777 | ··0x00006ee0·64005f5a·4e364951·54726565·3135696e·d._ZN6IQTree15in | ||
| 1778 | ··0x00006ef0·63726561·73654b44·656c6574·6545762e·creaseKDeleteEv. | ||
| 1779 | ··0x00006f00·636f6c64·005f5a4e·36495154·72656531·cold._ZN6IQTree1 | ||
| 1780 | ··0x00006f10·30726169·7365426f·6e757345·50384e65·0raiseBonusEP8Ne | ||
| 1781 | ··0x00006f20·69676862·6f725034·4e6f6465·642e636f·ighborP4Noded.co | ||
| 1782 | ··0x00006f30·6c64005f·5a4e3649·51547265·65323067·ld._ZN6IQTree20g | ||
| 1783 | ··0x00006f40·65744d6f·64656c52·61746573·46726f6d·etModelRatesFrom | ||
| 1784 | ··0x00006f50·504c4c45·762e636f·6c64005f·5a4e3649·PLLEv.cold._ZN6I | ||
| 1785 | ··0x00006f60·51547265·65313970·6c6c5072·696e744d·QTree19pllPrintM | ||
| 1786 | ··0x00006f70·6f64656c·50617261·6d734576·2e636f6c·odelParamsEv.col | ||
| 1787 | ··0x00006f80·64005f5a·4e364951·54726565·3236706c·d._ZN6IQTree26pl | ||
| 1788 | ··0x00006f90·6c427569·6c644951·54726565·50617474·lBuildIQTreePatt | ||
| 1789 | ··0x00006fa0·65726e49·6e646578·45762e63·6f6c6400·ernIndexEv.cold. | ||
| 1790 | ··0x00006fb0·5f5a4e36·49515472·65653770·65727475·_ZN6IQTree7pertu | ||
| 1791 | ··0x00006fc0·72624569·2e636f6c·64005f5a·4e364951·rbEi.cold._ZN6IQ | ||
| 1792 | ··0x00006fd0·54726565·32336f70·74696d69·7a654d6f·Tree23optimizeMo | ||
| 1793 | ··0x00006fe0·64656c50·6172616d·65746572·73423563·delParametersB5c | ||
| 1794 | ··0x00006ff0·78783131·4562642e·636f6c64·005f5a4e·xx11Ebd.cold._ZN | ||
| 1795 | ··0x00007000·36495154·72656531·35707269·6e744265·6IQTree15printBe | ||
| 1796 | ··0x00007010·73745363·6f726573·45762e63·6f6c6400·stScoresEv.cold. | ||
| 1797 | ··0x00007020·5f5a4e36·49515472·65653136·6f707469·_ZN6IQTree16opti | ||
| 1798 | ··0x00007030·6d697a65·4272616e·63686573·42356378·mizeBranchesB5cx | ||
| 1799 | ··0x00007040·78313145·692e636f·6c64005f·5a4e3649·x11Ei.cold._ZN6I | ||
| 1800 | ··0x00007050·51547265·65313870·72696e74·49746572·QTree18printIter | ||
| 1801 | ··0x00007060·6174696f·6e496e66·6f45692e·636f6c64·ationInfoEi.cold | ||
| 1802 | ··0x00007070·005f5a4e·36495154·72656532·31616464·._ZN6IQTree21add | ||
| 1803 | ··0x00007080·54726565·546f4361·6e646964·61746553·TreeToCandidateS | ||
| 1804 | ··0x00007090·6574454e·5374375f·5f637878·31313132·etENSt7__cxx1112 | ||
| 1805 | ··0x000070a0·62617369·635f7374·72696e67·49635374·basic_stringIcSt | ||
| 1806 | ··0x000070b0·31316368·61725f74·72616974·73496345·11char_traitsIcE | ||
| 1807 | ··0x000070c0·53614963·45454564·62692e63·6f6c6400·SaIcEEEdbi.cold. | ||
| 1808 | ··0x000070d0·5f5a4e36·49515472·65653132·73617665·_ZN6IQTree12save | ||
| 1809 | ··0x000070e0·4e4e4954·72656573·45503950·68796c6f·NNITreesEP9Phylo | ||
| 1810 | ··0x000070f0·4e6f6465·53315f2e·636f6c64·005f5a4e·NodeS1_.cold._ZN | ||
| 1811 | ··0x00007100·36495154·72656531·37707269·6e745068·6IQTree17printPh | ||
| 1812 | ··0x00007110·796c6f6c·69625472·65654550·4b632e63·ylolibTreeEPKc.c | ||
| 1813 | ··0x00007120·6f6c6400·5f5a4e36·49515472·65653137·old._ZN6IQTree17 | ||
| 1814 | ··0x00007130·636f6e76·6572744e·4e493253·706c6974·convertNNI2Split | ||
| 1815 | ··0x00007140·73455231·3153706c·6974496e·744d6170·sER11SplitIntMap | ||
| 1816 | ··0x00007150·69525374·36766563·746f7249·374e4e49·iRSt6vectorI7NNI | ||
| 1817 | ··0x00007160·4d6f7665·53614953·335f4545·2e636f6c·MoveSaIS3_EE.col | ||
| 1818 | ··0x00007170·64005f5a·4e364951·54726565·3230696e·d._ZN6IQTree20in | ||
| 1819 | ··0x00007180·7075744d·6f64656c·49515472·65653250·putModelIQTree2P | ||
| 1820 | ··0x00007190·4c4c4576·2e636f6c·64005f5a·4e364951·LLEv.cold._ZN6IQ | ||
| 1821 | ··0x000071a0·54726565·31386372·65617465·504c4c50·Tree18createPLLP | ||
| 1822 | ··0x000071b0·61727469·74696f6e·45523650·6172616d·artitionER6Param | ||
| 1823 | ··0x000071c0·7352536f·2e636f6c·64005f5a·4e364951·sRSo.cold._ZN6IQ | ||
| 1824 | ··0x0000 | 1756 | ··0x00006d90·49515472·65653135·696e6974·69616c69·IQTree15initiali |
| 1757 | ··0x00006da0·7a654d6f·64656c45·52365061·72616d73·zeModelER6Params | ||
| 1758 | ··0x00006db0·4e537437·5f5f6378·78313131·32626173·NSt7__cxx1112bas | ||
| 1759 | ··0x00006dc0·69635f73·7472696e·67496353·74313163·ic_stringIcSt11c | ||
| 1760 | ··0x00006dd0·6861725f·74726169·74734963·45536149·har_traitsIcESaI | ||
| 1761 | ··0x00006de0·63454545·5031314d·6f64656c·73426c6f·cEEEP11ModelsBlo | ||
| 1825 | ··0x000071e0·504c4c45·52365061·72616d73·2e636f6c·PLLER6Params.col | ||
| 1826 | ··0x000071f0·64005f5a·4e364951·54726565·32327072·d._ZN6IQTree22pr | ||
| 1827 | ··0x00007200·696e7442·65737443·616e6469·64617465·intBestCandidate | ||
| 1828 | ··0x00007210·54726565·45762e63·6f6c6400·5f5a4e36·TreeEv.cold._ZN6 | ||
| 1829 | ··0x00007220·49515472·65653137·65737469·6d617465·IQTree17estimate | ||
| 1830 | ··0x00007230·4e4e4943·75746f66·66455036·50617261·NNICutoffEP6Para | ||
| 1831 | ··0x0000 | 1762 | ··0x00006df0·636b2e63·6f6c6400·5f5a4e36·49515472·ck.cold._ZN6IQTr |
| 1832 | ··0x00007250·65653130·73617665·5546426f·6f744550·ee10saveUFBootEP | ||
| 1833 | ··0x0000 | 1763 | ··0x00006e00·65653469·6e697445·762e636f·6c64005f·ee4initEv.cold._ |
| 1764 | ··0x00006e10·5a4e3649·51547265·65323167·656e6572·ZN6IQTree21gener | ||
| 1765 | ··0x00006e20·61746550·61727369·6d6f6e79·54726565·ateParsimonyTree | ||
| 1766 | ··0x00006e30·42356378·78313145·692e636f·6c64005f·B5cxx11Ei.cold._ | ||
| 1767 | ··0x00006e40·5a4e3649·51547265·65313569·6e637265·ZN6IQTree15incre | ||
| 1768 | ··0x00006e50·6173654b·44656c65·74654576·2e636f6c·aseKDeleteEv.col | ||
| 1834 | ··0x0000 | 1769 | ··0x00006e60·64005f5a·4e364951·54726565·31307261·d._ZN6IQTree10ra |
| 1770 | ··0x00006e70·69736542·6f6e7573·4550384e·65696768·iseBonusEP8Neigh | ||
| 1771 | ··0x00006e80·626f7250·344e6f64·65642e63·6f6c6400·borP4Noded.cold. | ||
| 1835 | ··0x00007280·76654375·7272656e·74547265·6545642e·veCurrentTreeEd. | ||
| 1836 | ··0x00007290·636f6c64·005f5a31·38636f6d·70757465·cold._Z18compute | ||
| 1837 | ··0x000072a0·436f7272·656c6174·696f6e52·53743676·CorrelationRSt6v | ||
| 1838 | ··0x000072b0·6563746f·72496953·61496945·4553325f·ectorIiSaIiEES2_ | ||
| 1839 | ··0x000072c0·2e636f6c·64005f5a·4e364951·54726565·.cold._ZN6IQTree | ||
| 1840 | ··0x000072d0·3138636f·6d707574·65496e69·7469616c·18computeInitial | ||
| 1841 | ··0x000072e0·54726565·4531364c·696b656c·69686f6f·TreeE16Likelihoo | ||
| 1842 | ··0x000072f0·644b6572·6e656c2e·636f6c64·005f5a4e·dKernel.cold._ZN | ||
| 1843 | ··0x00007300·31304368·65636b70·6f696e74·33676574·10Checkpoint3get | ||
| 1844 | ··0x00007310·49644545·624e5374·375f5f63·78783131·IdEEbNSt7__cxx11 | ||
| 1845 | ··0x00007320·31326261·7369635f·73747269·6e674963·12basic_stringIc | ||
| 1846 | ··0x00007330·53743131·63686172·5f747261·69747349·St11char_traitsI | ||
| 1847 | ··0x00007340·63455361·49634545·4552545f·2e697372·cESaIcEEERT_.isr | ||
| 1848 | ··0x00007350·612e3000·5f5a4e31·30436865·636b706f·a.0._ZN10Checkpo | ||
| 1849 | ··0x00007360·696e7433·67657449·64454562·4e537437·int3getIdEEbNSt7 | ||
| 1850 | ··0x00007370·5f5f6378·78313131·32626173·69635f73·__cxx1112basic_s | ||
| 1851 | ··0x00007380·7472696e·67496353·74313163·6861725f·tringIcSt11char_ | ||
| 1852 | ··0x00007390·74726169·74734963·45536149·63454545·traitsIcESaIcEEE | ||
| 1853 | ··0x000073a0·52545f2e·69737261·2e302e63·6f6c6400·RT_.isra.0.cold. | ||
| 1854 | ··0x0000 | 1772 | ··0x00006e90·5f5a4e36·49515472·65653230·6765744d·_ZN6IQTree20getM |
| 1773 | ··0x00006ea0·6f64656c·52617465·7346726f·6d504c4c·odelRatesFromPLL | ||
| 1855 | ··0x000073c0·53746f70·4d657373·61676545·762e636f·StopMessageEv.co | ||
| Max diff block lines reached; 3790120/3828876 bytes (98.99%) of diff not shown. | |||
| Offset 17, 13 lines modified | Offset 17, 13 lines modified | ||
| 17 | ··0x000000e0·72726179·002e6669·6e695f61·72726179·rray..fini_array | 17 | ··0x000000e0·72726179·002e6669·6e695f61·72726179·rray..fini_array |
| 18 | ··0x000000f0·002e6461·74612e72·656c2e72·6f002e64·..data.rel.ro..d | 18 | ··0x000000f0·002e6461·74612e72·656c2e72·6f002e64·..data.rel.ro..d |
| 19 | ··0x00000100·796e616d·6963002e·64617461·002e6273·ynamic..data..bs | 19 | ··0x00000100·796e616d·6963002e·64617461·002e6273·ynamic..data..bs |
| 20 | ··0x00000110·73002e63·6f6d6d65·6e74002e·64656275·s..comment..debu | 20 | ··0x00000110·73002e63·6f6d6d65·6e74002e·64656275·s..comment..debu |
| 21 | ··0x00000120·675f6172·616e6765·73002e64·65627567·g_aranges..debug | 21 | ··0x00000120·675f6172·616e6765·73002e64·65627567·g_aranges..debug |
| 22 | ··0x00000130·5f696e66·6f002e64·65627567·5f616262·_info..debug_abb | 22 | ··0x00000130·5f696e66·6f002e64·65627567·5f616262·_info..debug_abb |
| 23 | ··0x00000140·72657600·2e646562·75675f6c·696e6500·rev..debug_line. | 23 | ··0x00000140·72657600·2e646562·75675f6c·696e6500·rev..debug_line. |
| 24 | ··0x00000150·2e646562·75675f73·7472002e·64656275·.debug_str..debu | ||
| 25 | ··0x00000160·675f6c69·6e655f73·7472002e·64656275·g_line_str..debu | ||
| 26 | ··0x00000170·675f6c6f·636c6973·7473002e·64656275·g_loclists..debu | ||
| 27 | ··0x00000180·675f726e·676c6973·7473002e·676e755f·g_rnglists..gnu_ | ||
| 28 | ··0x000001 | 24 | ··0x00000150·2e646562·75675f6c·696e655f·73747200·.debug_line_str. |
| 25 | ··0x00000160·2e646562·75675f6c·6f636c69·73747300·.debug_loclists. | ||
| 26 | ··0x00000170·2e646562·75675f72·6e676c69·73747300·.debug_rnglists. | ||
| 27 | ··0x00000180·2e676e75·5f646562·7567616c·746c696e·.gnu_debugaltlin | ||
| 28 | ··0x00000190·6b00································k. | ||
| Offset 4, 17 lines modified | Offset 4, 17 lines modified | ||
| 4 | ··Data:······························2's·complement,·little·endian | 4 | ··Data:······························2's·complement,·little·endian |
| 5 | ··Version:···························1·(current) | 5 | ··Version:···························1·(current) |
| 6 | ··OS/ABI:····························UNIX·-·GNU | 6 | ··OS/ABI:····························UNIX·-·GNU |
| 7 | ··ABI·Version:·······················0 | 7 | ··ABI·Version:·······················0 |
| 8 | ··Type:······························DYN·(Shared·object·file) | 8 | ··Type:······························DYN·(Shared·object·file) |
| 9 | ··Machine:···························Intel·80386 | 9 | ··Machine:···························Intel·80386 |
| 10 | ··Version:···························0x1 | 10 | ··Version:···························0x1 |
| 11 | ··Entry·point·address:···············0xe7 | 11 | ··Entry·point·address:···············0xe7e30 |
| 12 | ··Start·of·program·headers:··········52·(bytes·into·file) | 12 | ··Start·of·program·headers:··········52·(bytes·into·file) |
| 13 | ··Start·of·section·headers:··········230 | 13 | ··Start·of·section·headers:··········23033576·(bytes·into·file) |
| 14 | ··Flags:·····························0x0 | 14 | ··Flags:·····························0x0 |
| 15 | ··Size·of·this·header:···············52·(bytes) | 15 | ··Size·of·this·header:···············52·(bytes) |
| 16 | ··Size·of·program·headers:···········32·(bytes) | 16 | ··Size·of·program·headers:···········32·(bytes) |
| 17 | ··Number·of·program·headers:·········12 | 17 | ··Number·of·program·headers:·········12 |
| 18 | ··Size·of·section·headers:···········40·(bytes) | 18 | ··Size·of·section·headers:···········40·(bytes) |
| 19 | ··Number·of·section·headers:·········39 | 19 | ··Number·of·section·headers:·········39 |
| 20 | ··Section·header·string·table·index:·38 | 20 | ··Section·header·string·table·index:·38 |
| Offset 1, 26 lines modified | Offset 1, 26 lines modified | ||
| 1 | Elf·file·type·is·DYN·(Shared·object·file) | 1 | Elf·file·type·is·DYN·(Shared·object·file) |
| 2 | Entry·point·0xe7 | 2 | Entry·point·0xe7e30 |
| 3 | There·are·12·program·headers,·starting·at·offset·52 | 3 | There·are·12·program·headers,·starting·at·offset·52 |
| 4 | Program·Headers: | 4 | Program·Headers: |
| 5 | ··Type···········Offset···VirtAddr···PhysAddr···FileSiz·MemSiz··Flg·Align | 5 | ··Type···········Offset···VirtAddr···PhysAddr···FileSiz·MemSiz··Flg·Align |
| 6 | ··PHDR···········0x000034·0x00000034·0x00000034·0x00180·0x00180·R···0x4 | 6 | ··PHDR···········0x000034·0x00000034·0x00000034·0x00180·0x00180·R···0x4 |
| 7 | ··INTERP·········0x0001d8·0x000001d8·0x000001d8·0x00000·0x00013·R···0x1 | 7 | ··INTERP·········0x0001d8·0x000001d8·0x000001d8·0x00000·0x00013·R···0x1 |
| 8 | ··LOAD···········0x000000·0x00000000·0x00000000·0x001d8·0x7fba8·R···0x1000 | 8 | ··LOAD···········0x000000·0x00000000·0x00000000·0x001d8·0x7fba8·R···0x1000 |
| 9 | ··LOAD···········0x000000·0x00080000·0x00080000·0x00000·0x49 | 9 | ··LOAD···········0x000000·0x00080000·0x00080000·0x00000·0x492e68·R·E·0x1000 |
| 10 | ··LOAD···········0x001000·0x0051 | 10 | ··LOAD···········0x001000·0x00513000·0x00513000·0x17fecc·0x17fecc·R···0x1000 |
| 11 | ··LOAD···········0x00016c·0x0069 | 11 | ··LOAD···········0x00016c·0x0069316c·0x0069316c·0x00000·0x24614·RW··0x1000 |
| 12 | ··DYNAMIC········0x18116c·0x0069 | 12 | ··DYNAMIC········0x18116c·0x0069a93c·0x0069a93c·0x00000·0x00128·RW··0x4 |
| 13 | ··NOTE···········0x0001b4·0x000001b4·0x000001b4·0x00024·0x00024·R···0x4 | 13 | ··NOTE···········0x0001b4·0x000001b4·0x000001b4·0x00024·0x00024·R···0x4 |
| 14 | ··NOTE···········0x180 | 14 | ··NOTE···········0x180eac·0x00692eac·0x00692eac·0x00020·0x00020·R···0x4 |
| 15 | ··GNU_EH_FRAME···0x001000·0x005d | 15 | ··GNU_EH_FRAME···0x001000·0x005d72f8·0x005d72f8·0x00000·0x0de0c·R···0x4 |
| 16 | ··GNU_STACK······0x000000·0x00000000·0x00000000·0x00000·0x00000·RW··0x10 | 16 | ··GNU_STACK······0x000000·0x00000000·0x00000000·0x00000·0x00000·RW··0x10 |
| 17 | ··GNU_RELRO······0x18116c·0x0069 | 17 | ··GNU_RELRO······0x18116c·0x0069316c·0x0069316c·0x00000·0x07e94·R···0x1 |
| 18 | ·Section·to·Segment·mapping: | 18 | ·Section·to·Segment·mapping: |
| 19 | ··Segment·Sections... | 19 | ··Segment·Sections... |
| 20 | ···00····· | 20 | ···00····· |
| 21 | ···01·····.interp· | 21 | ···01·····.interp· |
| 22 | ···02·····.note.gnu.build-id·.interp·.gnu.hash·.dynsym·.dynstr·.gnu.version·.gnu.version_r·.rel.dyn·.rel.plt· | 22 | ···02·····.note.gnu.build-id·.interp·.gnu.hash·.dynsym·.dynstr·.gnu.version·.gnu.version_r·.rel.dyn·.rel.plt· |
| 23 | ···03·····.init·.plt·.plt.got·.text·.fini· | 23 | ···03·····.init·.plt·.plt.got·.text·.fini· |
| Offset 1, 8 lines modified | Offset 1, 8 lines modified | ||
| 1 | There·are·39·section·headers,·starting·at·offset·0x15f | 1 | There·are·39·section·headers,·starting·at·offset·0x15f76e8: |
| 2 | Section·Headers: | 2 | Section·Headers: |
| 3 | ··[Nr]·Name··············Type············Addr·····Off····Size···ES·Flg·Lk·Inf·Al | 3 | ··[Nr]·Name··············Type············Addr·····Off····Size···ES·Flg·Lk·Inf·Al |
| 4 | ··[·0]···················NULL············00000000·000000·000000·00······0···0··0 | 4 | ··[·0]···················NULL············00000000·000000·000000·00······0···0··0 |
| 5 | ··[·1]·.note.gnu.build-id·NOTE············000001b4·0001b4·000024·00···A··0···0··4 | 5 | ··[·1]·.note.gnu.build-id·NOTE············000001b4·0001b4·000024·00···A··0···0··4 |
| 6 | ··[·2]·.interp···········NOBITS··········000001d8·0001d8·000013·00···A··0···0··1 | 6 | ··[·2]·.interp···········NOBITS··········000001d8·0001d8·000013·00···A··0···0··1 |
| 7 | ··[·3]·.gnu.hash·········NOBITS··········000001ec·0001d8·00abb8·04···A··4···0··4 | 7 | ··[·3]·.gnu.hash·········NOBITS··········000001ec·0001d8·00abb8·04···A··4···0··4 |
| Offset 11, 38 lines modified | Offset 11, 38 lines modified | ||
| 11 | ··[·6]·.gnu.version······NOBITS··········0006fec2·0001d8·0030a4·02···A··4···0··2 | 11 | ··[·6]·.gnu.version······NOBITS··········0006fec2·0001d8·0030a4·02···A··4···0··2 |
| 12 | ··[·7]·.gnu.version_r····NOBITS··········00072f68·0001d8·0002e0·00···A··5···5··4 | 12 | ··[·7]·.gnu.version_r····NOBITS··········00072f68·0001d8·0002e0·00···A··5···5··4 |
| 13 | ··[·8]·.rel.dyn··········NOBITS··········00073248·0001d8·00c048·08···A··4···0··4 | 13 | ··[·8]·.rel.dyn··········NOBITS··········00073248·0001d8·00c048·08···A··4···0··4 |
| 14 | ··[·9]·.rel.plt··········NOBITS··········0007f290·0001d8·000918·08···A··4··24··4 | 14 | ··[·9]·.rel.plt··········NOBITS··········0007f290·0001d8·000918·08···A··4··24··4 |
| 15 | ··[10]·.init·············NOBITS··········00080000·001000·000020·00··AX··0···0··4 | 15 | ··[10]·.init·············NOBITS··········00080000·001000·000020·00··AX··0···0··4 |
| 16 | ··[11]·.plt··············NOBITS··········00080020·001000·001240·04··AX··0···0·16 | 16 | ··[11]·.plt··············NOBITS··········00080020·001000·001240·04··AX··0···0·16 |
