Thu May 23 12:52:49 UTC 2024 I: starting to build milib/unstable/amd64 on jenkins on '2024-05-23 12:52' Thu May 23 12:52:49 UTC 2024 I: The jenkins build log is/was available at https://jenkins.debian.net/userContent/reproducible/debian/build_service/amd64_3/20745/console.log Thu May 23 12:52:49 UTC 2024 I: Downloading source for unstable/milib=2.2.0+dfsg-1 --2024-05-23 12:52:49-- http://deb.debian.org/debian/pool/main/m/milib/milib_2.2.0%2bdfsg-1.dsc Connecting to