| 17 | ··[12]·.plt.got··········NOBITS··········00081260·001000·000018·08··AX··0···0··8 | 17 | ··[12]·.plt.got··········NOBITS··········00081260·001000·000018·08··AX··0···0··8 |
| 18 | ··[13]·.text·············NOBITS··········00081280·001000·49 | 18 | ··[13]·.text·············NOBITS··········00081280·001000·491bd4·00··AX··0···0·64 |
| 19 | ··[14]·.fini·············NOBITS··········0051 | 19 | ··[14]·.fini·············NOBITS··········00512e54·001000·000014·00··AX··0···0··4 |
| 20 | ··[15]·.rodata···········NOBITS··········0051 | 20 | ··[15]·.rodata···········NOBITS··········00513000·001000·0c42f8·00···A··0···0·32 |
| 21 | ··[16]·.eh_frame_hdr·····NOBITS··········005d | 21 | ··[16]·.eh_frame_hdr·····NOBITS··········005d72f8·001000·00de0c·00···A··0···0··4 |
| 22 | ··[17]·.eh_frame·········NOBITS··········005e | 22 | ··[17]·.eh_frame·········NOBITS··········005e5104·001000·08f8b0·00···A··0···0··4 |
| 23 | ··[18]·.gcc_except_table·NOBITS··········0067 | 23 | ··[18]·.gcc_except_table·NOBITS··········006749b4·001000·01e4f5·00···A··0···0··4 |
| 24 | ··[19]·.note.ABI-tag·····NOTE············0069 | 24 | ··[19]·.note.ABI-tag·····NOTE············00692eac·180eac·000020·00···A··0···0··4 |
| 25 | ··[20]·.init_array·······NOBITS··········0069 | 25 | ··[20]·.init_array·······NOBITS··········0069316c·18116c·000030·04··WA··0···0··4 |
| 26 | ··[21]·.fini_array·······NOBITS··········0069 | 26 | ··[21]·.fini_array·······NOBITS··········0069319c·18116c·000004·04··WA··0···0··4 |
| 27 | ··[22]·.data.rel.ro······NOBITS··········0069 | 27 | ··[22]·.data.rel.ro······NOBITS··········006931a0·18116c·00779c·00··WA··0···0·32 |
| 28 | ··[23]·.dynamic··········NOBITS··········0069 | 28 | ··[23]·.dynamic··········NOBITS··········0069a93c·18116c·000128·08··WA··5···0··4 |
| 29 | ··[24]·.got··············NOBITS··········0069 | 29 | ··[24]·.got··············NOBITS··········0069aa64·18116c·000580·04··WA··0···0··4 |
| 30 | ··[25]·.data·············NOBITS··········0069 | 30 | ··[25]·.data·············NOBITS··········0069b000·18116c·01049c·00··WA··0···0·32 |
| 31 | ··[26]·.bss··············NOBITS··········006a | 31 | ··[26]·.bss··············NOBITS··········006ab4a0·18116c·00c2e0·00··WA··0···0·32 |
| 32 | ··[27]·.comment··········PROGBITS········00000000·180 | 32 | ··[27]·.comment··········PROGBITS········00000000·180ecc·00001e·01··MS··0···0··1 |
| 33 | ··[28]·.debug_aranges····PROGBITS········00000000·180e | 33 | ··[28]·.debug_aranges····PROGBITS········00000000·180eec·002fdf·00···C··0···0··4 |
| 34 | ··[29]·.debug_info·······PROGBITS········00000000·183 | 34 | ··[29]·.debug_info·······PROGBITS········00000000·183ecc·c47943·00···C··0···0··4 |
| 35 | ··[30]·.debug_abbrev·····PROGBITS········00000000·dcb | 35 | ··[30]·.debug_abbrev·····PROGBITS········00000000·dcb810·021ada·00···C··0···0··4 |
| 36 | ··[31]·.debug_line·······PROGBITS········00000000·ded | 36 | ··[31]·.debug_line·······PROGBITS········00000000·ded2ec·226651·00···C··0···0··4 |
| 37 | ··[32]·.debug_line_str···PROGBITS········00000000·101 | 37 | ··[32]·.debug_line_str···PROGBITS········00000000·1013940·0012b6·01·MSC··0···0··4 |
| 38 | ··[33]·.debug_loclists···PROGBITS········00000000·101 | 38 | ··[33]·.debug_loclists···PROGBITS········00000000·1014bf8·447877·00···C··0···0··4 |
| 39 | ··[34]·.debug_rnglists···PROGBITS········00000000·145 | 39 | ··[34]·.debug_rnglists···PROGBITS········00000000·145c470·0fe9ee·00···C··0···0··4 |
| 40 | ··[35]·.gnu_debugaltlink·PROGBITS········00000000·155 | 40 | ··[35]·.gnu_debugaltlink·PROGBITS········00000000·155ae5e·000044·00······0···0··1 |
| 41 | ··[36]·.symtab···········SYMTAB··········00000000·155 | 41 | ··[36]·.symtab···········SYMTAB··········00000000·155aea4·0260f0·10·····37·3518··4 |
| 42 | ··[37]·.strtab···········STRTAB··········00000000·158 | 42 | ··[37]·.strtab···········STRTAB··········00000000·1580f94·0765c0·00······0···0··1 |
| 43 | ··[38]·.shstrtab·········STRTAB··········00000000·15f | 43 | ··[38]·.shstrtab·········STRTAB··········00000000·15f7554·000192·00······0···0··1 |
| 44 | Key·to·Flags: | 44 | Key·to·Flags: |
| 45 | ··W·(write),·A·(alloc),·X·(execute),·M·(merge),·S·(strings),·I·(info), | 45 | ··W·(write),·A·(alloc),·X·(execute),·M·(merge),·S·(strings),·I·(info), |
| 46 | ··L·(link·order),·O·(extra·OS·processing·required),·G·(group),·T·(TLS), | 46 | ··L·(link·order),·O·(extra·OS·processing·required),·G·(group),·T·(TLS), |
| 47 | ··C·(compressed),·x·(unknown),·o·(OS·specific),·E·(exclude), | 47 | ··C·(compressed),·x·(unknown),·o·(OS·specific),·E·(exclude), |
| 48 | ··R·(retain),·D·(mbind),·p·(processor·specific) | 48 | ··R·(retain),·D·(mbind),·p·(processor·specific) |
| Offset 1, 52 lines modified | Offset 1, 52 lines modified | ||
| 1 | Symbol·table·'.symtab'·contains·9743·entries: | 1 | Symbol·table·'.symtab'·contains·9743·entries: |
| 2 | ···Num:····Value··Size·Type····Bind···Vis······Ndx·Name | 2 | ···Num:····Value··Size·Type····Bind···Vis······Ndx·Name |
| 3 | ·····0:·00000000·····0·NOTYPE··LOCAL··DEFAULT··UND· | 3 | ·····0:·00000000·····0·NOTYPE··LOCAL··DEFAULT··UND· |
| 4 | ·····1:·00000000·····0·FILE····LOCAL··DEFAULT··ABS·Scrt1.o | 4 | ·····1:·00000000·····0·FILE····LOCAL··DEFAULT··ABS·Scrt1.o |
| 5 | ·····2:·0069 | 5 | ·····2:·00692eac····32·OBJECT··LOCAL··DEFAULT···19·__abi_tag |
| 6 | ·····3:·00000000·····0·FILE····LOCAL··DEFAULT··ABS·parsmultistate.cpp | 6 | ·····3:·00000000·····0·FILE····LOCAL··DEFAULT··ABS·parsmultistate.cpp |
| 7 | ·····4:·00081280···182·FUNC····LOCAL··DEFAULT···13·_Z16doParsMultiStateR6Params.cold | 7 | ·····4:·00081280···182·FUNC····LOCAL··DEFAULT···13·_Z16doParsMultiStateR6Params.cold |
| 8 | ·····5:·00000000·····0·FILE····LOCAL··DEFAULT··ABS·alignment.cpp | 8 | ·····5:·00000000·····0·FILE····LOCAL··DEFAULT··ABS·alignment.cpp |
| 9 | ·····6:·000e84 | 9 | ·····6:·000e84a0···423·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment12convertStateEcN3PML7SeqTypeE.part.0 |
| 10 | ·····7:·000e86 | 10 | ·····7:·000e8690····46·FUNC····LOCAL··DEFAULT···13·_ZN5Eigen15PlainObjectBaseINS_6MatrixIdLin1ELin1ELi0ELin1ELin1EEEE6resizeEii.part.0 |
| 11 | ·····8:·000e86 | 11 | ·····8:·000e86c0····46·FUNC····LOCAL··DEFAULT···13·_ZN5Eigen15PlainObjectBaseINS_6MatrixIiLin1ELi1ELi0ELin1ELi1EEEE6resizeEi.part.0 |
| 12 | ·····9:·000e86 | 12 | ·····9:·000e86f0····46·FUNC····LOCAL··DEFAULT···13·_ZN5Eigen8internal17resize_if_allowedINS_6MatrixIdLin1ELin1ELi0ELin1ELin1EEENS_14CwiseNullaryOpINS0_18scalar_constant_opIdEES3_EEddEEvRT_RKT0_RKNS0_9assign_opIT1_T2_EE.part.0 |
| 13 | ····10:·000e8 | 13 | ····10:·000e8720····46·FUNC····LOCAL··DEFAULT···13·_ZN5Eigen15PlainObjectBaseINS_6MatrixIdLi1ELin1ELi1ELi1ELin1EEEE6resizeEii.part.0 |
| 14 | ····11:·000e8 | 14 | ····11:·000e8750····46·FUNC····LOCAL··DEFAULT···13·_ZNK5Eigen10SolverBaseINS_9FullPivLUINS_6MatrixIdLin1ELin1ELi0ELin1ELin1EEEEEE22_check_solve_assertionILb0ENS_10MatrixBaseINS_14CwiseNullaryOpINS_8internal18scalar_identity_opIdEES3_EEEEEEvRKT0_.part.0 |
| 15 | ····12:·00120 | 15 | ····12:·00120540···564·FUNC····LOCAL··DEFAULT···13·_ZN5Eigen8internal13gemm_pack_rhsIdiNS0_22const_blas_data_mapperIdiLi0EEELi4ELi0ELb0ELb0EEclEPdRKS3_iiii.isra.0 |
| 16 | ····13:·001207 | 16 | ····13:·00120780··2227·FUNC····LOCAL··DEFAULT···13·_ZN5Eigen8internal29general_matrix_vector_productIidNS0_22const_blas_data_mapperIdiLi0EEELi0ELb0EdNS2_IdiLi1EEELb0ELi0EE3runEiiRKS3_RKS4_Pdid.isra.0 |
| 17 | ····14:·000e87 | 17 | ····14:·000e8780···363·FUNC····LOCAL··DEFAULT···13·_ZN5Eigen8internal13gemm_pack_lhsIdiNS0_22const_blas_data_mapperIdiLi0EEELi2ELi2EDv2_dLi0ELb0ELb0EEclEPdRKS3_iiii.isra.0 |
| 18 | ····15:·000e88 | 18 | ····15:·000e88f0···652·FUNC····LOCAL··DEFAULT···13·_ZN5Eigen8internal13gemm_pack_rhsIdiNS0_16blas_data_mapperIdiLi0ELi0ELi1EEELi4ELi0ELb0ELb1EEclEPdRKS3_iiii.isra.0 |
| 19 | ····16:·000e8b | 19 | ····16:·000e8b80··1482·FUNC····LOCAL··DEFAULT···13·_ZN5boost4math5tools6detail23evaluate_rational_c_impIeyeEET1_PKT_PKT0_RKS4_PKSt17integral_constantIiLi17EE.isra.0 |
| 20 | ····17:·000e9 | 20 | ····17:·000e9150···167·FUNC····LOCAL··DEFAULT···13·_ZNSt7__cxx1112basic_stringIcSt11char_traitsIcESaIcEE12_M_constructIPKcEEvT_S8_St20forward_iterator_tag.isra.0 |
| 21 | ····18:·000e92 | 21 | ····18:·000e92a0··2435·FUNC····LOCAL··DEFAULT···13·_ZN5Eigen8internal22lhs_process_one_packetILi4ELi2ELi1EdddDv2_dS2_S2_S2_NS0_11gebp_traitsIddLb0ELb0ELi1ELi0EEENS0_16BlasLinearMapperIdiLi0ELi1EEENS0_16blas_data_mapperIdiLi0ELi0ELi1EEEEclERKS8_PKdSD_diiiiiiiiiiii.isra.0 |
| 22 | ····19:·000e9 | 22 | ····19:·000e9c30··1092·FUNC····LOCAL··DEFAULT···13·_ZN5Eigen8internal11gebp_kernelIddiNS0_16blas_data_mapperIdiLi0ELi0ELi1EEELi2ELi4ELb0ELb0EEclERKS3_PKdS8_iiidiiii.isra.0 |
| 23 | ····20:·000ea0 | 23 | ····20:·000ea080···257·FUNC····LOCAL··DEFAULT···13·_ZNSt3tr110_HashtableISt6vectorIjSaIjEESt4pairIKS3_iESaIS6_ESt10_Select1stIS6_ESt8equal_toIS3_E11hashPatternNS_8__detail18_Mod_range_hashingENSD_20_Default_ranged_hashENSD_20_Prime_rehash_policyELb0ELb0ELb1EE4findERS5_.isra.0 |
| 24 | ····21:·000ea1 | 24 | ····21:·000ea190···167·FUNC····LOCAL··DEFAULT···13·_ZNSt7__cxx1112basic_stringIcSt11char_traitsIcESaIcEE12_M_constructIPcEEvT_S7_St20forward_iterator_tag.isra.0 |
| 25 | ····22:·000ea | 25 | ····22:·000ea240···389·FUNC····LOCAL··DEFAULT···13·_ZNSt6vectorIiSaIiEEaSERKS1_.isra.0 |
| 26 | ····23:·000ea4 | 26 | ····23:·000ea4a0···176·FUNC····LOCAL··DEFAULT···13·_ZNSt7__cxx1112basic_stringIcSt11char_traitsIcESaIcEEC2EPKcRKS3_.isra.0 |
| 27 | ····24:·0008170a····33·FUNC····LOCAL··DEFAULT···13·_ZNSt7__cxx1112basic_stringIcSt11char_traitsIcESaIcEEC2EPKcRKS3_.isra.0.cold | 27 | ····24:·0008170a····33·FUNC····LOCAL··DEFAULT···13·_ZNSt7__cxx1112basic_stringIcSt11char_traitsIcESaIcEEC2EPKcRKS3_.isra.0.cold |
| 28 | ····25:·000ea | 28 | ····25:·000ea550···704·FUNC····LOCAL··DEFAULT···13·_ZNSt3tr18__detail9_Map_baseIjSt4pairIKjjESt10_Select1stIS4_ELb1ENS_10_HashtableIjS4_SaIS4_ES6_St8equal_toIjENS_4hashIjEENS0_18_Mod_range_hashingENS0_20_Default_ranged_hashENS0_20_Prime_rehash_policyELb0ELb0ELb1EEEEixERS3_.isra.0 |
| 29 | ····26:·0008172c····48·FUNC····LOCAL··DEFAULT···13·_ZNSt3tr18__detail9_Map_baseIjSt4pairIKjjESt10_Select1stIS4_ELb1ENS_10_HashtableIjS4_SaIS4_ES6_St8equal_toIjENS_4hashIjEENS0_18_Mod_range_hashingENS0_20_Default_ranged_hashENS0_20_Prime_rehash_policyELb0ELb0ELb1EEEEixERS3_.isra.0.cold | 29 | ····26:·0008172c····48·FUNC····LOCAL··DEFAULT···13·_ZNSt3tr18__detail9_Map_baseIjSt4pairIKjjESt10_Select1stIS4_ELb1ENS_10_HashtableIjS4_SaIS4_ES6_St8equal_toIjENS_4hashIjEENS0_18_Mod_range_hashingENS0_20_Default_ranged_hashENS0_20_Prime_rehash_policyELb0ELb0ELb1EEEEixERS3_.isra.0.cold |
| 30 | ····27:·0008175c···192·FUNC····LOCAL··DEFAULT···13·_ZStplIcSt11char_traitsIcESaIcEENSt7__cxx1112basic_stringIT_T0_T1_EEPKS5_RKS8_.isra.0 | 30 | ····27:·0008175c···192·FUNC····LOCAL··DEFAULT···13·_ZStplIcSt11char_traitsIcESaIcEENSt7__cxx1112basic_stringIT_T0_T1_EEPKS5_RKS8_.isra.0 |
| 31 | ····28:·000ea | 31 | ····28:·000ea810···329·FUNC····LOCAL··DEFAULT···13·_ZNSt8_Rb_treeINSt7__cxx1112basic_stringIcSt11char_traitsIcESaIcEEESt4pairIKS5_iESt10_Select1stIS8_ESt4lessIS5_ESaIS8_EE24_M_get_insert_unique_posERS7_.isra.0 |
| 32 | ····29:·0008181c···130·FUNC····LOCAL··DEFAULT···13·_ZStplIcSt11char_traitsIcESaIcEENSt7__cxx1112basic_stringIT_T0_T1_EEOS8_RKS8_.isra.0 | 32 | ····29:·0008181c···130·FUNC····LOCAL··DEFAULT···13·_ZStplIcSt11char_traitsIcESaIcEENSt7__cxx1112basic_stringIT_T0_T1_EEOS8_RKS8_.isra.0 |
| 33 | ····30:·000ea | 33 | ····30:·000ea960···620·FUNC····LOCAL··DEFAULT···13·_ZNSt6vectorINSt7__cxx1112basic_stringIcSt11char_traitsIcESaIcEEESaIS5_EEaSERKS7_.isra.0 |
| 34 | ····31:·0008189e···168·FUNC····LOCAL··DEFAULT···13·_ZNSt6vectorINSt7__cxx1112basic_stringIcSt11char_traitsIcESaIcEEESaIS5_EEaSERKS7_.isra.0.cold | 34 | ····31:·0008189e···168·FUNC····LOCAL··DEFAULT···13·_ZNSt6vectorINSt7__cxx1112basic_stringIcSt11char_traitsIcESaIcEEESaIS5_EEaSERKS7_.isra.0.cold |
| 35 | ····32:·000eab | 35 | ····32:·000eabd0···636·FUNC····LOCAL··DEFAULT···13·_ZNSt8_Rb_treeINSt7__cxx1112basic_stringIcSt11char_traitsIcESaIcEEESt4pairIKS5_iESt10_Select1stIS8_ESt4lessIS5_ESaIS8_EE8_M_eraseEPSt13_Rb_tree_nodeIS8_E.isra.0 |
| 36 | ····33:·000ea | 36 | ····33:·000eae50···768·FUNC····LOCAL··DEFAULT···13·_ZSt25__unguarded_linear_insertIN9__gnu_cxx17__normal_iteratorIPNSt7__cxx1112basic_stringIcSt11char_traitsIcESaIcEEESt6vectorIS7_SaIS7_EEEENS0_5__ops14_Val_less_iterEEvT_T0_.isra.0 |
| 37 | ····34:·000eb | 37 | ····34:·000eb150··1230·FUNC····LOCAL··DEFAULT···13·_ZSt16__insertion_sortIN9__gnu_cxx17__normal_iteratorIPNSt7__cxx1112basic_stringIcSt11char_traitsIcESaIcEEESt6vectorIS7_SaIS7_EEEENS0_5__ops15_Iter_less_iterEEvT_SF_T0_.isra.0 |
| 38 | ····35:·000eb | 38 | ····35:·000eb620··2044·FUNC····LOCAL··DEFAULT···13·_ZSt13__adjust_heapIN9__gnu_cxx17__normal_iteratorIPNSt7__cxx1112basic_stringIcSt11char_traitsIcESaIcEEESt6vectorIS7_SaIS7_EEEEiS7_NS0_5__ops15_Iter_less_iterEEvT_T0_SG_T1_T2_.isra.0 |
| 39 | ····36:·000eb | 39 | ····36:·000ebe20···866·FUNC····LOCAL··DEFAULT···13·_ZN5boost4math6detail16lgamma_small_impIeNS0_8policies6policyINS3_13promote_floatILb0EEENS3_14promote_doubleILb0EEENS3_14default_policyES9_S9_S9_S9_S9_S9_S9_S9_S9_S9_EENS0_7lanczos12lanczos17m64EEET_SD_SD_SD_RKSt17integral_constantIiLi64EERKT0_RKT1_.isra.0 |
| 40 | ····37:·000ec1 | 40 | ····37:·000ec190···965·FUNC····LOCAL··DEFAULT···13·_ZNSt8_Rb_treeINSt7__cxx1112basic_stringIcSt11char_traitsIcESaIcEEESt4pairIKS5_iESt10_Select1stIS8_ESt4lessIS5_ESaIS8_EE22_M_emplace_hint_uniqueIJRKSt21piecewise_construct_tSt5tupleIJRS7_EESJ_IJEEEEESt17_Rb_tree_iteratorIS8_ESt23_Rb_tree_const_iteratorIS8_EDpOT_.isra.0 |
| 41 | ····38:·00081946····93·FUNC····LOCAL··DEFAULT···13·_ZNSt8_Rb_treeINSt7__cxx1112basic_stringIcSt11char_traitsIcESaIcEEESt4pairIKS5_iESt10_Select1stIS8_ESt4lessIS5_ESaIS8_EE22_M_emplace_hint_uniqueIJRKSt21piecewise_construct_tSt5tupleIJRS7_EESJ_IJEEEEESt17_Rb_tree_iteratorIS8_ESt23_Rb_tree_const_iteratorIS8_EDpOT_.isra.0.cold | 41 | ····38:·00081946····93·FUNC····LOCAL··DEFAULT···13·_ZNSt8_Rb_treeINSt7__cxx1112basic_stringIcSt11char_traitsIcESaIcEEESt4pairIKS5_iESt10_Select1stIS8_ESt4lessIS5_ESaIS8_EE22_M_emplace_hint_uniqueIJRKSt21piecewise_construct_tSt5tupleIJRS7_EESJ_IJEEEEESt17_Rb_tree_iteratorIS8_ESt23_Rb_tree_const_iteratorIS8_EDpOT_.isra.0.cold |
| 42 | ····39:·000ec | 42 | ····39:·000ec560··1477·FUNC····LOCAL··DEFAULT···13·_ZN5boost4math6detail7erf_impIeNS0_8policies6policyINS3_13promote_floatILb0EEENS3_14promote_doubleILb0EEENS3_14default_policyES9_S9_S9_S9_S9_S9_S9_S9_S9_S9_EEEET_SB_bRKT0_RKSt17integral_constantIiLi64EE.isra.0 |
| 43 | ····40:·000ec | 43 | ····40:·000ecb30····41·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment10getSeqNameB5cxx11Ei.part.0 |
| 44 | ····41:·000ec | 44 | ····41:·000ecb60···726·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment16convertPomoStateEi.part.0 |
| 45 | ····42:·000819a4·····5·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment16convertPomoStateEi.part.0.cold | 45 | ····42:·000819a4·····5·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment16convertPomoStateEi.part.0.cold |
| 46 | ····43:·000819aa···221·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment14computeObsDistEii.cold | 46 | ····43:·000819aa···221·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment14computeObsDistEii.cold |
| 47 | ····44:·00081a88····28·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment23computeDivergenceMatrixEPdS0_b.cold | 47 | ····44:·00081a88····28·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment23computeDivergenceMatrixEPdS0_b.cold |
| 48 | ····45:·00081aa4···161·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment13checkGappySeqEb.cold | 48 | ····45:·00081aa4···161·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment13checkGappySeqEb.cold |
| 49 | ····46:·00081b45···323·FUNC····LOCAL··DEFAULT···13·_Z23getDataBlockMorphStatesP18NxsCharactersBlock.cold | 49 | ····46:·00081b45···323·FUNC····LOCAL··DEFAULT···13·_Z23getDataBlockMorphStatesP18NxsCharactersBlock.cold |
| 50 | ····47:·00081c88·····5·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment19printSiteInfoHeaderERSoPKcb.cold | 50 | ····47:·00081c88·····5·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment19printSiteInfoHeaderERSoPKcb.cold |
| 51 | ····48:·00081c8e···133·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment19convertStateBackStrB5cxx11Ej.cold | 51 | ····48:·00081c8e···133·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment19convertStateBackStrB5cxx11Ej.cold |
| Offset 61, 61 lines modified | Offset 61, 61 lines modified | ||
| 61 | ····57:·0008206e····10·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment16computeStateFreqEPdj.cold | 61 | ····57:·0008206e····10·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment16computeStateFreqEPdj.cold |
| 62 | ····58:·00082078····64·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment16computeCodonFreqE13StateFreqTypePdS1_.cold | 62 | ····58:·00082078····64·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment16computeCodonFreqE13StateFreqTypePdS1_.cold |
| 63 | ····59:·000820b8····39·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment15multinomialProbES_Rd.cold | 63 | ····59:·000820b8····39·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment15multinomialProbES_Rd.cold |
| 64 | ····60:·000820e0····17·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment15multinomialProbERSt6vectorIiSaIiEE.cold | 64 | ····60:·000820e0····17·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment15multinomialProbERSt6vectorIiSaIiEE.cold |
| 65 | ····61:·000820f1···676·FUNC····LOCAL··DEFAULT···13·_Z10processSeqRNSt7__cxx1112basic_stringIcSt11char_traitsIcESaIcEEES5_i.cold | 65 | ····61:·000820f1···676·FUNC····LOCAL··DEFAULT···13·_Z10processSeqRNSt7__cxx1112basic_stringIcSt11char_traitsIcESaIcEEES5_i.cold |
| 66 | ····62:·00082396···228·FUNC····LOCAL··DEFAULT···13·_ZN9AlignmentC2Ev.cold | 66 | ····62:·00082396···228·FUNC····LOCAL··DEFAULT···13·_ZN9AlignmentC2Ev.cold |
| 67 | ····63:·0008247a···537·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment13printSiteGapsEPKc.cold | 67 | ····63:·0008247a···537·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment13printSiteGapsEPKc.cold |
| 68 | ····64:·005 | 68 | ····64:·00520768····22·OBJECT··LOCAL··DEFAULT···15·_ZL16ERR_WRITE_OUTPUT |
| 69 | ····65:·00082694···368·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment9printDistEPKcPd.cold | 69 | ····65:·00082694···368·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment9printDistEPKcPd.cold |
| 70 | ····66:·00082804···400·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment14printAlignmentE9InputTypePKcbS2_iS2_.cold | 70 | ····66:·00082804···400·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment14printAlignmentE9InputTypePKcbS2_iS2_.cold |
| 71 | ····67:·00082994····23·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment24createBootstrapAlignmentERSt6vectorIiSaIiEEPKc.cold | 71 | ····67:·00082994····23·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment24createBootstrapAlignmentERSt6vectorIiSaIiEEPKc.cold |
| 72 | ····68:·000829ac····83·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment17checkIdenticalSeqEv.cold | 72 | ····68:·000829ac····83·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment17checkIdenticalSeqEv.cold |
| 73 | ····69:·00082a00···198·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment15multinomialProbEPdRd.cold | 73 | ····69:·00082a00···198·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment15multinomialProbEPdRd.cold |
| 74 | ····70:·00082ac6···199·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment15multinomialProbESt6vectorIdSaIdEERd.cold | 74 | ····70:·00082ac6···199·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment15multinomialProbESt6vectorIdSaIdEERd.cold |
| 75 | ····71:·00082b8e··1004·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment19buildRetainingSitesEPKcRSt6vectorIiSaIiEEiS1_.cold | 75 | ····71:·00082b8e··1004·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment19buildRetainingSitesEPKcRSt6vectorIiSaIiEEiS1_.cold |
| 76 | ····72:·005 | 76 | ····72:·00520780····55·OBJECT··LOCAL··DEFAULT···15·_ZL14ERR_READ_INPUT |
| 77 | ····73:·00082f7a···169·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment11printPhylipERSobPKciS2_b.cold | 77 | ····73:·00082f7a···169·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment11printPhylipERSobPKciS2_b.cold |
| 78 | ····74:·00083024···169·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment10printFastaERSobPKciS2_.cold | 78 | ····74:·00083024···169·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment10printFastaERSobPKciS2_.cold |
| 79 | ····75:·000830ce···320·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment10printNexusERSobPKciS2_b.cold | 79 | ····75:·000830ce···320·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment10printNexusERSobPKciS2_b.cold |
| 80 | ····76:·0008320e···873·FUNC····LOCAL··DEFAULT···13·_Z13extractSiteIDP9AlignmentPKcRSt6vectorIiSaIiEE.cold | 80 | ····76:·0008320e···873·FUNC····LOCAL··DEFAULT···13·_Z13extractSiteIDP9AlignmentPKcRSt6vectorIiSaIiEE.cold |
| 81 | ····77:·00083578···407·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment24createBootstrapAlignmentEPiPKcS0_.cold | 81 | ····77:·00083578···407·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment24createBootstrapAlignmentEPiPKcS0_.cold |
| 82 | ····78:·00083710···872·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment8readDistERSiPd.cold | 82 | ····78:·00083710···872·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment8readDistERSiPd.cold |
| 83 | ····79:·00083a78···759·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment8readDistEPKcPd.cold | 83 | ····79:·00083a78···759·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment8readDistEPKcPd.cold |
| 84 | ····80:·000f96 | 84 | ····80:·000f96a0··1522·FUNC····LOCAL··DEFAULT···13·_ZSt16__introsort_loopIN9__gnu_cxx17__normal_iteratorIPNSt7__cxx1112basic_stringIcSt11char_traitsIcESaIcEEESt6vectorIS7_SaIS7_EEEEiNS0_5__ops15_Iter_less_iterEEvT_SF_T0_T1_.isra.0 |
| 85 | ····81:·000f9c | 85 | ····81:·000f9ca0··2200·FUNC····LOCAL··DEFAULT···13·_ZNSt6vectorINSt7__cxx1112basic_stringIcSt11char_traitsIcESaIcEEESaIS5_EE15_M_range_insertIN9__gnu_cxx17__normal_iteratorIPS5_S7_EEEEvSC_T_SD_St20forward_iterator_tag.isra.0 |
| 86 | ····82:·00083d70···110·FUNC····LOCAL··DEFAULT···13·_ZNSt6vectorINSt7__cxx1112basic_stringIcSt11char_traitsIcESaIcEEESaIS5_EE15_M_range_insertIN9__gnu_cxx17__normal_iteratorIPS5_S7_EEEEvSC_T_SD_St20forward_iterator_tag.isra.0.cold | 86 | ····82:·00083d70···110·FUNC····LOCAL··DEFAULT···13·_ZNSt6vectorINSt7__cxx1112basic_stringIcSt11char_traitsIcESaIcEEESaIS5_EE15_M_range_insertIN9__gnu_cxx17__normal_iteratorIPS5_S7_EEEEvSC_T_SD_St20forward_iterator_tag.isra.0.cold |
| 87 | ····83:·00083dde···532·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment12checkSeqNameEv.cold | 87 | ····83:·00083dde···532·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment12checkSeqNameEv.cold |
| 88 | ····84:·00083ff2····56·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment10addPatternER7Patternii.cold | 88 | ····84:·00083ff2····56·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment10addPatternER7Patternii.cold |
| 89 | ····85:·000e3f | 89 | ····85:·000e3f80····84·FUNC····LOCAL··DEFAULT···13·_ZN5boost4math3erfIeNS0_8policies6policyINS2_13promote_floatILb0EEENS2_14promote_doubleILb0EEENS2_14default_policyES8_S8_S8_S8_S8_S8_S8_S8_S8_S8_EEEENS0_5tools12promote_argsIT_fffffE4typeESC_RKT0_.isra.0 |
| 90 | ····86:·000f | 90 | ····86:·000fc050···482·FUNC····LOCAL··DEFAULT···13·_ZN5boost4math6detail18full_igamma_prefixIeNS0_8policies6policyINS3_13promote_floatILb0EEENS3_14promote_doubleILb0EEENS3_14default_policyES9_S9_S9_S9_S9_S9_S9_S9_S9_S9_EEEET_SB_SB_RKT0_.isra.0 |
| 91 | ····87:·000fc | 91 | ····87:·000fc240··1045·FUNC····LOCAL··DEFAULT···13·_ZN5boost4math6detail8beta_impIeNS0_7lanczos12lanczos17m64ENS0_8policies6policyINS5_13promote_floatILb0EEENS5_14promote_doubleILb0EEENS5_14default_policyESB_SB_SB_SB_SB_SB_SB_SB_SB_SB_EEEET_SD_SD_RKT0_RKT1_.isra.0 |
| 92 | ····88:·000fc | 92 | ····88:·000fc660····98·FUNC····LOCAL··DEFAULT···13·_ZN5boost4math6detail4betaIeeNS0_8policies6policyINS3_13promote_floatILb0EEENS3_14promote_doubleILb0EEENS3_14default_policyES9_S9_S9_S9_S9_S9_S9_S9_S9_S9_EEEENS0_5tools12promote_argsIT_T0_ffffE4typeESD_SE_RKT1_PKSt17integral_constantIbLb1EE.isra.0 |
| 93 | ····89:·000fc6 | 93 | ····89:·000fc6d0···542·FUNC····LOCAL··DEFAULT···13·_ZN5boost4math20binomial_coefficientIeNS0_8policies6policyINS2_13promote_floatILb0EEENS2_14promote_doubleILb0EEENS2_14default_policyES8_S8_S8_S8_S8_S8_S8_S8_S8_S8_EEEET_jjRKT0_.isra.0 |
| 94 | ····90:·000fc8 | 94 | ····90:·000fc8f0··4044·FUNC····LOCAL··DEFAULT···13·_ZN5boost4math6detail17ibeta_power_termsIeNS0_7lanczos12lanczos17m64ENS0_8policies6policyINS5_13promote_floatILb0EEENS5_14promote_doubleILb0EEENS5_14default_policyESB_SB_SB_SB_SB_SB_SB_SB_SB_SB_EEEET_SD_SD_SD_SD_RKT0_bRKT1_SD_PKc.isra.0 |
| 95 | ····91:·000fd8 | 95 | ····91:·000fd8c0···769·FUNC····LOCAL··DEFAULT···13·_ZN5boost4math6detail15ibeta_fraction2IeNS0_8policies6policyINS3_13promote_floatILb0EEENS3_14promote_doubleILb0EEENS3_14default_policyES9_S9_S9_S9_S9_S9_S9_S9_S9_S9_EEEET_SB_SB_SB_SB_RKT0_bPSB_.isra.0 |
| 96 | ····92:·000fdb | 96 | ····92:·000fdbd0··1124·FUNC····LOCAL··DEFAULT···13·_ZN5boost4math6detail9powm1_impIeNS0_8policies6policyINS3_13promote_floatILb0EEENS3_14promote_doubleILb0EEENS3_14default_policyES9_S9_S9_S9_S9_S9_S9_S9_S9_S9_EEEET_SB_SB_RKT0_.isra.0 |
| 97 | ····93:·000f | 97 | ····93:·000fe040···849·FUNC····LOCAL··DEFAULT···13·_ZN5boost4math6detail9gamma_impIeNS0_8policies6policyINS3_13promote_floatILb0EEENS3_14promote_doubleILb0EEENS3_14default_policyES9_S9_S9_S9_S9_S9_S9_S9_S9_S9_EENS0_7lanczos12lanczos17m64EEET_SD_RKT0_RKT1_.isra.0 |
| 98 | ····94:·000fe3 | 98 | ····94:·000fe3a0···796·FUNC····LOCAL··DEFAULT···13·_ZN5boost4math6detail10lgamma_impIeNS0_8policies6policyINS3_13promote_floatILb0EEENS3_14promote_doubleILb0EEENS3_14default_policyES9_S9_S9_S9_S9_S9_S9_S9_S9_S9_EENS0_7lanczos12lanczos17m64EEET_SD_RKT0_RKT1_Pi.isra.0 |
| 99 | ····95:·000e3f | 99 | ····95:·000e3fe0····86·FUNC····LOCAL··DEFAULT···13·_ZN5boost4math6lgammaIeNS0_8policies6policyINS2_13promote_floatILb0EEENS2_14promote_doubleILb0EEENS2_14default_policyES8_S8_S8_S8_S8_S8_S8_S8_S8_S8_EEEENS0_5tools12promote_argsIT_fffffE4typeESC_PiRKT0_.isra.0 |
| 100 | ····96:·000fe6 | 100 | ····96:·000fe6c0···697·FUNC····LOCAL··DEFAULT···13·_ZN5boost4math6detail30tgamma_delta_ratio_imp_lanczosIeNS0_8policies6policyINS3_13promote_floatILb0EEENS3_14promote_doubleILb0EEENS3_14default_policyES9_S9_S9_S9_S9_S9_S9_S9_S9_S9_EENS0_7lanczos12lanczos17m64EEET_SD_SD_RKT0_RKT1_.isra.0 |
| 101 | ····97:·000fe9 | 101 | ····97:·000fe980···114·FUNC····LOCAL··DEFAULT···13·_ZN5boost4math8policies23check_series_iterationsIeNS1_6policyINS1_13promote_floatILb0EEENS1_14promote_doubleILb0EEENS1_14default_policyES8_S8_S8_S8_S8_S8_S8_S8_S8_S8_EEEEvPKcyRKT0_.part.0 |
| 102 | ····98:·000fe | 102 | ····98:·000fea00··1595·FUNC····LOCAL··DEFAULT···13·_ZN5boost4math6detail24regularised_gamma_prefixIeNS0_8policies6policyINS3_13promote_floatILb0EEENS3_14promote_doubleILb0EEENS3_14default_policyES9_S9_S9_S9_S9_S9_S9_S9_S9_S9_EENS0_7lanczos12lanczos17m64EEET_SD_SD_RKT0_RKT1_.isra.0 |
| 103 | ····99:·000f | 103 | ····99:·000ff040··1767·FUNC····LOCAL··DEFAULT···13·_ZN5boost4math6detail12ibeta_seriesIeNS0_7lanczos12lanczos17m64ENS0_8policies6policyINS5_13promote_floatILb0EEENS5_14promote_doubleILb0EEENS5_14default_policyESB_SB_SB_SB_SB_SB_SB_SB_SB_SB_EEEET_SD_SD_SD_SD_RKT0_bPSD_SD_RKT1_.isra.0 |
| 104 | ···100:·000ff | 104 | ···100:·000ff730··9796·FUNC····LOCAL··DEFAULT···13·_ZN5boost4math6detail20gamma_incomplete_impIeNS0_8policies6policyINS3_13promote_floatILb0EEENS3_14promote_doubleILb0EEENS3_14default_policyES9_S9_S9_S9_S9_S9_S9_S9_S9_S9_EEEET_SB_SB_bbRKT0_PSB_.isra.0 |
| 105 | ···101:·0008402a···105·FUNC····LOCAL··DEFAULT···13·_ZN5boost4math6detail20gamma_incomplete_impIeNS0_8policies6policyINS3_13promote_floatILb0EEENS3_14promote_doubleILb0EEENS3_14default_policyES9_S9_S9_S9_S9_S9_S9_S9_S9_S9_EEEET_SB_SB_bbRKT0_PSB_.isra.0.cold | 105 | ···101:·0008402a···105·FUNC····LOCAL··DEFAULT···13·_ZN5boost4math6detail20gamma_incomplete_impIeNS0_8policies6policyINS3_13promote_floatILb0EEENS3_14promote_doubleILb0EEENS3_14default_policyES9_S9_S9_S9_S9_S9_S9_S9_S9_S9_EEEET_SB_SB_bbRKT0_PSB_.isra.0.cold |
| 106 | ···102:·00101d | 106 | ···102:·00101d80··2045·FUNC····LOCAL··DEFAULT···13·_ZN5boost4math6detail27beta_small_b_large_a_seriesIeNS0_8policies6policyINS3_13promote_floatILb0EEENS3_14promote_doubleILb0EEENS3_14default_policyES9_S9_S9_S9_S9_S9_S9_S9_S9_S9_EEEET_SB_SB_SB_SB_SB_SB_RKT0_b.isra.0 |
| 107 | ···103:·001025 | 107 | ···103:·00102580··7962·FUNC····LOCAL··DEFAULT···13·_ZN13SymTestResult13computePvalueEv.part.0 |
| 108 | ···104:·00084094····96·FUNC····LOCAL··DEFAULT···13·_ZN13SymTestResult13computePvalueEv.part.0.cold | 108 | ···104:·00084094····96·FUNC····LOCAL··DEFAULT···13·_ZN13SymTestResult13computePvalueEv.part.0.cold |
| 109 | ···105:·001044 | 109 | ···105:·001044c0···362·FUNC····LOCAL··DEFAULT···13·_ZN5Eigen8internal19gemv_dense_selectorILi2ELi1ELb1EE3runINS_9TransposeIKNS_6MatrixIdLin1ELin1ELi0ELin1ELin1EEEEENS4_IKNS4_INS5_IdLin1ELi1ELi0ELin1ELi1EEEEEEENS4_INS5_IdLi1ELin1ELi1ELi1ELin1EEEEEEEvRKT_RKT0_RT1_RKNSL_6ScalarE.isra.0 |
| 110 | ···106:·000840f4····22·FUNC····LOCAL··DEFAULT···13·_ZN5Eigen8internal19gemv_dense_selectorILi2ELi1ELb1EE3runINS_9TransposeIKNS_6MatrixIdLin1ELin1ELi0ELin1ELin1EEEEENS4_IKNS4_INS5_IdLin1ELi1ELi0ELin1ELi1EEEEEEENS4_INS5_IdLi1ELin1ELi1ELi1ELin1EEEEEEEvRKT_RKT0_RT1_RKNSL_6ScalarE.isra.0.cold | 110 | ···106:·000840f4····22·FUNC····LOCAL··DEFAULT···13·_ZN5Eigen8internal19gemv_dense_selectorILi2ELi1ELb1EE3runINS_9TransposeIKNS_6MatrixIdLin1ELin1ELi0ELin1ELin1EEEEENS4_IKNS4_INS5_IdLin1ELi1ELi0ELin1ELi1EEEEEEENS4_INS5_IdLi1ELin1ELi1ELi1ELin1EEEEEEEvRKT_RKT0_RT1_RKNSL_6ScalarE.isra.0.cold |
| 111 | ···107:·0012f | 111 | ···107:·0012fa30···437·FUNC····LOCAL··DEFAULT···13·_ZN5Eigen8internal16parallelize_gemmILb1ENS0_12gemm_functorIdiNS0_29general_matrix_matrix_productIidLi0ELb0EdLi0ELb0ELi0ELi1EEENS_5BlockIKNS_6MatrixIdLin1ELin1ELi0ELin1ELin1EEELin1ELin1ELb0EEENS5_IS7_Lin1ELin1ELb0EEES7_NS0_19gemm_blocking_spaceILi0EddLin1ELin1ELin1ELi1ELb0EEEEEiEEvRKT0_T1_SH_SH_b._omp_fn.0 |
| 112 | ···108:·00104 | 112 | ···108:·00104630··1509·FUNC····LOCAL··DEFAULT···13·_ZNK5Eigen9DenseBaseINS_13CwiseBinaryOpINS_8internal17scalar_product_opIddEEKNS_9TransposeIKNS_7ProductINS5_INS_6MatrixIdLin1ELi1ELi0ELin1ELi1EEEEENS_7InverseINS_9FullPivLUINS7_IdLin1ELin1ELi0ELin1ELin1EEEEEEELi0EEEEEKS8_EEE5reduxINS2_13scalar_sum_opIddEEEEdRKT_.isra.0 |
| 113 | ···109:·0008410a···285·FUNC····LOCAL··DEFAULT···13·_ZNK5Eigen9DenseBaseINS_13CwiseBinaryOpINS_8internal17scalar_product_opIddEEKNS_9TransposeIKNS_7ProductINS5_INS_6MatrixIdLin1ELi1ELi0ELin1ELi1EEEEENS_7InverseINS_9FullPivLUINS7_IdLin1ELin1ELi0ELin1ELin1EEEEEEELi0EEEEEKS8_EEE5reduxINS2_13scalar_sum_opIddEEEEdRKT_.isra.0.cold | 113 | ···109:·0008410a···285·FUNC····LOCAL··DEFAULT···13·_ZNK5Eigen9DenseBaseINS_13CwiseBinaryOpINS_8internal17scalar_product_opIddEEKNS_9TransposeIKNS_7ProductINS5_INS_6MatrixIdLin1ELi1ELi0ELin1ELi1EEEEENS_7InverseINS_9FullPivLUINS7_IdLin1ELin1ELi0ELin1ELin1EEEEEEELi0EEEEEKS8_EEE5reduxINS2_13scalar_sum_opIddEEEEdRKT_.isra.0.cold |
| 114 | ···110:·000e | 114 | ···110:·000e4040···388·FUNC····LOCAL··DEFAULT···13·_GLOBAL__sub_I_symbols_protein |
| 115 | ···111:·00084228···307·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment16extractDataBlockEP18NxsCharactersBlock.cold | 115 | ···111:·00084228···307·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment16extractDataBlockEP18NxsCharactersBlock.cold |
| 116 | ···112:·0008435c···273·FUNC····LOCAL··DEFAULT···13·_ZN9AlignmentC2EP12NxsDataBlockPcNSt7__cxx1112basic_stringIcSt11char_traitsIcESaIcEEE.cold | 116 | ···112:·0008435c···273·FUNC····LOCAL··DEFAULT···13·_ZN9AlignmentC2EP12NxsDataBlockPcNSt7__cxx1112basic_stringIcSt11char_traitsIcESaIcEEE.cold |
| 117 | ···113:·0008446e···483·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment9readNexusEPc.cold | 117 | ···113:·0008446e···483·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment9readNexusEPc.cold |
| 118 | ···114:·00084652···102·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment13printSiteInfoERSoi.cold | 118 | ···114:·00084652···102·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment13printSiteInfoERSoi.cold |
| 119 | ···115:·000846b8···209·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment13printSiteInfoEPKc.cold | 119 | ···115:·000846b8···209·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment13printSiteInfoEPKc.cold |
| 120 | ···116:·0008478a····68·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment16addConstPatternsEPc.cold | 120 | ···116:·0008478a····68·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment16addConstPatternsEPc.cold |
| 121 | ···117:·000847ce···199·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment22orderPatternByNumCharsEi.cold | 121 | ···117:·000847ce···199·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment22orderPatternByNumCharsEi.cold |
| Offset 144, 169 lines modified | Offset 144, 169 lines modified | ||
| 144 | ···140:·000897c8····46·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment20buildFromPatternFreqERS_St6vectorIiSaIiEE.cold | 144 | ···140:·000897c8····46·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment20buildFromPatternFreqERS_St6vectorIiSaIiEE.cold |
| 145 | ···141:·000897f6···220·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment24createGapMaskedAlignmentEPS_S0_.cold | 145 | ···141:·000897f6···220·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment24createGapMaskedAlignmentEPS_S0_.cold |
| 146 | ···142:·000898d2···175·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment20concatenateAlignmentEPS_.cold | 146 | ···142:·000898d2···175·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment20concatenateAlignmentEPS_.cold |
| 147 | ···143:·00089982····81·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment13copyAlignmentEPS_.cold | 147 | ···143:·00089982····81·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment13copyAlignmentEPS_.cold |
| 148 | ···144:·000899d4····80·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment21generateUninfPatternsEjRSt6vectorIjSaIjEERS0_IiSaIiEERS0_I7PatternSaIS7_EE.cold | 148 | ···144:·000899d4····80·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment21generateUninfPatternsEjRSt6vectorIjSaIjEERS0_IiSaIiEERS0_I7PatternSaIS7_EE.cold |
| 149 | ···145:·00089a24···460·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment26getUnobservedConstPatternsE7ASCTypeRSt6vectorI7PatternSaIS2_EE.cold | 149 | ···145:·00089a24···460·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment26getUnobservedConstPatternsE7ASCTypeRSt6vectorI7PatternSaIS2_EE.cold |
| 150 | ···146:·00089bf0··1523·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment9doSymTestEjRSt6vectorI13SymTestResultSaIS1_EES4_S4_PiPS0_I11SymTestStatSaIS6_EE.cold | 150 | ···146:·00089bf0··1523·FUNC····LOCAL··DEFAULT···13·_ZN9Alignment9doSymTestEjRSt6vectorI13SymTestResultSaIS1_EES4_S4_PiPS0_I11SymTestStatSaIS6_EE.cold |
| 151 | ···147:·000e8 | 151 | ···147:·000e857b·····0·NOTYPE··LOCAL··DEFAULT···13·.L71 |
| 152 | ···148:·000e8 | 152 | ···148:·000e8558·····0·NOTYPE··LOCAL··DEFAULT···13·.L67 |
| 153 | ···149:·000e85 | 153 | ···149:·000e8590·····0·NOTYPE··LOCAL··DEFAULT···13·.L76 |
| 154 | ···150:·000ef4 | 154 | ···150:·000ef4f0·····0·NOTYPE··LOCAL··DEFAULT···13·.L2106 |
| 155 | ···151:·000ef | 155 | ···151:·000ef530·····0·NOTYPE··LOCAL··DEFAULT···13·.L2110 |
| Max diff block lines reached; 1819221/1858585 bytes (97.88%) of diff not shown. | |||
| Offset 1, 8 lines modified | Offset 1, 8 lines modified | ||
| 1 | Displaying·notes·found·in:·.note.gnu.build-id | 1 | Displaying·notes·found·in:·.note.gnu.build-id |
| 2 | ··Owner················Data·size·» Description | 2 | ··Owner················Data·size·» Description |
| 3 | ··GNU··················0x00000014» NT_GNU_BUILD_ID·(unique·build·ID·bitstring)» ····Build·ID:· | 3 | ··GNU··················0x00000014» NT_GNU_BUILD_ID·(unique·build·ID·bitstring)» ····Build·ID:·af6a21c80fc63827ad9ba4fb14784f02c16f66ae |
| 4 | Displaying·notes·found·in:·.note.ABI-tag | 4 | Displaying·notes·found·in:·.note.ABI-tag |
| 5 | ··Owner················Data·size·» Description | 5 | ··Owner················Data·size·» Description |
| 6 | ··GNU··················0x00000010» NT_GNU_ABI_TAG·(ABI·version·tag)» ····OS:·Linux,·ABI:·3.2.0 | 6 | ··GNU··················0x00000010» NT_GNU_ABI_TAG·(ABI·version·tag)» ····OS:·Linux,·ABI:·3.2.0 |
| Offset 25, 194 lines modified | Offset 25, 194 lines modified | ||
| 25 | ··Opcode·9·has·1·arg | 25 | ··Opcode·9·has·1·arg |
| 26 | ··Opcode·10·has·0·args | 26 | ··Opcode·10·has·0·args |
| 27 | ··Opcode·11·has·0·args | 27 | ··Opcode·11·has·0·args |
| 28 | ··Opcode·12·has·1·arg | 28 | ··Opcode·12·has·1·arg |
| 29 | ·The·Directory·Table·(offset·0x22,·lines·22,·columns·1): | 29 | ·The·Directory·Table·(offset·0x22,·lines·22,·columns·1): |
| 30 | ··Entry» Name | 30 | ··Entry» Name |
| 31 | ··0» (line_strp)» (offset:·0x1e):·./build. | 31 | ··0» (line_strp)» (offset:·0x1e):·./build.serial |
| 32 | ··1» (line_strp)» (offset:·0x2 | 32 | ··1» (line_strp)» (offset:·0x2d):·./obsolete |
| 33 | ··2» (line_strp)» (offset:·0x3 | 33 | ··2» (line_strp)» (offset:·0x38):·/usr/include/c++/14/bits |
| 34 | ··3» (line_strp)» (offset:·0x | 34 | ··3» (line_strp)» (offset:·0x51):·/usr/include/c++/14 |
| 35 | ··4» (line_strp)» (offset:·0x6 | 35 | ··4» (line_strp)» (offset:·0x65):·/usr/include/c++/14/debug |
| 36 | ··5» (line_strp)» (offset:·0x7 | 36 | ··5» (line_strp)» (offset:·0x7f):·/usr/include/i386-linux-gnu/c++/14/bits |
| 37 | ··6» (line_strp)» (offset:·0xa | 37 | ··6» (line_strp)» (offset:·0xa7):·/usr/include/c++/14/tr1 |
| 38 | ··7» (line_strp)» (offset:·0xb | 38 | ··7» (line_strp)» (offset:·0xbf):·/usr/include/c++/14/ext |
| 39 | ··8» (line_strp)» (offset:·0xd | 39 | ··8» (line_strp)» (offset:·0xd7):·/usr/lib/gcc/i686-linux-gnu/14/include |
| 40 | ··9» (line_strp)» (offset:·0xf | 40 | ··9» (line_strp)» (offset:·0xfe):·/usr/include |
| 41 | ··10» (line_strp)» (offset:·0x10 | 41 | ··10» (line_strp)» (offset:·0x10b):·/usr/include/i386-linux-gnu/bits/types |
| 42 | ··11» (line_strp)» (offset:·0x1 | 42 | ··11» (line_strp)» (offset:·0x132):·/usr/include/i386-linux-gnu/bits |
| 43 | ··12» (line_strp)» (offset:·0x15 | 43 | ··12» (line_strp)» (offset:·0x153):·./ncl |
| 44 | ··13» (line_strp)» (offset:·0x15 | 44 | ··13» (line_strp)» (offset:·0x159):·./utils |
| 45 | ··14» (line_strp)» (offset:·0x1 | 45 | ··14» (line_strp)» (offset:·0x161):·./pda |
| 46 | ··15» (line_strp)» (offset:·0x16 | 46 | ··15» (line_strp)» (offset:·0x167):·./tree |
| 47 | ··16» (line_strp)» (offset:·0x16 | 47 | ··16» (line_strp)» (offset:·0x16e):·./yaml-cpp/include/yaml-cpp |
| 48 | ··17» (line_strp)» (offset:·0x18 | 48 | ··17» (line_strp)» (offset:·0x18a):·./yaml-cpp/include/yaml-cpp/node/detail |
| 49 | ··18» (line_strp)» (offset:·0x1 | 49 | ··18» (line_strp)» (offset:·0x1b2):·./phylo-yaml |
| 50 | ··19» (line_strp)» (offset:·0x1b | 50 | ··19» (line_strp)» (offset:·0x1bf):·./alignment |
| 51 | ··20» (line_strp)» (offset:·0x1c | 51 | ··20» (line_strp)» (offset:·0x1cb):·./model |
| 52 | ··21» (line_strp)» (offset:·0x1d | 52 | ··21» (line_strp)» (offset:·0x1d3):·./nclextra |
| 53 | ·The·File·Name·Table·(offset·0x80,·lines·102,·columns·2): | 53 | ·The·File·Name·Table·(offset·0x80,·lines·102,·columns·2): |
| 54 | ··Entry» Dir» Name | 54 | ··Entry» Dir» Name |
| 55 | ··0» (udata)» 1» (line_strp)» (offset:·0xb):·parsmultistate.cpp | 55 | ··0» (udata)» 1» (line_strp)» (offset:·0xb):·parsmultistate.cpp |
| 56 | ··1» (udata)» 2» (line_strp)» (offset:·0x1d | 56 | ··1» (udata)» 2» (line_strp)» (offset:·0x1de):·locale_facets.h |
| 57 | ··2» (udata)» 1» (line_strp)» (offset:·0xb):·parsmultistate.cpp | 57 | ··2» (udata)» 1» (line_strp)» (offset:·0xb):·parsmultistate.cpp |
| 58 | ··3» (udata)» 2» (line_strp)» (offset:·0x1e | 58 | ··3» (udata)» 2» (line_strp)» (offset:·0x1ee):·basic_string.h |
| 59 | ··4» (udata)» 2» (line_strp)» (offset:·0x1f | 59 | ··4» (udata)» 2» (line_strp)» (offset:·0x1fd):·char_traits.h |
| 60 | ··5» (udata)» 2» (line_strp)» (offset:·0x20 | 60 | ··5» (udata)» 2» (line_strp)» (offset:·0x20b):·basic_string.tcc |
| 61 | ··6» (udata)» 2» (line_strp)» (offset:·0x21 | 61 | ··6» (udata)» 2» (line_strp)» (offset:·0x21c):·alloc_traits.h |
| 62 | ··7» (udata)» 2» (line_strp)» (offset:·0x22 | 62 | ··7» (udata)» 2» (line_strp)» (offset:·0x22b):·new_allocator.h |
| 63 | ··8» (udata)» 2» (line_strp)» (offset:·0x2b | 63 | ··8» (udata)» 2» (line_strp)» (offset:·0x2bf):·allocator.h |
| 64 | ··9» (udata)» 3» (line_strp)» (offset:·0x30 | 64 | ··9» (udata)» 3» (line_strp)» (offset:·0x309):·ostream |
| 65 | ··10» (udata)» 2» (line_strp)» (offset:·0x23 | 65 | ··10» (udata)» 2» (line_strp)» (offset:·0x23b):·basic_ios.h |
| 66 | ··11» (udata)» 2» (line_strp)» (offset:·0x24 | 66 | ··11» (udata)» 2» (line_strp)» (offset:·0x247):·ios_base.h |
| 67 | ··12» (udata)» 2» (line_strp)» (offset:·0x2 | 67 | ··12» (udata)» 2» (line_strp)» (offset:·0x252):·stl_pair.h |
| 68 | ··13» (udata)» 2» (line_strp)» (offset:·0x25 | 68 | ··13» (udata)» 2» (line_strp)» (offset:·0x25d):·stl_iterator_base_types.h |
| 69 | ··14» (udata)» 3» (line_strp)» (offset:·0x95 | 69 | ··14» (udata)» 3» (line_strp)» (offset:·0x956):·type_traits |
| 70 | ··15» (udata)» 4» (line_strp)» (offset:·0x27 | 70 | ··15» (udata)» 4» (line_strp)» (offset:·0x277):·debug.h |
| 71 | ··16» (udata)» 5» (line_strp)» (offset:·0x27 | 71 | ··16» (udata)» 5» (line_strp)» (offset:·0x27f):·c++config.h |
| 72 | ··17» (udata)» 3» (line_strp)» (offset:·0x28 | 72 | ··17» (udata)» 3» (line_strp)» (offset:·0x28b):·cwchar |
| 73 | ··18» (udata)» 3» (line_strp)» (offset:·0x2 | 73 | ··18» (udata)» 3» (line_strp)» (offset:·0x292):·clocale |
| 74 | ··19» (udata)» 3» (line_strp)» (offset:·0x29 | 74 | ··19» (udata)» 3» (line_strp)» (offset:·0x29a):·cstdlib |
| 75 | ··20» (udata)» 3» (line_strp)» (offset:·0x2 | 75 | ··20» (udata)» 3» (line_strp)» (offset:·0x2a2):·cstdio |
| 76 | ··21» (udata)» 3» (line_strp)» (offset:·0x2a | 76 | ··21» (udata)» 3» (line_strp)» (offset:·0x2a9):·initializer_list |
| 77 | ··22» (udata)» 2» (line_strp)» (offset:·0x2b | 77 | ··22» (udata)» 2» (line_strp)» (offset:·0x2ba):·uses_allocator.h |
| 78 | ··23» (udata)» 3» (line_strp)» (offset:·0x2c | 78 | ··23» (udata)» 3» (line_strp)» (offset:·0x2cb):·tuple |
| 79 | ··24» (udata)» 2» (line_strp)» (offset:·0x2 | 79 | ··24» (udata)» 2» (line_strp)» (offset:·0x2d1):·exception_ptr.h |
| 80 | ··25» (udata)» 2» (line_strp)» (offset:·0x2 | 80 | ··25» (udata)» 2» (line_strp)» (offset:·0x2e1):·stringfwd.h |
| 81 | ··26» (udata)» 3» (line_strp)» (offset:·0x2e | 81 | ··26» (udata)» 3» (line_strp)» (offset:·0x2ed):·cwctype |
| 82 | ··27» (udata)» 2» (line_strp)» (offset:·0x2f | 82 | ··27» (udata)» 2» (line_strp)» (offset:·0x2f5):·ostream.tcc |
| 83 | ··28» (udata)» 3» (line_strp)» (offset:·0x | 83 | ··28» (udata)» 3» (line_strp)» (offset:·0x301):·iosfwd |
| 84 | ··29» (udata)» 3» (line_strp)» (offset:·0x30 | 84 | ··29» (udata)» 3» (line_strp)» (offset:·0x308):·iostream |
| 85 | ··30» (udata)» 2» (line_strp)» (offset:·0x3 | 85 | ··30» (udata)» 2» (line_strp)» (offset:·0x311):·postypes.h |
| 86 | ··31» (udata)» 2» (line_strp)» (offset:·0x31 | 86 | ··31» (udata)» 2» (line_strp)» (offset:·0x31c):·std_abs.h |
| 87 | ··32» (udata)» 3» (line_strp)» (offset:·0x32 | 87 | ··32» (udata)» 3» (line_strp)» (offset:·0x326):·cmath |
| 88 | ··33» (udata)» 3» (line_strp)» (offset:·0x32 | 88 | ··33» (udata)» 3» (line_strp)» (offset:·0x32c):·cstdarg |
| 89 | ··34» (udata)» 3» (line_strp)» (offset:·0x33 | 89 | ··34» (udata)» 3» (line_strp)» (offset:·0x334):·ctime |
| 90 | ··35» (udata)» 3» (line_strp)» (offset:·0x33 | 90 | ··35» (udata)» 3» (line_strp)» (offset:·0x33a):·cstring |
| 91 | ··36» (udata)» 6» (line_strp)» (offset:·0x95 | 91 | ··36» (udata)» 6» (line_strp)» (offset:·0x956):·type_traits |
| 92 | ··37» (udata)» 6» (line_strp)» (offset:·0x3 | 92 | ··37» (udata)» 6» (line_strp)» (offset:·0x342):·hashtable_policy.h |
| 93 | ··38» (udata)» 2» (line_strp)» (offset:·0x35 | 93 | ··38» (udata)» 2» (line_strp)» (offset:·0x355):·shared_ptr_base.h |
| 94 | ··39» (udata)» 3» (line_strp)» (offset:·0x36 | 94 | ··39» (udata)» 3» (line_strp)» (offset:·0x367):·cstddef |
| 95 | ··40» (udata)» 2» (line_strp)» (offset:·0x36 | 95 | ··40» (udata)» 2» (line_strp)» (offset:·0x36f):·ptr_traits.h |
| 96 | ··41» (udata)» 2» (line_strp)» (offset:·0x37 | 96 | ··41» (udata)» 2» (line_strp)» (offset:·0x37c):·basic_ios.tcc |
| 97 | ··42» (udata)» 2» (line_strp)» (offset:·0x38 | 97 | ··42» (udata)» 2» (line_strp)» (offset:·0x38a):·ostream_insert.h |
| 98 | ··43» (udata)» 2» (line_strp)» (offset:·0x39 | 98 | ··43» (udata)» 2» (line_strp)» (offset:·0x39b):·functexcept.h |
| 99 | ··44» (udata)» 2» (line_strp)» (offset:·0x3a | 99 | ··44» (udata)» 2» (line_strp)» (offset:·0x3a9):·stl_iterator_base_funcs.h |
| 100 | ··45» (udata)» 2» (line_strp)» (offset:·0x3c | 100 | ··45» (udata)» 2» (line_strp)» (offset:·0x3c3):·predefined_ops.h |
| 101 | ··46» (udata)» 7» (line_strp)» (offset:·0x21 | 101 | ··46» (udata)» 7» (line_strp)» (offset:·0x21c):·alloc_traits.h |
| 102 | ··47» (udata)» 2» (line_strp)» (offset:·0x3d | 102 | ··47» (udata)» 2» (line_strp)» (offset:·0x3d4):·stl_iterator.h |
| 103 | ··48» (udata)» 7» (line_strp)» (offset:·0x3e | 103 | ··48» (udata)» 7» (line_strp)» (offset:·0x3e3):·concurrence.h |
| 104 | ··49» (udata)» 8» (line_strp)» (offset:·0x3 | 104 | ··49» (udata)» 8» (line_strp)» (offset:·0x3f1):·stddef.h |
| 105 | ··50» (udata)» 8» (line_strp)» (offset:·0x3f | 105 | ··50» (udata)» 8» (line_strp)» (offset:·0x3fa):·stdarg.h |
| 106 | ··51» (udata)» 9» (line_strp)» (offset:·0x4b | 106 | ··51» (udata)» 9» (line_strp)» (offset:·0x4bc):·wchar.h |
| 107 | ··52» (udata)» 10» (line_strp)» (offset:·0x40 | 107 | ··52» (udata)» 10» (line_strp)» (offset:·0x403):·wint_t.h |
| 108 | ··53» (udata)» 10» (line_strp)» (offset:·0x40 | 108 | ··53» (udata)» 10» (line_strp)» (offset:·0x40c):·__mbstate_t.h |
| 109 | ··54» (udata)» 10» (line_strp)» (offset:·0x40 | 109 | ··54» (udata)» 10» (line_strp)» (offset:·0x40e):·mbstate_t.h |
| 110 | ··55» (udata)» 10» (line_strp)» (offset:·0x41 | 110 | ··55» (udata)» 10» (line_strp)» (offset:·0x41a):·__FILE.h |
| 111 | ··56» (udata)» 10» (line_strp)» (offset:·0x42 | 111 | ··56» (udata)» 10» (line_strp)» (offset:·0x423):·struct_FILE.h |
| 112 | ··57» (udata)» 10» (line_strp)» (offset:·0x41 | 112 | ··57» (udata)» 10» (line_strp)» (offset:·0x41c):·FILE.h |
| 113 | ··58» (udata)» 11» (line_strp)» (offset:·0x4 | 113 | ··58» (udata)» 11» (line_strp)» (offset:·0x431):·wchar2.h |
| 114 | ··59» (udata)» 10» (line_strp)» (offset:·0x43 | 114 | ··59» (udata)» 10» (line_strp)» (offset:·0x43a):·struct_tm.h |
| 115 | ··60» (udata)» 9» (line_strp)» (offset:·0x44 | 115 | ··60» (udata)» 9» (line_strp)» (offset:·0x446):·locale.h |
| 116 | ··61» (udata)» 11» (line_strp)» (offset:·0x129 | 116 | ··61» (udata)» 11» (line_strp)» (offset:·0x1299):·types.h |
| 117 | ··62» (udata)» 9» (line_strp)» (offset:·0x44 | 117 | ··62» (udata)» 9» (line_strp)» (offset:·0x44f):·stdlib.h |
| 118 | ··63» (udata)» 10» (line_strp)» (offset:·0x45 | 118 | ··63» (udata)» 10» (line_strp)» (offset:·0x458):·clock_t.h |
| 119 | ··64» (udata)» 10» (line_strp)» (offset:·0x4 | 119 | ··64» (udata)» 10» (line_strp)» (offset:·0x462):·time_t.h |
| 120 | ··65» (udata)» 11» (line_strp)» (offset:·0x46 | 120 | ··65» (udata)» 11» (line_strp)» (offset:·0x46b):·stdint-intn.h |
| 121 | ··66» (udata)» 11» (line_strp)» (offset:·0x47 | 121 | ··66» (udata)» 11» (line_strp)» (offset:·0x479):·stdlib-float.h |
| 122 | ··67» (udata)» 11» (line_strp)» (offset:·0x48 | 122 | ··67» (udata)» 11» (line_strp)» (offset:·0x488):·stdlib-bsearch.h |
| 123 | ··68» (udata)» 11» (line_strp)» (offset:·0x44 | 123 | ··68» (udata)» 11» (line_strp)» (offset:·0x44f):·stdlib.h |
| 124 | ··69» (udata)» 10» (line_strp)» (offset:·0x49 | 124 | ··69» (udata)» 10» (line_strp)» (offset:·0x499):·__fpos_t.h |
| 125 | ··70» (udata)» 9» (line_strp)» (offset:·0x4a | 125 | ··70» (udata)» 9» (line_strp)» (offset:·0x4a4):·stdio.h |
| 126 | ··71» (udata)» 11» (line_strp)» (offset:·0x4a | 126 | ··71» (udata)» 11» (line_strp)» (offset:·0x4ac):·stdio2.h |
| 127 | ··72» (udata)» 11» (line_strp)» (offset:·0x4a | 127 | ··72» (udata)» 11» (line_strp)» (offset:·0x4a4):·stdio.h |
| 128 | ··73» (udata)» 11» (line_strp)» (offset:·0x4b | 128 | ··73» (udata)» 11» (line_strp)» (offset:·0x4b5):·wctype-wchar.h |
| 129 | ··74» (udata)» 9» (line_strp)» (offset:·0x4c | 129 | ··74» (udata)» 9» (line_strp)» (offset:·0x4c4):·wctype.h |
| 130 | ··75» (udata)» 3» (line_strp)» (offset:·0x44 | 130 | ··75» (udata)» 3» (line_strp)» (offset:·0x44f):·stdlib.h |
| 131 | ··76» (udata)» 9» (line_strp)» (offset:·0x4c | 131 | ··76» (udata)» 9» (line_strp)» (offset:·0x4cd):·math.h |
| 132 | ··77» (udata)» 9» (line_strp)» (offset:·0x4d | 132 | ··77» (udata)» 9» (line_strp)» (offset:·0x4d4):·time.h |
| 133 | ··78» (udata)» 12» (line_strp)» (offset:·0x4d | 133 | ··78» (udata)» 12» (line_strp)» (offset:·0x4db):·ncl.h |
| 134 | ··79» (udata)» 9» (line_strp)» (offset:·0x1f | 134 | ··79» (udata)» 9» (line_strp)» (offset:·0x1f4):·string.h |
| 135 | ··80» (udata)» 13» (line_strp)» (offset:·0x27 | 135 | ··80» (udata)» 13» (line_strp)» (offset:·0x2747):·tools.h |
| 136 | ··81» (udata)» 14» (line_strp)» (offset:·0x4 | 136 | ··81» (udata)» 14» (line_strp)» (offset:·0x4e1):·split.h |
| 137 | ··82» (udata)» 15» (line_strp)» (offset:·0x5 | 137 | ··82» (udata)» 15» (line_strp)» (offset:·0x580):·node.h |
| 138 | ··83» (udata)» 14» (line_strp)» (offset:·0x4e | 138 | ··83» (udata)» 14» (line_strp)» (offset:·0x4e9):·hashsplitset.h |
| 139 | ··84» (udata)» 15» (line_strp)» (offset:·0x4f | 139 | ··84» (udata)» 15» (line_strp)» (offset:·0x4f8):·mtree.h |
| 140 | ··85» (udata)» 16» (line_strp)» (offset:·0x21 | 140 | ··85» (udata)» 16» (line_strp)» (offset:·0x21e5):·parser.h |
| 141 | ··86» (udata)» 16» (line_strp)» (offset:·0x | 141 | ··86» (udata)» 16» (line_strp)» (offset:·0x500):·exceptions.h |
| 142 | ··87» (udata)» 17» (line_strp)» (offset:·0x50 | 142 | ··87» (udata)» 17» (line_strp)» (offset:·0x50d):·bool_type.h |
| 143 | ··88» (udata)» 18» (line_strp)» (offset:·0x51 | 143 | ··88» (udata)» 18» (line_strp)» (offset:·0x519):·statespace.h |
| 144 | ··89» (udata)» 19» (line_strp)» (offset:·0x52 | 144 | ··89» (udata)» 19» (line_strp)» (offset:·0x526):·pattern.h |
| 145 | ··90» (udata)» 19» (line_strp)» (offset:·0x1d | 145 | ··90» (udata)» 19» (line_strp)» (offset:·0x1d30):·alignment.h |
| 146 | ··91» (udata)» 13» (line_strp)» (offset:·0x5 | 146 | ··91» (udata)» 13» (line_strp)» (offset:·0x530):·checkpoint.h |
| 147 | ··92» (udata)» 20» (line_strp)» (offset:·0x53 | 147 | ··92» (udata)» 20» (line_strp)» (offset:·0x53d):·modelsubst.h |
| 148 | ··93» (udata)» 20» (line_strp)» (offset:·0x54 | 148 | ··93» (udata)» 20» (line_strp)» (offset:·0x54a):·rateheterogeneity.h |
| 149 | ··94» (udata)» 21» (line_strp)» (offset:·0x55 | 149 | ··94» (udata)» 21» (line_strp)» (offset:·0x55e):·modelsblock.h |
| Max diff block lines reached; 235966789/235980960 bytes (99.99%) of diff not shown. | |||
| Offset 2, 8820 lines modified | Offset 2, 8820 lines modified | ||
| 2 | ··Compilation·Unit·@·offset·0: | 2 | ··Compilation·Unit·@·offset·0: |
| 3 | ···Length:········0x14·(32-bit) | 3 | ···Length:········0x14·(32-bit) |
| 4 | ···Version:·······5 | 4 | ···Version:·······5 |
| 5 | ···Unit·Type:·····DW_UT_partial·(3) | 5 | ···Unit·Type:·····DW_UT_partial·(3) |
| 6 | ···Abbrev·Offset:·0x112b | 6 | ···Abbrev·Offset:·0x112b |
| 7 | ···Pointer·Size:··4 | 7 | ···Pointer·Size:··4 |
| 8 | ·<0><c>:·Abbrev·Number:·9 | 8 | ·<0><c>:·Abbrev·Number:·92·(DW_TAG_partial_unit) |
| 9 | ·<1><d>:·Abbrev·Number:· | 9 | ·<1><d>:·Abbrev·Number:·41·(DW_TAG_imported_unit) |
| 10 | ····<e>···DW_AT_import······:·(GNU_ref_alt)·<0xc> | 10 | ····<e>···DW_AT_import······:·(GNU_ref_alt)·<0xc> |
| 11 | ·<1><12>:·Abbrev·Number:· | 11 | ·<1><12>:·Abbrev·Number:·41·(DW_TAG_imported_unit) |
| 12 | ····<13>···DW_AT_import······:·(GNU_ref_alt)·<0x14555b6> | 12 | ····<13>···DW_AT_import······:·(GNU_ref_alt)·<0x14555b6> |
| 13 | ·<1><17>:·Abbrev·Number:·0 | 13 | ·<1><17>:·Abbrev·Number:·0 |
| 14 | ··Compilation·Unit·@·offset·0x18: | 14 | ··Compilation·Unit·@·offset·0x18: |
| 15 | ···Length:········0x14·(32-bit) | 15 | ···Length:········0x14·(32-bit) |
| 16 | ···Version:·······5 | 16 | ···Version:·······5 |
| 17 | ···Unit·Type:·····DW_UT_partial·(3) | 17 | ···Unit·Type:·····DW_UT_partial·(3) |
| 18 | ···Abbrev·Offset:·0x112b | 18 | ···Abbrev·Offset:·0x112b |
| 19 | ···Pointer·Size:··4 | 19 | ···Pointer·Size:··4 |
| 20 | ·<0><24>:·Abbrev·Number:·9 | 20 | ·<0><24>:·Abbrev·Number:·92·(DW_TAG_partial_unit) |
| 21 | ·<1><25>:·Abbrev·Number:· | 21 | ·<1><25>:·Abbrev·Number:·41·(DW_TAG_imported_unit) |
| 22 | ····<26>···DW_AT_import······:·(GNU_ref_alt)·<0xc> | 22 | ····<26>···DW_AT_import······:·(GNU_ref_alt)·<0xc> |
| 23 | ·<1><2a>:·Abbrev·Number:· | 23 | ·<1><2a>:·Abbrev·Number:·41·(DW_TAG_imported_unit) |
| 24 | ····<2b>···DW_AT_import······:·(GNU_ref_alt)·<0x14533a8> | 24 | ····<2b>···DW_AT_import······:·(GNU_ref_alt)·<0x14533a8> |
| 25 | ·<1><2f>:·Abbrev·Number:·0 | 25 | ·<1><2f>:·Abbrev·Number:·0 |
| 26 | ··Compilation·Unit·@·offset·0x30: | 26 | ··Compilation·Unit·@·offset·0x30: |
| 27 | ···Length:········0x14·(32-bit) | 27 | ···Length:········0x14·(32-bit) |
| 28 | ···Version:·······5 | 28 | ···Version:·······5 |
| 29 | ···Unit·Type:·····DW_UT_partial·(3) | 29 | ···Unit·Type:·····DW_UT_partial·(3) |
| 30 | ···Abbrev·Offset:·0x112b | 30 | ···Abbrev·Offset:·0x112b |
| 31 | ···Pointer·Size:··4 | 31 | ···Pointer·Size:··4 |
| 32 | ·<0><3c>:·Abbrev·Number:·9 | 32 | ·<0><3c>:·Abbrev·Number:·92·(DW_TAG_partial_unit) |
| 33 | ·<1><3d>:·Abbrev·Number:· | 33 | ·<1><3d>:·Abbrev·Number:·41·(DW_TAG_imported_unit) |
| 34 | ····<3e>···DW_AT_import······:·(GNU_ref_alt)·<0xc> | 34 | ····<3e>···DW_AT_import······:·(GNU_ref_alt)·<0xc> |
| 35 | ·<1><42>:·Abbrev·Number:· | 35 | ·<1><42>:·Abbrev·Number:·41·(DW_TAG_imported_unit) |
| 36 | ····<43>···DW_AT_import······:·(GNU_ref_alt)·<0x145564c> | 36 | ····<43>···DW_AT_import······:·(GNU_ref_alt)·<0x145564c> |
| 37 | ·<1><47>:·Abbrev·Number:·0 | 37 | ·<1><47>:·Abbrev·Number:·0 |
| 38 | ··Compilation·Unit·@·offset·0x48: | 38 | ··Compilation·Unit·@·offset·0x48: |
| 39 | ···Length:········0x14·(32-bit) | 39 | ···Length:········0x14·(32-bit) |
| 40 | ···Version:·······5 | 40 | ···Version:·······5 |
| 41 | ···Unit·Type:·····DW_UT_partial·(3) | 41 | ···Unit·Type:·····DW_UT_partial·(3) |
| 42 | ···Abbrev·Offset:·0x112b | 42 | ···Abbrev·Offset:·0x112b |
| 43 | ···Pointer·Size:··4 | 43 | ···Pointer·Size:··4 |
| 44 | ·<0><54>:·Abbrev·Number:·9 | 44 | ·<0><54>:·Abbrev·Number:·92·(DW_TAG_partial_unit) |
| 45 | ·<1><55>:·Abbrev·Number:· | 45 | ·<1><55>:·Abbrev·Number:·41·(DW_TAG_imported_unit) |
| 46 | ····<56>···DW_AT_import······:·(GNU_ref_alt)·<0xc> | 46 | ····<56>···DW_AT_import······:·(GNU_ref_alt)·<0xc> |
| 47 | ·<1><5a>:·Abbrev·Number:· | 47 | ·<1><5a>:·Abbrev·Number:·41·(DW_TAG_imported_unit) |
| 48 | ····<5b>···DW_AT_import······:·(GNU_ref_alt)·<0xb38e3> | 48 | ····<5b>···DW_AT_import······:·(GNU_ref_alt)·<0xb38e3> |
| 49 | ·<1><5f>:·Abbrev·Number:·0 | 49 | ·<1><5f>:·Abbrev·Number:·0 |
| 50 | ··Compilation·Unit·@·offset·0x60: | 50 | ··Compilation·Unit·@·offset·0x60: |
| 51 | ···Length:········0x14·(32-bit) | 51 | ···Length:········0x14·(32-bit) |
| 52 | ···Version:·······5 | 52 | ···Version:·······5 |
| 53 | ···Unit·Type:·····DW_UT_partial·(3) | 53 | ···Unit·Type:·····DW_UT_partial·(3) |
| 54 | ···Abbrev·Offset:·0x112b | 54 | ···Abbrev·Offset:·0x112b |
| 55 | ···Pointer·Size:··4 | 55 | ···Pointer·Size:··4 |
| 56 | ·<0><6c>:·Abbrev·Number:·9 | 56 | ·<0><6c>:·Abbrev·Number:·92·(DW_TAG_partial_unit) |
| 57 | ·<1><6d>:·Abbrev·Number:· | 57 | ·<1><6d>:·Abbrev·Number:·41·(DW_TAG_imported_unit) |
| 58 | ····<6e>···DW_AT_import······:·(GNU_ref_alt)·<0x14555b6> | 58 | ····<6e>···DW_AT_import······:·(GNU_ref_alt)·<0x14555b6> |
| 59 | ·<1><72>:·Abbrev·Number:· | 59 | ·<1><72>:·Abbrev·Number:·41·(DW_TAG_imported_unit) |
| 60 | ····<73>···DW_AT_import······:·(GNU_ref_alt)·<0x14533a8> | 60 | ····<73>···DW_AT_import······:·(GNU_ref_alt)·<0x14533a8> |
| 61 | ·<1><77>:·Abbrev·Number:·0 | 61 | ·<1><77>:·Abbrev·Number:·0 |
| 62 | ··Compilation·Unit·@·offset·0x78: | 62 | ··Compilation·Unit·@·offset·0x78: |
| 63 | ···Length:········0x14·(32-bit) | 63 | ···Length:········0x14·(32-bit) |
| 64 | ···Version:·······5 | 64 | ···Version:·······5 |
| 65 | ···Unit·Type:·····DW_UT_partial·(3) | 65 | ···Unit·Type:·····DW_UT_partial·(3) |
| 66 | ···Abbrev·Offset:·0x112b | 66 | ···Abbrev·Offset:·0x112b |
| 67 | ···Pointer·Size:··4 | 67 | ···Pointer·Size:··4 |
| 68 | ·<0><84>:·Abbrev·Number:·9 | 68 | ·<0><84>:·Abbrev·Number:·92·(DW_TAG_partial_unit) |
| 69 | ·<1><85>:·Abbrev·Number:· | 69 | ·<1><85>:·Abbrev·Number:·41·(DW_TAG_imported_unit) |
| 70 | ····<86>···DW_AT_import······:·(GNU_ref_alt)·<0x14533a8> | 70 | ····<86>···DW_AT_import······:·(GNU_ref_alt)·<0x14533a8> |
| 71 | ·<1><8a>:·Abbrev·Number:· | 71 | ·<1><8a>:·Abbrev·Number:·41·(DW_TAG_imported_unit) |
| 72 | ····<8b>···DW_AT_import······:·(GNU_ref_alt)·<0x1453358> | 72 | ····<8b>···DW_AT_import······:·(GNU_ref_alt)·<0x1453358> |
| 73 | ·<1><8f>:·Abbrev·Number:·0 | 73 | ·<1><8f>:·Abbrev·Number:·0 |
| 74 | ··Compilation·Unit·@·offset·0x90: | 74 | ··Compilation·Unit·@·offset·0x90: |
| 75 | ···Length:········0x14·(32-bit) | 75 | ···Length:········0x14·(32-bit) |
| 76 | ···Version:·······5 | 76 | ···Version:·······5 |
| 77 | ···Unit·Type:·····DW_UT_partial·(3) | 77 | ···Unit·Type:·····DW_UT_partial·(3) |
| 78 | ···Abbrev·Offset:·0x112b | 78 | ···Abbrev·Offset:·0x112b |
| 79 | ···Pointer·Size:··4 | 79 | ···Pointer·Size:··4 |
| 80 | ·<0><9c>:·Abbrev·Number:·9 | 80 | ·<0><9c>:·Abbrev·Number:·92·(DW_TAG_partial_unit) |
| 81 | ·<1><9d>:·Abbrev·Number:· | 81 | ·<1><9d>:·Abbrev·Number:·41·(DW_TAG_imported_unit) |
| 82 | ····<9e>···DW_AT_import······:·(GNU_ref_alt)·<0x14533a8> | 82 | ····<9e>···DW_AT_import······:·(GNU_ref_alt)·<0x14533a8> |
| 83 | ·<1><a2>:·Abbrev·Number:· | 83 | ·<1><a2>:·Abbrev·Number:·41·(DW_TAG_imported_unit) |
| 84 | ····<a3>···DW_AT_import······:·(GNU_ref_alt)·<0x1453338> | 84 | ····<a3>···DW_AT_import······:·(GNU_ref_alt)·<0x1453338> |
| 85 | ·<1><a7>:·Abbrev·Number:·0 | 85 | ·<1><a7>:·Abbrev·Number:·0 |
| 86 | ··Compilation·Unit·@·offset·0xa8: | 86 | ··Compilation·Unit·@·offset·0xa8: |
| 87 | ···Length:········0x14·(32-bit) | 87 | ···Length:········0x14·(32-bit) |
| 88 | ···Version:·······5 | 88 | ···Version:·······5 |
| 89 | ···Unit·Type:·····DW_UT_partial·(3) | 89 | ···Unit·Type:·····DW_UT_partial·(3) |
| 90 | ···Abbrev·Offset:·0x112b | 90 | ···Abbrev·Offset:·0x112b |
| 91 | ···Pointer·Size:··4 | 91 | ···Pointer·Size:··4 |
| 92 | ·<0><b4>:·Abbrev·Number:·9 | 92 | ·<0><b4>:·Abbrev·Number:·92·(DW_TAG_partial_unit) |
| 93 | ·<1><b5>:·Abbrev·Number:· | 93 | ·<1><b5>:·Abbrev·Number:·41·(DW_TAG_imported_unit) |
| 94 | ····<b6>···DW_AT_import······:·(GNU_ref_alt)·<0x1453358> | 94 | ····<b6>···DW_AT_import······:·(GNU_ref_alt)·<0x1453358> |
| 95 | ·<1><ba>:·Abbrev·Number:· | 95 | ·<1><ba>:·Abbrev·Number:·41·(DW_TAG_imported_unit) |
| 96 | ····<bb>···DW_AT_import······:·(GNU_ref_alt)·<0x1453338> | 96 | ····<bb>···DW_AT_import······:·(GNU_ref_alt)·<0x1453338> |
| 97 | ·<1><bf>:·Abbrev·Number:·0 | 97 | ·<1><bf>:·Abbrev·Number:·0 |
| 98 | ··Compilation·Unit·@·offset·0xc0: | 98 | ··Compilation·Unit·@·offset·0xc0: |
| 99 | ···Length:········0x14·(32-bit) | 99 | ···Length:········0x14·(32-bit) |
| 100 | ···Version:·······5 | 100 | ···Version:·······5 |
| 101 | ···Unit·Type:·····DW_UT_partial·(3) | 101 | ···Unit·Type:·····DW_UT_partial·(3) |
| 102 | ···Abbrev·Offset:·0x112b | 102 | ···Abbrev·Offset:·0x112b |
| 103 | ···Pointer·Size:··4 | 103 | ···Pointer·Size:··4 |
| 104 | ·<0><cc>:·Abbrev·Number:·9 | 104 | ·<0><cc>:·Abbrev·Number:·92·(DW_TAG_partial_unit) |
| 105 | ·<1><cd>:·Abbrev·Number:· | 105 | ·<1><cd>:·Abbrev·Number:·41·(DW_TAG_imported_unit) |
| 106 | ····<ce>···DW_AT_import······:·(GNU_ref_alt)·<0x1453358> | 106 | ····<ce>···DW_AT_import······:·(GNU_ref_alt)·<0x1453358> |
| 107 | ·<1><d2>:·Abbrev·Number:· | 107 | ·<1><d2>:·Abbrev·Number:·41·(DW_TAG_imported_unit) |
| 108 | ····<d3>···DW_AT_import······:·(GNU_ref_alt)·<0xb38e3> | 108 | ····<d3>···DW_AT_import······:·(GNU_ref_alt)·<0xb38e3> |
| 109 | ·<1><d7>:·Abbrev·Number:·0 | 109 | ·<1><d7>:·Abbrev·Number:·0 |
| 110 | ··Compilation·Unit·@·offset·0xd8: | 110 | ··Compilation·Unit·@·offset·0xd8: |
| 111 | ···Length:········0x1e·(32-bit) | 111 | ···Length:········0x1e·(32-bit) |
| 112 | ···Version:·······5 | 112 | ···Version:·······5 |
| 113 | ···Unit·Type:·····DW_UT_partial·(3) | 113 | ···Unit·Type:·····DW_UT_partial·(3) |
| 114 | ···Abbrev·Offset:·0x112b | 114 | ···Abbrev·Offset:·0x112b |
| 115 | ···Pointer·Size:··4 | 115 | ···Pointer·Size:··4 |
| 116 | ·<0><e4>:·Abbrev·Number:·9 | 116 | ·<0><e4>:·Abbrev·Number:·92·(DW_TAG_partial_unit) |
| 117 | ·<1><e5>:·Abbrev·Number:· | 117 | ·<1><e5>:·Abbrev·Number:·41·(DW_TAG_imported_unit) |
| 118 | ····<e6>···DW_AT_import······:·(GNU_ref_alt)·<0x1453338> | 118 | ····<e6>···DW_AT_import······:·(GNU_ref_alt)·<0x1453338> |
| 119 | ·<1><ea>:·Abbrev·Number:· | 119 | ·<1><ea>:·Abbrev·Number:·41·(DW_TAG_imported_unit) |
| 120 | ····<eb>···DW_AT_import······:·(GNU_ref_alt)·<0xb38e3> | 120 | ····<eb>···DW_AT_import······:·(GNU_ref_alt)·<0xb38e3> |
| 121 | ·<1><ef>:·Abbrev·Number:·8·(DW_TAG_imported_unit) | 121 | ·<1><ef>:·Abbrev·Number:·8·(DW_TAG_imported_unit) |
| 122 | ····<f0>···DW_AT_import······:·(ref_addr)·<0xc>» [Abbrev·Number:·9 | 122 | ····<f0>···DW_AT_import······:·(ref_addr)·<0xc>» [Abbrev·Number:·92·(DW_TAG_partial_unit)] |
| 123 | ·<1><f4>:·Abbrev·Number:·8·(DW_TAG_imported_unit) | 123 | ·<1><f4>:·Abbrev·Number:·8·(DW_TAG_imported_unit) |
| 124 | ····<f5>···DW_AT_import······:·(ref_addr)·<0x84>» [Abbrev·Number:·9 | 124 | ····<f5>···DW_AT_import······:·(ref_addr)·<0x84>» [Abbrev·Number:·92·(DW_TAG_partial_unit)] |
| 125 | ·<1><f9>:·Abbrev·Number:·0 | 125 | ·<1><f9>:·Abbrev·Number:·0 |
| 126 | ··Compilation·Unit·@·offset·0xfa: | 126 | ··Compilation·Unit·@·offset·0xfa: |
| 127 | ···Length:········0x14·(32-bit) | 127 | ···Length:········0x14·(32-bit) |
| Max diff block lines reached; 462027344/462034157 bytes (100.00%) of diff not shown. | |||
| Offset 441, 480 lines modified | Offset 441, 480 lines modified | ||
| 441 | ····DW_AT_name·········DW_FORM_string | 441 | ····DW_AT_name·········DW_FORM_string |
| 442 | ····DW_AT_decl_file····DW_FORM_implicit_const:·8 | 442 | ····DW_AT_decl_file····DW_FORM_implicit_const:·8 |
| 443 | ····DW_AT_decl_line····DW_FORM_data2 | 443 | ····DW_AT_decl_line····DW_FORM_data2 |
| 444 | ····DW_AT_decl_column··DW_FORM_data1 | 444 | ····DW_AT_decl_column··DW_FORM_data1 |
| 445 | ····DW_AT_type·········DW_FORM_ref_udata | 445 | ····DW_AT_type·········DW_FORM_ref_udata |
| 446 | ····DW_AT_data_member_location·DW_FORM_data1 | 446 | ····DW_AT_data_member_location·DW_FORM_data1 |
| 447 | ····DW_AT·value:·0·····DW_FORM·value:·0 | 447 | ····DW_AT·value:·0·····DW_FORM·value:·0 |
| 448 | ···63······DW_TAG_imported_unit····[no·children] | ||
| 449 | ····DW_AT_import·······DW_FORM_ref_addr | ||
| 450 | ····DW_AT·value:·0·····DW_FORM·value:·0 | ||
| 451 | ···64······DW_TAG_imported_unit····[no·children] | ||
| 452 | ····DW_AT_import·······DW_FORM_GNU_ref_alt | ||
| 453 | ····DW_AT·value:·0·····DW_FORM·value:·0 | ||
| 454 | ···6 | 448 | ···63······DW_TAG_subprogram····[has·children] |
| 455 | ····DW_AT_abstract_origin·DW_FORM_ref1 | ||
| 456 | ····DW_AT_linkage_name·DW_FORM_GNU_strp_alt | ||
| 457 | ····DW_AT_object_pointer·DW_FORM_ref1 | ||
| 458 | ····DW_AT_sibling······DW_FORM_ref1 | ||
| 459 | ····DW_AT·value:·0·····DW_FORM·value:·0 | ||
| 460 | ···66······DW_TAG_subprogram····[has·children] | ||
| 461 | ····DW_AT_external·····DW_FORM_flag_present | ||
| 462 | ····DW_AT_name·········DW_FORM_GNU_strp_alt | ||
| 463 | ····DW_AT_decl_file····DW_FORM_data1 | ||
| 464 | ····DW_AT_decl_line····DW_FORM_data1 | ||
| 465 | ····DW_AT_decl_column··DW_FORM_data1 | ||
| 466 | ····DW_AT_linkage_name·DW_FORM_GNU_strp_alt | ||
| 467 | ····DW_AT_accessibility·DW_FORM_data1 | ||
| 468 | ····DW_AT_declaration··DW_FORM_flag_present | ||
| 469 | ····DW_AT_object_pointer·DW_FORM_ref1 | ||
| 470 | ····DW_AT_inline·······DW_FORM_data1 | ||
| 471 | ····DW_AT·value:·0·····DW_FORM·value:·0 | ||
| 472 | ···67······DW_TAG_subprogram····[has·children] | ||
| 473 | ····DW_AT_abstract_origin·DW_FORM_ref1 | ||
| 474 | ····DW_AT_linkage_name·DW_FORM_GNU_strp_alt | ||
| 475 | ····DW_AT_object_pointer·DW_FORM_ref1 | ||
| 476 | ····DW_AT·value:·0·····DW_FORM·value:·0 | ||
| 477 | ···68······DW_TAG_formal_parameter····[no·children] | ||
| 478 | ····DW_AT_type·········DW_FORM_GNU_ref_alt | ||
| 479 | ····DW_AT_artificial···DW_FORM_flag_present | ||
| 480 | ····DW_AT·value:·0·····DW_FORM·value:·0 | ||
| 481 | ···69······DW_TAG_formal_parameter····[no·children] | ||
| 482 | ····DW_AT_name·········DW_FORM_GNU_strp_alt | ||
| 483 | ····DW_AT_type·········DW_FORM_ref1 | ||
| 484 | ····DW_AT_artificial···DW_FORM_flag_present | ||
| 485 | ····DW_AT·value:·0·····DW_FORM·value:·0 | ||
| 486 | ···70······DW_TAG_subprogram····[has·children] | ||
| 487 | ····DW_AT_external·····DW_FORM_flag_present | ||
| 488 | ····DW_AT_name·········DW_FORM_GNU_strp_alt | ||
| 489 | ····DW_AT_decl_file····DW_FORM_data1 | ||
| 490 | ····DW_AT_decl_line····DW_FORM_data1 | ||
| 491 | ····DW_AT_decl_column··DW_FORM_data1 | ||
| 492 | ····DW_AT_linkage_name·DW_FORM_GNU_strp_alt | ||
| 493 | ····DW_AT_virtuality···DW_FORM_data1 | ||
| 494 | ····DW_AT_containing_type·DW_FORM_ref1 | ||
| 495 | ····DW_AT_accessibility·DW_FORM_data1 | ||
| 496 | ····DW_AT_declaration··DW_FORM_flag_present | ||
| 497 | ····DW_AT_object_pointer·DW_FORM_ref1 | ||
| 498 | ····DW_AT_inline·······DW_FORM_data1 | ||
| 499 | ····DW_AT_sibling······DW_FORM_ref1 | ||
| 500 | ····DW_AT·value:·0·····DW_FORM·value:·0 | ||
| 501 | ···71······DW_TAG_pointer_type····[no·children] | ||
| 502 | ····DW_AT_byte_size····DW_FORM_implicit_const:·4 | ||
| 503 | ····DW_AT_type·········DW_FORM_ref1 | ||
| 504 | ····DW_AT·value:·0·····DW_FORM·value:·0 | ||
| 505 | ···72······DW_TAG_class_type····[has·children] | ||
| 506 | ····DW_AT_name·········DW_FORM_GNU_strp_alt | ||
| 507 | ····DW_AT_declaration··DW_FORM_flag_present | ||
| 508 | ····DW_AT_sibling······DW_FORM_ref1 | ||
| 509 | ····DW_AT·value:·0·····DW_FORM·value:·0 | ||
| 510 | ···73······DW_TAG_formal_parameter····[no·children] | ||
| 511 | ····DW_AT_type·········DW_FORM_ref1 | ||
| 512 | ····DW_AT_artificial···DW_FORM_flag_present | ||
| 513 | ····DW_AT·value:·0·····DW_FORM·value:·0 | ||
| 514 | ···74······DW_TAG_subprogram····[has·children] | ||
| 515 | ····DW_AT_specification·DW_FORM_ref_addr | 449 | ····DW_AT_specification·DW_FORM_ref_addr |
| 516 | ····DW_AT_inline·······DW_FORM_data1 | 450 | ····DW_AT_inline·······DW_FORM_data1 |
| 517 | ····DW_AT_sibling······DW_FORM_ref_udata | 451 | ····DW_AT_sibling······DW_FORM_ref_udata |
| 518 | ····DW_AT·value:·0·····DW_FORM·value:·0 | 452 | ····DW_AT·value:·0·····DW_FORM·value:·0 |
| 453 | ···64······DW_TAG_imported_unit····[no·children] | ||
| 454 | ····DW_AT_import·······DW_FORM_ref_addr | ||
| 455 | ····DW_AT·value:·0·····DW_FORM·value:·0 | ||
| 519 | ··· | 456 | ···65······DW_TAG_subprogram····[has·children] |
| 520 | ····DW_AT_specification·DW_FORM_ref_addr | 457 | ····DW_AT_specification·DW_FORM_ref_addr |
| 521 | ····DW_AT_inline·······DW_FORM_data1 | 458 | ····DW_AT_inline·······DW_FORM_data1 |
| 522 | ····DW_AT·value:·0·····DW_FORM·value:·0 | 459 | ····DW_AT·value:·0·····DW_FORM·value:·0 |
| 523 | ··· | 460 | ···66······DW_TAG_formal_parameter····[no·children] |
| 524 | ····DW_AT_name·········DW_FORM_GNU_strp_alt | 461 | ····DW_AT_name·········DW_FORM_GNU_strp_alt |
| 525 | ····DW_AT_decl_file····DW_FORM_data1 | 462 | ····DW_AT_decl_file····DW_FORM_data1 |
| 526 | ····DW_AT_decl_line····DW_FORM_data1 | 463 | ····DW_AT_decl_line····DW_FORM_data1 |
| 527 | ····DW_AT_decl_column··DW_FORM_data1 | 464 | ····DW_AT_decl_column··DW_FORM_data1 |
| 528 | ····DW_AT_type·········DW_FORM_ref_addr | 465 | ····DW_AT_type·········DW_FORM_ref_addr |
| 529 | ····DW_AT·value:·0·····DW_FORM·value:·0 | 466 | ····DW_AT·value:·0·····DW_FORM·value:·0 |
| 530 | ··· | 467 | ···67······DW_TAG_subprogram····[has·children] |
| 531 | ····DW_AT_external·····DW_FORM_flag_present | 468 | ····DW_AT_external·····DW_FORM_flag_present |
| 532 | ····DW_AT_name·········DW_FORM_GNU_strp_alt | 469 | ····DW_AT_name·········DW_FORM_GNU_strp_alt |
| 533 | ····DW_AT_decl_file····DW_FORM_data1 | 470 | ····DW_AT_decl_file····DW_FORM_data1 |
| 534 | ····DW_AT_decl_line····DW_FORM_data1 | 471 | ····DW_AT_decl_line····DW_FORM_data1 |
| 535 | ····DW_AT_decl_column··DW_FORM_data1 | 472 | ····DW_AT_decl_column··DW_FORM_data1 |
| 536 | ····DW_AT_linkage_name·DW_FORM_GNU_strp_alt | 473 | ····DW_AT_linkage_name·DW_FORM_GNU_strp_alt |
| 537 | ····DW_AT_type·········DW_FORM_GNU_ref_alt | 474 | ····DW_AT_type·········DW_FORM_GNU_ref_alt |
| 538 | ····DW_AT_declaration··DW_FORM_flag_present | 475 | ····DW_AT_declaration··DW_FORM_flag_present |
| 539 | ····DW_AT_sibling······DW_FORM_ref_udata | 476 | ····DW_AT_sibling······DW_FORM_ref_udata |
| 540 | ····DW_AT·value:·0·····DW_FORM·value:·0 | 477 | ····DW_AT·value:·0·····DW_FORM·value:·0 |
| 541 | ··· | 478 | ···68······DW_TAG_subprogram····[has·children] |
| 542 | ····DW_AT_external·····DW_FORM_flag_present | 479 | ····DW_AT_external·····DW_FORM_flag_present |
| 543 | ····DW_AT_name·········DW_FORM_GNU_strp_alt | 480 | ····DW_AT_name·········DW_FORM_GNU_strp_alt |
| 544 | ····DW_AT_decl_file····DW_FORM_data1 | 481 | ····DW_AT_decl_file····DW_FORM_data1 |
| 545 | ····DW_AT_decl_line····DW_FORM_data1 | 482 | ····DW_AT_decl_line····DW_FORM_data1 |
| 546 | ····DW_AT_decl_column··DW_FORM_data1 | 483 | ····DW_AT_decl_column··DW_FORM_data1 |
| 547 | ····DW_AT_linkage_name·DW_FORM_GNU_strp_alt | 484 | ····DW_AT_linkage_name·DW_FORM_GNU_strp_alt |
| 548 | ····DW_AT_type·········DW_FORM_ref_addr | 485 | ····DW_AT_type·········DW_FORM_ref_addr |
| 549 | ····DW_AT_declaration··DW_FORM_flag_present | 486 | ····DW_AT_declaration··DW_FORM_flag_present |
| 550 | ····DW_AT·value:·0·····DW_FORM·value:·0 | 487 | ····DW_AT·value:·0·····DW_FORM·value:·0 |
| 551 | ··· | 488 | ···69······DW_TAG_formal_parameter····[no·children] |
| 552 | ····DW_AT_name·········DW_FORM_string | 489 | ····DW_AT_name·········DW_FORM_string |
| 553 | ····DW_AT_decl_file····DW_FORM_data1 | 490 | ····DW_AT_decl_file····DW_FORM_data1 |
| 554 | ····DW_AT_decl_line····DW_FORM_data1 | 491 | ····DW_AT_decl_line····DW_FORM_data1 |
| 555 | ····DW_AT_decl_column··DW_FORM_data1 | 492 | ····DW_AT_decl_column··DW_FORM_data1 |
| 556 | ····DW_AT_type·········DW_FORM_ref_addr | 493 | ····DW_AT_type·········DW_FORM_ref_addr |
| 557 | ····DW_AT·value:·0·····DW_FORM·value:·0 | 494 | ····DW_AT·value:·0·····DW_FORM·value:·0 |
| 558 | ··· | 495 | ···70······DW_TAG_subprogram····[has·children] |
| 559 | ····DW_AT_specification·DW_FORM_ref_udata | 496 | ····DW_AT_specification·DW_FORM_ref_udata |
| 560 | ····DW_AT_inline·······DW_FORM_data1 | 497 | ····DW_AT_inline·······DW_FORM_data1 |
| 561 | ····DW_AT_sibling······DW_FORM_ref_udata | 498 | ····DW_AT_sibling······DW_FORM_ref_udata |
| 562 | ····DW_AT·value:·0·····DW_FORM·value:·0 | 499 | ····DW_AT·value:·0·····DW_FORM·value:·0 |
| 563 | ··· | 500 | ···71······DW_TAG_subprogram····[has·children] |
| 564 | ····DW_AT_external·····DW_FORM_flag_present | 501 | ····DW_AT_external·····DW_FORM_flag_present |
| Max diff block lines reached; 1184967/1190832 bytes (99.51%) of diff not shown. | |||
| Offset 1, 5198 lines modified | Offset 1, 5198 lines modified | ||
| 1 | Contents·of·the·.debug_aranges·section: | 1 | Contents·of·the·.debug_aranges·section: |
| 2 | ··Length:···················44 | 2 | ··Length:···················44 |
| 3 | ··Version:··················2 | 3 | ··Version:··················2 |
| 4 | ··Offset·into·.debug_info:··0x22a | 4 | ··Offset·into·.debug_info:··0x22a5e |
| 5 | ··Pointer·Size:·············4 | 5 | ··Pointer·Size:·············4 |
| 6 | ··Segment·Size:·············0 | 6 | ··Segment·Size:·············0 |
| 7 | ····Address····Length | 7 | ····Address····Length |
| 8 | ····000e7 | 8 | ····000e7f60·000003f7 |
| 9 | ····00081280·000000b6 | 9 | ····00081280·000000b6 |
| 10 | ····000e8 | 10 | ····000e8360·00000006 |
| 11 | ····00000000·00000000 | 11 | ····00000000·00000000 |
| 12 | ··Length:···················1164 | 12 | ··Length:···················1164 |
| 13 | ··Version:··················2 | 13 | ··Version:··················2 |
| 14 | ··Offset·into·.debug_info:··0x24b | 14 | ··Offset·into·.debug_info:··0x24b36 |
| 15 | ··Pointer·Size:·············4 | 15 | ··Pointer·Size:·············4 |
| 16 | ··Segment·Size:·············0 | 16 | ··Segment·Size:·············0 |
| 17 | ····Address····Length | 17 | ····Address····Length |
| 18 | ····000e83 | 18 | ····000e8380·00037e03 |
| 19 | ····0008170a·00008ad9 | 19 | ····0008170a·00008ad9 |
| 20 | ····000e8 | 20 | ····000e8360·00000006 |
| 21 | ····001201 | 21 | ····00120190·00000003 |
| 22 | ····001201 | 22 | ····001201a0·0000000b |
| 23 | ····001201 | 23 | ····001201b0·00000001 |
| 24 | ····001201 | 24 | ····001201c0·00000001 |
| 25 | ····001201 | 25 | ····001201d0·00000001 |
| 26 | ····001201 | 26 | ····001201e0·00000001 |
| 27 | ····001201 | 27 | ····001201f0·000000ab |
| 28 | ····001202 | 28 | ····001202a0·00000026 |
| 29 | ····001202 | 29 | ····001202d0·00000030 |
| 30 | ····00120 | 30 | ····00120300·00000067 |
| 31 | ····001203d0·00000026 | ||
| 32 | ····00120400·00000030 | ||
| 33 | ····001204 | 31 | ····00120450·00000026 |
| 34 | ····001204 | 32 | ····00120480·00000030 |
| 33 | ····001204b0·00000026 | ||
| 34 | ····001204e0·00000030 | ||
| 35 | ····00120 | 35 | ····00120540·00000234 |
| 36 | ····001207 | 36 | ····00120780·000008b3 |
| 37 | ····00081336·000000f1 | 37 | ····00081336·000000f1 |
| 38 | ····00081428·000000f1 | 38 | ····00081428·000000f1 |
| 39 | ····0008151a·000000f7 | 39 | ····0008151a·000000f7 |
| 40 | ····00081612·000000f7 | 40 | ····00081612·000000f7 |
| 41 | ····0012 | 41 | ····00121040·00000013 |
| 42 | ····0012 | 42 | ····00121060·00000073 |
| 43 | ····001210 | 43 | ····001210e0·0000006e |
| 44 | ····00120 | 44 | ····00120370·0000006c |
| 45 | ····001203 | 45 | ····001203e0·00000064 |
| 46 | ····00121 | 46 | ····00121150·00000078 |
| 47 | ····001211 | 47 | ····001211d0·0000005d |
| 48 | ····001212 | 48 | ····001212f0·0000005d |
| 49 | ····00121390·00000063 | ||
| 50 | ····00121400·00000065 | ||
| 51 | ····001214 | 49 | ····00121410·00000063 |
| 52 | ····00121550·00000065 | ||
| 53 | ····001211b0·0000005b | ||
| 54 | ····00121210·0000005d | ||
| 55 | ····001212d0·0000005b | ||
| 56 | ····00121330·0000005d | ||
| 57 | ····001214 | 50 | ····00121480·00000065 |
| 51 | ····00121560·00000063 | ||
| 58 | ····001215 | 52 | ····001215d0·00000065 |
| 59 | ····00121 | 53 | ····00121230·0000005b |
| 60 | ····00121780·0000006c | ||
| 61 | ····001218d0·00000063 | ||
| 62 | ····00121 | 54 | ····00121290·0000005d |
| 55 | ····00121350·0000005b | ||
| 63 | ····00121 | 56 | ····001213b0·0000005d |
| 64 | ····00121710·0000006f | ||
| 65 | ····001217f0·0000006d | ||
| 66 | ····00121860·0000006f | ||
| 67 | ····00121 | 57 | ····001214f0·00000065 |
| 58 | ····00121640·00000065 | ||
| 68 | ····00121 | 59 | ····001216b0·0000006c |
| 60 | ····00121800·0000006c | ||
| 61 | ····00121950·00000063 | ||
| 62 | ····00121aa0·00000063 | ||
| 63 | ····00121720·0000006d | ||
| 64 | ····00121790·0000006f | ||
| 65 | ····00121870·0000006d | ||
| 66 | ····001218e0·0000006f | ||
| 69 | ····00121 | 67 | ····001219c0·00000065 |
| 68 | ····00121a30·00000067 | ||
| 69 | ····00121b10·00000065 | ||
| 70 | ····00121b | 70 | ····00121b80·00000067 |
| 71 | ····00121b | 71 | ····00121bf0·00000121 |
| 72 | ····00121 | 72 | ····00121d20·00000129 |
| 73 | ····00121 | 73 | ····00121e50·000000f4 |
| 74 | ····00121 | 74 | ····00121f50·00000114 |
| 75 | ····0012 | 75 | ····00122070·0000009f |
| 76 | ····0008a1e3·00000036 | 76 | ····0008a1e3·00000036 |
| 77 | ····00122 | 77 | ····00122110·00000046 |
| 78 | ····00122 | 78 | ····00122160·000003e1 |
| 79 | ····00122 | 79 | ····00122550·000002df |
| 80 | ····00122 | 80 | ····00122830·000000bc |
| 81 | ····001228 | 81 | ····001228f0·000000a0 |
| 82 | ····001229 | 82 | ····00122990·000001a2 |
| 83 | ····00122 | 83 | ····00122b40·00000005 |
| 84 | ····00122 | 84 | ····00122b50·00000082 |
| 85 | ····00122b | 85 | ····00122be0·000000e9 |
| 86 | ····00122c | 86 | ····00122cd0·00000053 |
| 87 | ····00122 | 87 | ····00122d30·0000005a |
| 88 | ····00122d | 88 | ····00122d90·0000004e |
| 89 | ····00122d | 89 | ····00122de0·00000088 |
| 90 | ····00122 | 90 | ····00122e70·00000057 |
| 91 | ····00122e | 91 | ····00122ed0·00000205 |
| 92 | ····001230 | 92 | ····001230e0·00000173 |
| 93 | ····00123 | 93 | ····00123260·0000008f |
| 94 | ····001232 | 94 | ····001232f0·000000c3 |
| 95 | ····001233 | 95 | ····001233c0·0000002c |
| 96 | ····001233 | 96 | ····001233f0·0000002c |
| 97 | ····00123 | 97 | ····00123420·0000002c |
| 98 | ····00123 | 98 | ····00123450·0000038e |
| 99 | ····001237 | 99 | ····001237e0·00000029 |
| 100 | ····00123 | 100 | ····00123810·0000010a |
| 101 | ····001238a0·00000117 | ||
| 102 | ····001239 | 101 | ····00123920·00000117 |
| 103 | ····00123a | 102 | ····00123a40·00000117 |
| 103 | ····00123b60·00000111 | ||
| 104 | ····00123c | 104 | ····00123c80·00000111 |
| 105 | ····00123d | 105 | ····00123da0·000003af |
| 106 | ····001241 | 106 | ····00124180·00000216 |
| 107 | ····001243 | 107 | ····001243a0·000000f0 |
| 108 | ····001244 | 108 | ····001244c0·000003e5 |
| 109 | ····001248 | 109 | ····001248b0·000000f0 |
| Max diff block lines reached; 203786/209062 bytes (97.48%) of diff not shown. | |||
| Offset 10, 503 lines modified | Offset 10, 503 lines modified | ||
| 10 | ····Offset···Begin············End··············Expression | 10 | ····Offset···Begin············End··············Expression |
| 11 | ····0000000c·v0000000·v0000000·location·view·pair | 11 | ····0000000c·v0000000·v0000000·location·view·pair |
| 12 | ····0000000e·v0000000·v0000000·location·view·pair | 12 | ····0000000e·v0000000·v0000000·location·view·pair |
| 13 | ····00000010·v0000000·v0000000·location·view·pair | 13 | ····00000010·v0000000·v0000000·location·view·pair |
| 14 | ····00000012·v0000000·v0000000·views·at·0000000c·for: | 14 | ····00000012·v0000000·v0000000·views·at·0000000c·for: |
| 15 | ·············000e7 | 15 | ·············000e7f60·000e8357·(DW_OP_fbreg:·0) |
| 16 | ····0000001c·00081280·(base·address) | 16 | ····0000001c·00081280·(base·address) |
| 17 | ····00000021·v0000000·v0000000·views·at·0000000e·for: | 17 | ····00000021·v0000000·v0000000·views·at·0000000e·for: |
| 18 | ·············00081280·000812e9·(DW_OP_fbreg:·0) | 18 | ·············00081280·000812e9·(DW_OP_fbreg:·0) |
| 19 | ····00000027·v0000000·v0000000·views·at·00000010·for: | 19 | ····00000027·v0000000·v0000000·views·at·00000010·for: |
| 20 | ·············000812ee·00081336·(DW_OP_fbreg:·0) | 20 | ·············000812ee·00081336·(DW_OP_fbreg:·0) |
| 21 | ····0000002e·<End·of·list> | 21 | ····0000002e·<End·of·list> |
| 22 | ····0000002f·v0000000·v0000000·location·view·pair | 22 | ····0000002f·v0000000·v0000000·location·view·pair |
| 23 | ····00000031·v0000000·v0000000·location·view·pair | 23 | ····00000031·v0000000·v0000000·location·view·pair |
| 24 | ····00000033·v0000000·v0000000·location·view·pair | 24 | ····00000033·v0000000·v0000000·location·view·pair |
| 25 | ····00000035·v0000000·v0000000·location·view·pair | 25 | ····00000035·v0000000·v0000000·location·view·pair |
| 26 | ····00000037·v0000000·v0000000·location·view·pair | 26 | ····00000037·v0000000·v0000000·location·view·pair |
| 27 | ····00000039·000e80 | 27 | ····00000039·000e8096·(base·address) |
| 28 | ····0000003e·v0000000·v0000000·views·at·0000002f·for: | 28 | ····0000003e·v0000000·v0000000·views·at·0000002f·for: |
| 29 | ·············000e80 | 29 | ·············000e8096·000e809c·(DW_OP_reg0·(eax)) |
| 30 | ····00000043·v0000000·v0000000·views·at·00000031·for: | 30 | ····00000043·v0000000·v0000000·views·at·00000031·for: |
| 31 | ·············000e80 | 31 | ·············000e809c·000e8148·(DW_OP_fbreg:·-4016) |
| 32 | ····0000004b·v0000000·v0000000·views·at·00000033·for: | 32 | ····0000004b·v0000000·v0000000·views·at·00000033·for: |
| 33 | ·············000e8 | 33 | ·············000e8233·000e8293·(DW_OP_fbreg:·-4016) |
| 34 | ····00000054·000812ee·(base·address) | 34 | ····00000054·000812ee·(base·address) |
| 35 | ····00000059·v0000000·v0000000·views·at·00000035·for: | 35 | ····00000059·v0000000·v0000000·views·at·00000035·for: |
| 36 | ·············000812ee·000812ff·(DW_OP_fbreg:·-4016) | 36 | ·············000812ee·000812ff·(DW_OP_fbreg:·-4016) |
| 37 | ····00000060·v0000000·v0000000·views·at·00000037·for: | 37 | ····00000060·v0000000·v0000000·views·at·00000037·for: |
| 38 | ·············00081327·0008132c·(DW_OP_fbreg:·-4016) | 38 | ·············00081327·0008132c·(DW_OP_fbreg:·-4016) |
| 39 | ····00000067·<End·of·list> | 39 | ····00000067·<End·of·list> |
| 40 | ····00000068·v0000000·v0000000·location·view·pair | 40 | ····00000068·v0000000·v0000000·location·view·pair |
| 41 | ····0000006a·v0000000·v0000000·views·at·00000068·for: | 41 | ····0000006a·v0000000·v0000000·views·at·00000068·for: |
| 42 | ·············000e8 | 42 | ·············000e8111·000e8117·(DW_OP_fbreg:·-4020) |
| 43 | ····00000074·<End·of·list> | 43 | ····00000074·<End·of·list> |
| 44 | ····00000075·v0000003·v0000002·location·view·pair | 44 | ····00000075·v0000003·v0000002·location·view·pair |
| 45 | ····00000077·v0000003·v0000002·views·at·00000075·for: | 45 | ····00000077·v0000003·v0000002·views·at·00000075·for: |
| 46 | ·············000e7f | 46 | ·············000e7faa·000e7fc1·(DW_OP_implicit_pointer:·<0x24b30>·0) |
| 47 | ····00000084·<End·of·list> | 47 | ····00000084·<End·of·list> |
| 48 | ····00000085·v0000000·v0000003·location·view·pair | 48 | ····00000085·v0000000·v0000003·location·view·pair |
| 49 | ····00000087·v0000000·v0000003·views·at·00000085·for: | 49 | ····00000087·v0000000·v0000003·views·at·00000085·for: |
| 50 | ·············000e7f | 50 | ·············000e7faa·000e7faa·(DW_OP_implicit_pointer:·<0x24b30>·0) |
| 51 | ····00000094·<End·of·list> | 51 | ····00000094·<End·of·list> |
| 52 | ····00000095·v0000003·v0000002·location·view·pair | 52 | ····00000095·v0000003·v0000002·location·view·pair |
| 53 | ····00000097·v0000003·v0000002·views·at·00000095·for: | 53 | ····00000097·v0000003·v0000002·views·at·00000095·for: |
| 54 | ·············000e7f | 54 | ·············000e7faa·000e7fc1·(DW_OP_reg7·(edi)) |
| 55 | ····0000009f·<End·of·list> | 55 | ····0000009f·<End·of·list> |
| 56 | ····000000a0·v0000005·v0000002·location·view·pair | 56 | ····000000a0·v0000005·v0000002·location·view·pair |
| 57 | ····000000a2·v0000005·v0000002·views·at·000000a0·for: | 57 | ····000000a2·v0000005·v0000002·views·at·000000a0·for: |
| 58 | ·············000e7f | 58 | ·············000e7faa·000e7fc1·(DW_OP_lit0;·DW_OP_stack_value) |
| 59 | ····000000ab·<End·of·list> | 59 | ····000000ab·<End·of·list> |
| 60 | ····000000ac·v0000005·v0000006·location·view·pair | 60 | ····000000ac·v0000005·v0000006·location·view·pair |
| 61 | ····000000ae·v0000005·v0000006·views·at·000000ac·for: | 61 | ····000000ae·v0000005·v0000006·views·at·000000ac·for: |
| 62 | ·············000e7f | 62 | ·············000e7faa·000e7faa·(DW_OP_implicit_pointer:·<0x24234>·0) |
| 63 | ····000000bb·<End·of·list> | 63 | ····000000bb·<End·of·list> |
| 64 | ····000000bc·v0000005·v0000006·location·view·pair | 64 | ····000000bc·v0000005·v0000006·location·view·pair |
| 65 | ····000000be·v0000005·v0000006·views·at·000000bc·for: | 65 | ····000000be·v0000005·v0000006·views·at·000000bc·for: |
| 66 | ·············000e7f | 66 | ·············000e7faa·000e7faa·(DW_OP_reg7·(edi)) |
| 67 | ····000000c6·<End·of·list> | 67 | ····000000c6·<End·of·list> |
| 68 | ····000000c7·v0000006·v0000000·location·view·pair | 68 | ····000000c7·v0000006·v0000000·location·view·pair |
| 69 | ····000000c9·v0000006·v0000000·views·at·000000c7·for: | 69 | ····000000c9·v0000006·v0000000·views·at·000000c7·for: |
| 70 | ·············000e7f | 70 | ·············000e7faa·000e7fc1·(DW_OP_reg7·(edi)) |
| 71 | ····000000d1·<End·of·list> | 71 | ····000000d1·<End·of·list> |
| 72 | ····000000d2·v0000006·v0000000·location·view·pair | 72 | ····000000d2·v0000006·v0000000·location·view·pair |
| 73 | ····000000d4·v0000006·v0000000·views·at·000000d2·for: | 73 | ····000000d4·v0000006·v0000000·views·at·000000d2·for: |
| 74 | ·············000e7f | 74 | ·············000e7faa·000e7fc1·(DW_OP_lit0;·DW_OP_stack_value) |
| 75 | ····000000dd·<End·of·list> | 75 | ····000000dd·<End·of·list> |
| 76 | ····000000de·v0000008·v0000000·location·view·pair | 76 | ····000000de·v0000008·v0000000·location·view·pair |
| 77 | ····000000e0·v0000008·v0000000·views·at·000000de·for: | 77 | ····000000e0·v0000008·v0000000·views·at·000000de·for: |
| 78 | ·············000e7f | 78 | ·············000e7faa·000e7fba·(DW_OP_reg7·(edi)) |
| 79 | ····000000e8·<End·of·list> | 79 | ····000000e8·<End·of·list> |
| 80 | ····000000e9·v0000008·v0000000·location·view·pair | 80 | ····000000e9·v0000008·v0000000·location·view·pair |
| 81 | ····000000eb·v0000008·v0000000·views·at·000000e9·for: | 81 | ····000000eb·v0000008·v0000000·views·at·000000e9·for: |
| 82 | ·············000e7f | 82 | ·············000e7faa·000e7fba·(DW_OP_lit0;·DW_OP_stack_value) |
| 83 | ····000000f4·<End·of·list> | 83 | ····000000f4·<End·of·list> |
| 84 | ····000000f5·v0000000·v0000000·location·view·pair | 84 | ····000000f5·v0000000·v0000000·location·view·pair |
| 85 | ····000000f7·v0000000·v0000000·views·at·000000f5·for: | 85 | ····000000f7·v0000000·v0000000·views·at·000000f5·for: |
| 86 | ·············000e7f | 86 | ·············000e7fba·000e7fc1·(DW_OP_breg7·(edi):·0) |
| 87 | ····00000100·<End·of·list> | 87 | ····00000100·<End·of·list> |
| 88 | ····00000101·v0000000·v0000002·location·view·pair | 88 | ····00000101·v0000000·v0000002·location·view·pair |
| 89 | ····00000103·v0000000·v0000002·views·at·00000101·for: | 89 | ····00000103·v0000000·v0000002·views·at·00000101·for: |
| 90 | ·············000e7f | 90 | ·············000e7fc1·000e7fc1·(DW_OP_implicit_pointer:·<0x24234>·0) |
| 91 | ····00000110·<End·of·list> | 91 | ····00000110·<End·of·list> |
| 92 | ····00000111·v0000000·v0000004·location·view·pair | 92 | ····00000111·v0000000·v0000004·location·view·pair |
| 93 | ····00000113·v0000000·v0000004·views·at·00000111·for: | 93 | ····00000113·v0000000·v0000004·views·at·00000111·for: |
| 94 | ·············000e7f | 94 | ·············000e7fea·000e7ffa·(DW_OP_reg7·(edi)) |
| 95 | ····0000011b·<End·of·list> | 95 | ····0000011b·<End·of·list> |
| 96 | ····0000011c·v0000001·v0000000·location·view·pair | 96 | ····0000011c·v0000001·v0000000·location·view·pair |
| 97 | ····0000011e·v0000001·v0000000·views·at·0000011c·for: | 97 | ····0000011e·v0000001·v0000000·views·at·0000011c·for: |
| 98 | ·············000e7f | 98 | ·············000e7fea·000e7ffa·(DW_OP_reg7·(edi)) |
| 99 | ····00000126·<End·of·list> | 99 | ····00000126·<End·of·list> |
| 100 | ····00000127·v0000002·v0000000·location·view·pair | 100 | ····00000127·v0000002·v0000000·location·view·pair |
| Max diff block lines reached; 215525850/215531563 bytes (100.00%) of diff not shown. | |||
| Offset 1, 5198 lines modified | Offset 1, 5198 lines modified | ||
| 1 | Contents·of·the·.debug_aranges·section: | 1 | Contents·of·the·.debug_aranges·section: |
| 2 | ··Length:···················44 | 2 | ··Length:···················44 |
| 3 | ··Version:··················2 | 3 | ··Version:··················2 |
| 4 | ··Offset·into·.debug_info:··0x22a | 4 | ··Offset·into·.debug_info:··0x22a5e |
| 5 | ··Pointer·Size:·············4 | 5 | ··Pointer·Size:·············4 |
| 6 | ··Segment·Size:·············0 | 6 | ··Segment·Size:·············0 |
| 7 | ····Address····Length | 7 | ····Address····Length |
| 8 | ····000e7 | 8 | ····000e7f60·000003f7 |
| 9 | ····00081280·000000b6 | 9 | ····00081280·000000b6 |
| 10 | ····000e8 | 10 | ····000e8360·00000006 |
| 11 | ····00000000·00000000 | 11 | ····00000000·00000000 |
| 12 | ··Length:···················1164 | 12 | ··Length:···················1164 |
| 13 | ··Version:··················2 | 13 | ··Version:··················2 |
| 14 | ··Offset·into·.debug_info:··0x24b | 14 | ··Offset·into·.debug_info:··0x24b36 |
| 15 | ··Pointer·Size:·············4 | 15 | ··Pointer·Size:·············4 |
| 16 | ··Segment·Size:·············0 | 16 | ··Segment·Size:·············0 |
| 17 | ····Address····Length | 17 | ····Address····Length |
| 18 | ····000e83 | 18 | ····000e8380·00037e03 |
| 19 | ····0008170a·00008ad9 | 19 | ····0008170a·00008ad9 |
| 20 | ····000e8 | 20 | ····000e8360·00000006 |
| 21 | ····001201 | 21 | ····00120190·00000003 |
| 22 | ····001201 | 22 | ····001201a0·0000000b |
| 23 | ····001201 | 23 | ····001201b0·00000001 |
| 24 | ····001201 | 24 | ····001201c0·00000001 |
| 25 | ····001201 | 25 | ····001201d0·00000001 |
| 26 | ····001201 | 26 | ····001201e0·00000001 |
| 27 | ····001201 | 27 | ····001201f0·000000ab |
| 28 | ····001202 | 28 | ····001202a0·00000026 |
| 29 | ····001202 | 29 | ····001202d0·00000030 |
| 30 | ····00120 | 30 | ····00120300·00000067 |
| 31 | ····001203d0·00000026 | ||
| 32 | ····00120400·00000030 | ||
| 33 | ····001204 | 31 | ····00120450·00000026 |
| 34 | ····001204 | 32 | ····00120480·00000030 |
| 33 | ····001204b0·00000026 | ||
| 34 | ····001204e0·00000030 | ||
| 35 | ····00120 | 35 | ····00120540·00000234 |
| 36 | ····001207 | 36 | ····00120780·000008b3 |
| 37 | ····00081336·000000f1 | 37 | ····00081336·000000f1 |
| 38 | ····00081428·000000f1 | 38 | ····00081428·000000f1 |
| 39 | ····0008151a·000000f7 | 39 | ····0008151a·000000f7 |
| 40 | ····00081612·000000f7 | 40 | ····00081612·000000f7 |
| 41 | ····0012 | 41 | ····00121040·00000013 |
| 42 | ····0012 | 42 | ····00121060·00000073 |
| 43 | ····001210 | 43 | ····001210e0·0000006e |
| 44 | ····00120 | 44 | ····00120370·0000006c |
| 45 | ····001203 | 45 | ····001203e0·00000064 |
| 46 | ····00121 | 46 | ····00121150·00000078 |
| 47 | ····001211 | 47 | ····001211d0·0000005d |
| 48 | ····001212 | 48 | ····001212f0·0000005d |
| 49 | ····00121390·00000063 | ||
| 50 | ····00121400·00000065 | ||
| 51 | ····001214 | 49 | ····00121410·00000063 |
| 52 | ····00121550·00000065 | ||
| 53 | ····001211b0·0000005b | ||
| 54 | ····00121210·0000005d | ||
| 55 | ····001212d0·0000005b | ||
| 56 | ····00121330·0000005d | ||
| 57 | ····001214 | 50 | ····00121480·00000065 |
| 51 | ····00121560·00000063 | ||
| 58 | ····001215 | 52 | ····001215d0·00000065 |
| 59 | ····00121 | 53 | ····00121230·0000005b |
| 60 | ····00121780·0000006c | ||
| 61 | ····001218d0·00000063 | ||
| 62 | ····00121 | 54 | ····00121290·0000005d |
| 55 | ····00121350·0000005b | ||
| 63 | ····00121 | 56 | ····001213b0·0000005d |
| 64 | ····00121710·0000006f | ||
| 65 | ····001217f0·0000006d | ||
| 66 | ····00121860·0000006f | ||
| 67 | ····00121 | 57 | ····001214f0·00000065 |
| 58 | ····00121640·00000065 | ||
| 68 | ····00121 | 59 | ····001216b0·0000006c |
| 60 | ····00121800·0000006c | ||
| 61 | ····00121950·00000063 | ||
| 62 | ····00121aa0·00000063 | ||
| 63 | ····00121720·0000006d | ||
| 64 | ····00121790·0000006f | ||
| 65 | ····00121870·0000006d | ||
| 66 | ····001218e0·0000006f | ||
| 69 | ····00121 | 67 | ····001219c0·00000065 |
| 68 | ····00121a30·00000067 | ||
| 69 | ····00121b10·00000065 | ||
| 70 | ····00121b | 70 | ····00121b80·00000067 |
| 71 | ····00121b | 71 | ····00121bf0·00000121 |
| 72 | ····00121 | 72 | ····00121d20·00000129 |
| 73 | ····00121 | 73 | ····00121e50·000000f4 |
| 74 | ····00121 | 74 | ····00121f50·00000114 |
| 75 | ····0012 | 75 | ····00122070·0000009f |
| 76 | ····0008a1e3·00000036 | 76 | ····0008a1e3·00000036 |
| 77 | ····00122 | 77 | ····00122110·00000046 |
| 78 | ····00122 | 78 | ····00122160·000003e1 |
| 79 | ····00122 | 79 | ····00122550·000002df |
| 80 | ····00122 | 80 | ····00122830·000000bc |
| 81 | ····001228 | 81 | ····001228f0·000000a0 |
| 82 | ····001229 | 82 | ····00122990·000001a2 |
| 83 | ····00122 | 83 | ····00122b40·00000005 |
| 84 | ····00122 | 84 | ····00122b50·00000082 |
| 85 | ····00122b | 85 | ····00122be0·000000e9 |
| 86 | ····00122c | 86 | ····00122cd0·00000053 |
| 87 | ····00122 | 87 | ····00122d30·0000005a |
| 88 | ····00122d | 88 | ····00122d90·0000004e |
| 89 | ····00122d | 89 | ····00122de0·00000088 |
| 90 | ····00122 | 90 | ····00122e70·00000057 |
| 91 | ····00122e | 91 | ····00122ed0·00000205 |
| 92 | ····001230 | 92 | ····001230e0·00000173 |
| 93 | ····00123 | 93 | ····00123260·0000008f |
| 94 | ····001232 | 94 | ····001232f0·000000c3 |
| 95 | ····001233 | 95 | ····001233c0·0000002c |
| 96 | ····001233 | 96 | ····001233f0·0000002c |
| 97 | ····00123 | 97 | ····00123420·0000002c |
| 98 | ····00123 | 98 | ····00123450·0000038e |
| 99 | ····001237 | 99 | ····001237e0·00000029 |
| 100 | ····00123 | 100 | ····00123810·0000010a |
| 101 | ····001238a0·00000117 | ||
| 102 | ····001239 | 101 | ····00123920·00000117 |
| 103 | ····00123a | 102 | ····00123a40·00000117 |
| 103 | ····00123b60·00000111 | ||
| 104 | ····00123c | 104 | ····00123c80·00000111 |
| 105 | ····00123d | 105 | ····00123da0·000003af |
| 106 | ····001241 | 106 | ····00124180·00000216 |
| 107 | ····001243 | 107 | ····001243a0·000000f0 |
| 108 | ····001244 | 108 | ····001244c0·000003e5 |
| 109 | ····001248 | 109 | ····001248b0·000000f0 |
| Max diff block lines reached; 203786/209062 bytes (97.48%) of diff not shown. | |||
| Offset 1, 4946 lines modified | Offset 1, 5100 lines modified | ||
| 1 | GCC:·(Debian·14.2.0-8)·14.2.0 | 1 | GCC:·(Debian·14.2.0-8)·14.2.0 |
| 2 | >h:h9dWo | ||
| 3 | 2d]0d]3d | ||
| 4 | }MG}Mg|# | ||
| 5 | "+zFh"+z | ||
| 6 | 0~wF6[@\ | ||
| 7 | |m#NAIET | ||
| 8 | OhTLvH>8* | ||
| 9 | +z» 5=L!_)_ | ||
| 10 | 5;<].f<t | ||
| 11 | L>&iS#fF | ||
| 12 | 2s_xuf·I( | ||
| 13 | L5*4"?[J | ||
| 14 | b<·dvPax` | ||
| 15 | T>aEwsX' | ||
| 16 | B_+S5Q5F | ||
| 17 | 4EfO2lS% | ||
| 18 | aBm[5`B3-L | ||
| 19 | iGJ^{}`$[ | ||
| 20 | ^%RdKy8b} | ||
| 21 | x5dxZ>}Q | ||
| 22 | TB@%X+M/ | ||
| 23 | jW8}?t%a | ||
| 24 | Z0\Wo;s<0 | ||
| 25 | E&c):l<F | ||
| 26 | PI*)W0%m | ||
| 27 | WD,<`&};t | ||
| 28 | >XULFP5=& | ||
| 29 | h\]8;@s5 | ||
| 30 | JIW9n-OX | ||
| 31 | vePk;y"@ | ||
| 32 | &GuiwJ{? | ||
| 33 | !UAY(eN+ | ||
| 34 | j&7)-64t | ||
| 35 | SRZ[W25)* | ||
| 36 | z~>,F4_@?3U | ||
| 37 | cS,mv\+v# | ||
| 38 | sdN7vh}D | ||
| 39 | t%t/ID9W | ||
| 40 | H]rb3!R: | ||
| 41 | Zq/vV+.U | ||
| 42 | WGhWXLqX | ||
| 43 | )e7d;U)? | ||
| 44 | @|J(jInA | ||
| 45 | SU..u|tgrq | ||
| 46 | M» ~» Bw0] | ||
| 47 | \`r·EQ].s] | ||
| 48 | l)KIM$=+ | ||
| 49 | $\lv8Flq8&mq | ||
| 50 | +05lOn(} | ||
| 51 | Us.@Vt0C» / | ||
| 52 | xW>hBH{% | ||
| 53 | Dq``/.[/3 | ||
| 54 | !1&G>lM@bj | ||
| 55 | ]J]gm-Wf | ||
| 56 | F~7kCj*o | ||
| 57 | ·%~,NHFI | ||
| 58 | .Bbn39pgpe | ||
| 59 | (lN`9·N*lfv\ | ||
| 60 | LkD>1%pdA | ||
| 61 | ZCq,zWH9 | ||
| 62 | l+U$oNc- | ||
| 63 | !;TBc8we | ||
| 64 | {"G» /m()8LY | ||
| 65 | u#uf#uNg | ||
| 66 | mnz56[» 8 | ||
| 67 | `"rpq"S\ | ||
| 68 | fH4j"wPj | ||
| 69 | B<vk_qs| | ||
| 70 | !d$mu/2t | ||
| 71 | 7(}Gy}_Q | ||
| 72 | 0Oo'kJZv | ||
| 73 | ep^\AC:M· | ||
| 74 | mgYs~R%T | ||
| 75 | SCNeEReC | ||
| 76 | YX&^^@xVX | ||
| 77 | eG"r>m!( | ||
| 78 | :x^V`-&Z | ||
| 79 | » kc-v|J$ | ||
| 80 | y/n6CXO7 | ||
| 81 | {!_3E[#O | ||
| 82 | *m$_4}_VN | ||
| 83 | D:B.nUr~ | ||
| 84 | pPY&» (:n | ||
| 85 | !/1._*C" | ||
| 86 | v>@JN3YW | ||
| 87 | hy4kyt:- | ||
| 88 | @-8/J*7?.Z | ||
| 89 | ZIBaY+I. | ||
| 90 | (Cz+OK^E | ||
| 91 | (rVf9+k9Og(9 | ||
| 92 | K7gzvXea | ||
| 93 | af1yVdBr | ||
| 94 | 5*c4gDa~ | ||
| 95 | bP(2\-QENHt | ||
| 96 | j|6@X;\] | ||
| 97 | t+mseDwfD | ||
| 98 | ?d0it8;Z | ||
| 99 | K7b1i{W) | ||
| 100 | %R4G`'co | ||
| 101 | ?A0SKW+} | ||
| 102 | KTc1J?eE | ||
| 103 | AVqe<S3@_ | ||
| 104 | `F#y@6BX | ||
| 105 | Ep.#2LMf=_ | ||
| 106 | ^.V=RoPz | ||
| 107 | h[VwB$6) | ||
| 108 | h#76<[b<E | ||
| 109 | MeVgm]PwD | ||
| 110 | n"7o~*z7 | ||
| 111 | VKO[rk-' | ||
| 112 | RfbVCH])31 | ||
| 113 | ~zPF{3·L=( | ||
| 114 | v('mL75g | ||
| 115 | 2q-D[3ZL | ||
| 116 | +Jxf@cz3mxRQ[ | ||
| 117 | 9*?AaP~TH | ||
| 118 | pTV}<*M8* | ||
| 119 | n?X$3Jt| | ||
| 120 | 0/Q4f0kLn | ||
| 121 | ZTGutfG~ | ||
| 122 | \DqQ^R#9 | ||
| 123 | #fZLzc8*s | ||
| 124 | Pl)nGh}Ui)R | ||
| 125 | ;+t=+tfA | ||
| 126 | 3dKnf/m. | ||
| 127 | 8,g[$n`q | ||
| Max diff block lines reached; 101136/107224 bytes (94.32%) of diff not shown. | |||
| Offset 355, 15 lines modified | Offset 355, 15 lines modified | ||
| 355 | » ... | 355 | » ... |
| 356 | 0008a9d2·<PhyloTree::computeLogLDiffVariance(double*,·double*)·[clone·.cold]>: | 356 | 0008a9d2·<PhyloTree::computeLogLDiffVariance(double*,·double*)·[clone·.cold]>: |
| 357 | » ... | 357 | » ... |
| 358 | 0008aa1e·<PhyloTree::computeLogLDiffVariance(PhyloTree*,·double*)·[clone·.cold]>: | 358 | 0008aa1e·<PhyloTree::computeLogLDiffVariance(PhyloTree*,·double*)·[clone·.cold]>: |
| 359 | PhyloTree::computeLogLDiffVariance(PhyloTree*,·double*)·[clone·.cold]: | 359 | PhyloTree::computeLogLDiffVariance(PhyloTree*,·double*)·[clone·.cold]: |
| 360 | ./build. | 360 | ./build.serial/tree/./tree/phylotree.cpp:1760·(discriminator·2) |
| 361 | » add····%al,(%eax) | 361 | » add····%al,(%eax) |
| 362 | » add····%al,(%eax) | 362 | » add····%al,(%eax) |
| 363 | » ... | 363 | » ... |
| 364 | 0008aa24·<PhyloTree::getUnmarkedNodes(std::vector<PhyloNode*,·std::allocator<PhyloNode*>·>&,·PhyloNode*,·PhyloNode*)·[clone·.cold]>: | 364 | 0008aa24·<PhyloTree::getUnmarkedNodes(std::vector<PhyloNode*,·std::allocator<PhyloNode*>·>&,·PhyloNode*,·PhyloNode*)·[clone·.cold]>: |
| 365 | » ... | 365 | » ... |
| Offset 596, 15 lines modified | Offset 596, 15 lines modified | ||
| 596 | » ... | 596 | » ... |
| 597 | 0008d33a·<PhyloTree::computeAncestralLikelihood(PhyloNeighbor*,·PhyloNode*,·int*)·[clone·.cold]>: | 597 | 0008d33a·<PhyloTree::computeAncestralLikelihood(PhyloNeighbor*,·PhyloNode*,·int*)·[clone·.cold]>: |
| 598 | » ... | 598 | » ... |
| 599 | 0008d374·<PhyloTree::computeJointAncestralSequences(int*)·[clone·.cold]>: | 599 | 0008d374·<PhyloTree::computeJointAncestralSequences(int*)·[clone·.cold]>: |
| 600 | PhyloTree::computeJointAncestralSequences(int*)·[clone·.cold]: | 600 | PhyloTree::computeJointAncestralSequences(int*)·[clone·.cold]: |
| 601 | ./build. | 601 | ./build.serial/tree/./tree/phylotreesse.cpp:1772·(discriminator·2) |
| 602 | » add····%al,(%eax) | 602 | » add····%al,(%eax) |
| 603 | » add····%al,(%eax) | 603 | » add····%al,(%eax) |
| 604 | » ... | 604 | » ... |
| 605 | 0008d37a·<ParsTree::findMstScore(int)·[clone·.cold]>: | 605 | 0008d37a·<ParsTree::findMstScore(int)·[clone·.cold]>: |
| 606 | » ... | 606 | » ... |
| Offset 696, 15 lines modified | Offset 696, 15 lines modified | ||
| 696 | /usr/include/c++/14/bits/basic_ios.h:50 | 696 | /usr/include/c++/14/bits/basic_ios.h:50 |
| 697 | » add····%al,(%eax) | 697 | » add····%al,(%eax) |
| 698 | » add····%al,(%eax) | 698 | » add····%al,(%eax) |
| 699 | » ... | 699 | » ... |
| 700 | 0008edae·<IQTree::getModelRatesFromPLL()·[clone·.cold]>: | 700 | 0008edae·<IQTree::getModelRatesFromPLL()·[clone·.cold]>: |
| 701 | IQTree::getModelRatesFromPLL()·[clone·.cold]: | 701 | IQTree::getModelRatesFromPLL()·[clone·.cold]: |
| 702 | ./build. | 702 | ./build.serial/tree/./tree/iqtree.cpp:1710·(discriminator·2) |
| 703 | » add····%al,(%eax) | 703 | » add····%al,(%eax) |
| 704 | » add····%al,(%eax) | 704 | » add····%al,(%eax) |
| 705 | » ... | 705 | » ... |
| 706 | 0008edb4·<IQTree::pllPrintModelParams()·[clone·.cold]>: | 706 | 0008edb4·<IQTree::pllPrintModelParams()·[clone·.cold]>: |
| 707 | IQTree::pllPrintModelParams()·[clone·.cold]: | 707 | IQTree::pllPrintModelParams()·[clone·.cold]: |
| 708 | /usr/include/c++/14/bits/basic_ios.h:50 | 708 | /usr/include/c++/14/bits/basic_ios.h:50 |
| Offset 2901, 15 lines modified | Offset 2901, 15 lines modified | ||
| 2901 | » ... | 2901 | » ... |
| 2902 | 000bef7c·<posPOMO(std::__cxx11::basic_string<char,·std::char_traits<char>,·std::allocator<char>·>&)·[clone·.cold]>: | 2902 | 000bef7c·<posPOMO(std::__cxx11::basic_string<char,·std::char_traits<char>,·std::allocator<char>·>&)·[clone·.cold]>: |
| 2903 | » ... | 2903 | » ... |
| 2904 | 000befa6·<ModelFactory::optimizeAllParameters(double)·[clone·.cold]>: | 2904 | 000befa6·<ModelFactory::optimizeAllParameters(double)·[clone·.cold]>: |
| 2905 | ModelFactory::optimizeAllParameters(double)·[clone·.cold]: | 2905 | ModelFactory::optimizeAllParameters(double)·[clone·.cold]: |
| 2906 | ./build. | 2906 | ./build.serial/model/./model/modelfactory.cpp:998·(discriminator·2) |
| 2907 | » add····%al,(%eax) | 2907 | » add····%al,(%eax) |
| 2908 | » add····%al,(%eax) | 2908 | » add····%al,(%eax) |
| 2909 | » ... | 2909 | » ... |
| 2910 | 000befac·<ModelFactory::optimizeParameters(int,·bool,·double,·double)·[clone·.cold]>: | 2910 | 000befac·<ModelFactory::optimizeParameters(int,·bool,·double,·double)·[clone·.cold]>: |
| 2911 | » ... | 2911 | » ... |
| Offset 2978, 15 lines modified | Offset 2978, 15 lines modified | ||
| 2978 | » ... | 2978 | » ... |
| 2979 | 000c174a·<ModelSet::ModelSet(char·const*,·PhyloTree*)·[clone·.cold]>: | 2979 | 000c174a·<ModelSet::ModelSet(char·const*,·PhyloTree*)·[clone·.cold]>: |
| 2980 | » ... | 2980 | » ... |
| 2981 | 000c17b0·<ModelSubst::newTransMatrix()·[clone·.cold]>: | 2981 | 000c17b0·<ModelSubst::newTransMatrix()·[clone·.cold]>: |
| 2982 | ModelSubst::newTransMatrix()·[clone·.cold]: | 2982 | ModelSubst::newTransMatrix()·[clone·.cold]: |
| 2983 | ./build. | 2983 | ./build.serial/model/./model/modelsubst.cpp:183·(discriminator·2) |
| 2984 | » add····%al,(%eax) | 2984 | » add····%al,(%eax) |
| 2985 | » add····%al,(%eax) | 2985 | » add····%al,(%eax) |
| 2986 | » ... | 2986 | » ... |
| 2987 | 000c17b6·<ModelSubst::startCheckpoint()·[clone·.cold]>: | 2987 | 000c17b6·<ModelSubst::startCheckpoint()·[clone·.cold]>: |
| 2988 | » ... | 2988 | » ... |
| Offset 3093, 15 lines modified | Offset 3093, 15 lines modified | ||
| 3093 | /usr/include/c++/14/bits/basic_ios.h:50 | 3093 | /usr/include/c++/14/bits/basic_ios.h:50 |
| 3094 | » add····%al,(%eax) | 3094 | » add····%al,(%eax) |
| 3095 | » add····%al,(%eax) | 3095 | » add····%al,(%eax) |
| 3096 | » ... | 3096 | » ... |
| 3097 | 000c249b·<virtual·thunk·to·RateGamma::writeInfo(std::ostream&)·[clone·.cold]>: | 3097 | 000c249b·<virtual·thunk·to·RateGamma::writeInfo(std::ostream&)·[clone·.cold]>: |
| 3098 | virtual·thunk·to·RateGamma::writeInfo(std::ostream&)·[clone·.cold]: | 3098 | virtual·thunk·to·RateGamma::writeInfo(std::ostream&)·[clone·.cold]: |
| 3099 | ./build. | 3099 | ./build.serial/model/./model/rategamma.h:183 |
| 3100 | » add····%al,(%eax) | 3100 | » add····%al,(%eax) |
| 3101 | » add····%al,(%eax) | 3101 | » add····%al,(%eax) |
| 3102 | » ... | 3102 | » ... |
| 3103 | 000c24a0·<RateGamma::optimizeParameters(double,·double,·double)·[clone·.cold]>: | 3103 | 000c24a0·<RateGamma::optimizeParameters(double,·double,·double)·[clone·.cold]>: |
| 3104 | » ... | 3104 | » ... |
| Offset 3172, 15 lines modified | Offset 3172, 15 lines modified | ||
| 3172 | /usr/include/c++/14/bits/basic_ios.h:50 | 3172 | /usr/include/c++/14/bits/basic_ios.h:50 |
| 3173 | » add····%al,(%eax) | 3173 | » add····%al,(%eax) |
| 3174 | » add····%al,(%eax) | 3174 | » add····%al,(%eax) |
| 3175 | » ... | 3175 | » ... |
| 3176 | 000c2ced·<virtual·thunk·to·RateInvar::writeInfo(std::ostream&)·[clone·.cold]>: | 3176 | 000c2ced·<virtual·thunk·to·RateInvar::writeInfo(std::ostream&)·[clone·.cold]>: |
| 3177 | virtual·thunk·to·RateInvar::writeInfo(std::ostream&)·[clone·.cold]: | 3177 | virtual·thunk·to·RateInvar::writeInfo(std::ostream&)·[clone·.cold]: |
| 3178 | ./build. | 3178 | ./build.serial/model/./model/rateinvar.h:121 |
| 3179 | » add····%al,(%eax) | 3179 | » add····%al,(%eax) |
| 3180 | » add····%al,(%eax) | 3180 | » add····%al,(%eax) |
| 3181 | » ... | 3181 | » ... |
| 3182 | 000c2cf2·<RateInvar::optimizeParameters(double)·[clone·.cold]>: | 3182 | 000c2cf2·<RateInvar::optimizeParameters(double)·[clone·.cold]>: |
| 3183 | » ... | 3183 | » ... |
| Offset 3450, 15 lines modified | Offset 3450, 15 lines modified | ||
| 3450 | » ... | 3450 | » ... |
| 3451 | 000c6f98·<ModelPoMo::normalizeMutationRates()·[clone·.cold]>: | 3451 | 000c6f98·<ModelPoMo::normalizeMutationRates()·[clone·.cold]>: |
| 3452 | » ... | 3452 | » ... |
| 3453 | 000c6fa0·<ModelPoMo::setInitialMutCoeff()·[clone·.cold]>: | 3453 | 000c6fa0·<ModelPoMo::setInitialMutCoeff()·[clone·.cold]>: |
| 3454 | ModelPoMo::setInitialMutCoeff()·[clone·.cold]: | 3454 | ModelPoMo::setInitialMutCoeff()·[clone·.cold]: |
| 3455 | ./build. | 3455 | ./build.serial/model/./model/modelpomo.cpp:247·(discriminator·2) |
| 3456 | » add····%al,(%eax) | 3456 | » add····%al,(%eax) |
| 3457 | » add····%al,(%eax) | 3457 | » add····%al,(%eax) |
| 3458 | » ... | 3458 | » ... |
| 3459 | 000c6fa6·<ModelPoMo::normalize_boundary_freqs(double*)·[clone·.cold]>: | 3459 | 000c6fa6·<ModelPoMo::normalize_boundary_freqs(double*)·[clone·.cold]>: |
| 3460 | ModelPoMo::normalize_boundary_freqs(double*)·[clone·.cold]: | 3460 | ModelPoMo::normalize_boundary_freqs(double*)·[clone·.cold]: |
| 3461 | /usr/include/c++/14/bits/basic_ios.h:50 | 3461 | /usr/include/c++/14/bits/basic_ios.h:50 |
| Max diff block lines reached; 2278408/2282614 bytes (99.82%) of diff not shown. | |||
| Offset 1, 7 lines modified | Offset 1, 7 lines modified | ||
| 1 | Disassembly·of·section·.fini: | 1 | Disassembly·of·section·.fini: |
| 2 | 0051 | 2 | 00512e54·<_fini>: |
| 3 | » ... | 3 | » ... |
| Offset 1, 847 lines modified | Offset 1, 847 lines modified | ||
| 1 | String·dump·of·section·'.debug_line_str': | 1 | String·dump·of·section·'.debug_line_str': | Diff chunk too large, falling back to line-by-line diff (843 lines added, 843 lines removed) |
| 2 | ··[·····0]··./obsolete/parsmultistate.cpp | 2 | ··[·····0]··./obsolete/parsmultistate.cpp |
| 3 | ··[····1e]··./build. | 3 | ··[····1e]··./build.serial |
| 4 | ··[····2 | 4 | ··[····2d]··./obsolete |
| 5 | ··[····3 | 5 | ··[····38]··/usr/include/c++/14/bits |
| 6 | ··[···· | 6 | ··[····51]··/usr/include/c++/14 |
| 7 | ··[····6 | 7 | ··[····65]··/usr/include/c++/14/debug |
| 8 | ··[····7 | 8 | ··[····7f]··/usr/include/i386-linux-gnu/c++/14/bits |
| 9 | ··[····a | 9 | ··[····a7]··/usr/include/c++/14/tr1 |
| 10 | ··[····b | 10 | ··[····bf]··/usr/include/c++/14/ext |
| 11 | ··[····d | 11 | ··[····d7]··/usr/lib/gcc/i686-linux-gnu/14/include |
| 12 | ··[····f | 12 | ··[····fe]··/usr/include |
| 13 | ··[···10 | 13 | ··[···10b]··/usr/include/i386-linux-gnu/bits/types |
| 14 | ··[···1 | 14 | ··[···132]··/usr/include/i386-linux-gnu/bits |
| 15 | ··[···15 | 15 | ··[···153]··./ncl |
| 16 | ··[···15 | 16 | ··[···159]··./utils |
| 17 | ··[···1 | 17 | ··[···161]··./pda |
| 18 | ··[···16 | 18 | ··[···167]··./tree |
| 19 | ··[···16 | 19 | ··[···16e]··./yaml-cpp/include/yaml-cpp |
| 20 | ··[···18 | 20 | ··[···18a]··./yaml-cpp/include/yaml-cpp/node/detail |
| 21 | ··[···1 | 21 | ··[···1b2]··./phylo-yaml |
| 22 | ··[···1b | 22 | ··[···1bf]··./alignment |
| 23 | ··[···1c | 23 | ··[···1cb]··./model |
| 24 | ··[···1d | 24 | ··[···1d3]··./nclextra |
| 25 | ··[···1d | 25 | ··[···1de]··locale_facets.h |
| 26 | ··[···1e | 26 | ··[···1ee]··basic_string.h |
| 27 | ··[···1f | 27 | ··[···1fd]··char_traits.h |
| 28 | ··[···20 | 28 | ··[···20b]··basic_string.tcc |
| 29 | ··[···21 | 29 | ··[···21c]··alloc_traits.h |
| 30 | ··[···22 | 30 | ··[···22b]··new_allocator.h |
| 31 | ··[···23 | 31 | ··[···23b]··basic_ios.h |
| 32 | ··[···24 | 32 | ··[···247]··ios_base.h |
| 33 | ··[···2 | 33 | ··[···252]··stl_pair.h |
| 34 | ··[···25 | 34 | ··[···25d]··stl_iterator_base_types.h |
| 35 | ··[···27 | 35 | ··[···277]··debug.h |
| 36 | ··[···27 | 36 | ··[···27f]··c++config.h |
| 37 | ··[···28 | 37 | ··[···28b]··cwchar |
| 38 | ··[···2 | 38 | ··[···292]··clocale |
| 39 | ··[···29 | 39 | ··[···29a]··cstdlib |
| 40 | ··[···2 | 40 | ··[···2a2]··cstdio |
| 41 | ··[···2a | 41 | ··[···2a9]··initializer_list |
| 42 | ··[···2b | 42 | ··[···2ba]··uses_allocator.h |
| 43 | ··[···2c | 43 | ··[···2cb]··tuple |
| 44 | ··[···2 | 44 | ··[···2d1]··exception_ptr.h |
| 45 | ··[···2 | 45 | ··[···2e1]··stringfwd.h |
| 46 | ··[···2e | 46 | ··[···2ed]··cwctype |
| 47 | ··[···2f | 47 | ··[···2f5]··ostream.tcc |
| 48 | ··[··· | 48 | ··[···301]··iosfwd |
| 49 | ··[···30 | 49 | ··[···308]··iostream |
| 50 | ··[···3 | 50 | ··[···311]··postypes.h |
| 51 | ··[···31 | 51 | ··[···31c]··std_abs.h |
| 52 | ··[···32 | 52 | ··[···326]··cmath |
| 53 | ··[···32 | 53 | ··[···32c]··cstdarg |
| 54 | ··[···33 | 54 | ··[···334]··ctime |
| 55 | ··[···33 | 55 | ··[···33a]··cstring |
| 56 | ··[···3 | 56 | ··[···342]··hashtable_policy.h |
| 57 | ··[···35 | 57 | ··[···355]··shared_ptr_base.h |
| 58 | ··[···36 | 58 | ··[···367]··cstddef |
| 59 | ··[···36 | 59 | ··[···36f]··ptr_traits.h |
| 60 | ··[···37 | 60 | ··[···37c]··basic_ios.tcc |
| 61 | ··[···38 | 61 | ··[···38a]··ostream_insert.h |
| 62 | ··[···39 | 62 | ··[···39b]··functexcept.h |
| 63 | ··[···3a | 63 | ··[···3a9]··stl_iterator_base_funcs.h |
| 64 | ··[···3c | 64 | ··[···3c3]··predefined_ops.h |
| 65 | ··[···3d | 65 | ··[···3d4]··stl_iterator.h |
| 66 | ··[···3e | 66 | ··[···3e3]··concurrence.h |
| 67 | ··[···3 | 67 | ··[···3f1]··stddef.h |
| 68 | ··[···3f | 68 | ··[···3fa]··stdarg.h |
| 69 | ··[···40 | 69 | ··[···403]··wint_t.h |
| 70 | ··[···40 | 70 | ··[···40c]··__mbstate_t.h |
| 71 | ··[···41 | 71 | ··[···41a]··__FILE.h |
| 72 | ··[···42 | 72 | ··[···423]··struct_FILE.h |
| 73 | ··[···4 | 73 | ··[···431]··wchar2.h |
| 74 | ··[···43 | 74 | ··[···43a]··struct_tm.h |
| 75 | ··[···44 | 75 | ··[···446]··locale.h |
| 76 | ··[···44 | 76 | ··[···44f]··stdlib.h |
| 77 | ··[···45 | 77 | ··[···458]··clock_t.h |
| 78 | ··[···4 | 78 | ··[···462]··time_t.h |
| 79 | ··[···46 | 79 | ··[···46b]··stdint-intn.h |
| 80 | ··[···47 | 80 | ··[···479]··stdlib-float.h |
| 81 | ··[···48 | 81 | ··[···488]··stdlib-bsearch.h |
| 82 | ··[···49 | 82 | ··[···499]··__fpos_t.h |
| 83 | ··[···4a | 83 | ··[···4a4]··stdio.h |
| 84 | ··[···4a | 84 | ··[···4ac]··stdio2.h |
| 85 | ··[···4b | 85 | ··[···4b5]··wctype-wchar.h |
| 86 | ··[···4c | 86 | ··[···4c4]··wctype.h |
| 87 | ··[···4c | 87 | ··[···4cd]··math.h |
| 88 | ··[···4d | 88 | ··[···4d4]··time.h |
| 89 | ··[···4d | 89 | ··[···4db]··ncl.h |
| 90 | ··[···4 | 90 | ··[···4e1]··split.h |
| 91 | ··[···4e | 91 | ··[···4e9]··hashsplitset.h |
| 92 | ··[···4f | 92 | ··[···4f8]··mtree.h |
| 93 | ··[··· | 93 | ··[···500]··exceptions.h |
| 94 | ··[···50 | 94 | ··[···50d]··bool_type.h |
| 95 | ··[···51 | 95 | ··[···519]··statespace.h |
| 96 | ··[···52 | 96 | ··[···526]··pattern.h |
| 97 | ··[···5 | 97 | ··[···530]··checkpoint.h |
| 98 | ··[···53 | 98 | ··[···53d]··modelsubst.h |
| 99 | ··[···54 | 99 | ··[···54a]··rateheterogeneity.h |
| 100 | ··[···55 | 100 | ··[···55e]··modelsblock.h |
| 101 | ··[···56 | 101 | ··[···56c]··modelfactory.h |
| 102 | ··[···57 | 102 | ··[···57b]··phylonode.h |
| 103 | ··[···58 | 103 | ··[···587]··splitgraph.h |
| 104 | ··[···59 | 104 | ··[···594]··phylotree.h |
| 105 | ··[···5 | 105 | ··[···5a0]··new |
| 106 | ··[···5a | 106 | ··[···5a4]··parstree.h |
| 107 | ··[···5a | 107 | ··[···5af]··system_error |
| 108 | ··[···5b | 108 | ··[···5bc]··./alignment/alignment.cpp |
| 109 | ··[···5d | 109 | ··[···5d6]··./build.serial/alignment |
| 110 | ··[···5e | 110 | ··[···5ef]··/usr/include/boost/math/policies |
| 111 | ··[···6 | 111 | ··[···610]··/usr/include/eigen3/Eigen/src/Core |
| 112 | ··[···6 | 112 | ··[···633]··/usr/include/eigen3/Eigen/src/Core/products |
| 113 | ··[···65 | 113 | ··[···65f]··/usr/include/eigen3/Eigen/src/Core/util |
| 114 | ··[···68 | 114 | ··[···687]··/usr/include/eigen3/Eigen/src/Core/arch/SSE |
| 115 | ··[···6 | 115 | ··[···6b3]··/usr/include/eigen3/Eigen/src/Core/arch/Default |
| 116 | ··[···6 | 116 | ··[···6e3]··/usr/include/boost/math/tools/detail |
| 117 | ··[···70 | 117 | ··[···708]··/usr/include/boost |
| 118 | ··[···71 | 118 | ··[···71b]··/usr/include/boost/exception |
| 119 | ··[···73 | 119 | ··[···738]··/usr/include/boost/math/special_functions/detail |
| 120 | ··[···76 | 120 | ··[···769]··/usr/include/boost/math/tools |
| 121 | ··[···78 | 121 | ··[···787]··/usr/include/boost/math/special_functions |
| 122 | ··[···7 | 122 | ··[···7b1]··/usr/include/eigen3/Eigen/src/LU |
| 123 | ··[···7 | 123 | ··[···7d2]··/usr/include/eigen3/Eigen/src/Core/functors |
| 124 | ··[···7f | 124 | ··[···7fe]··/usr/include/eigen3/Eigen/src/Core/../plugins |
| 125 | ··[···82 | 125 | ··[···82c]··/usr/include/boost/math/distributions |
| Max diff block lines reached; 0/52166 bytes (0.00%) of diff not shown. | |||
| Offset 1, 8 lines modified | Offset 1, 8 lines modified | ||
| 1 | Hex·dump·of·section·'.gnu_debugaltlink': | 1 | Hex·dump·of·section·'.gnu_debugaltlink': |
| 2 | ··0x00000000·2f757372·2f6c6962·2f646562·75672f2e·/usr/lib/debug/. | 2 | ··0x00000000·2f757372·2f6c6962·2f646562·75672f2e·/usr/lib/debug/. |
| 3 | ··0x00000010·64777a2f·69333836·2d6c696e·75782d67·dwz/i386-linux-g | 3 | ··0x00000010·64777a2f·69333836·2d6c696e·75782d67·dwz/i386-linux-g |
| 4 | ··0x00000020·6e752f69·71747265·652e6465·62756700·nu/iqtree.debug. | 4 | ··0x00000020·6e752f69·71747265·652e6465·62756700·nu/iqtree.debug. |
| 5 | ··0x00000030· | 5 | ··0x00000030·6b572d48·6c5a52d6·d5a227cc·ab12a58e·kW-HlZR...'..... |
| 6 | ··0x00000040· | 6 | ··0x00000040·b8e8e5e8····························.... |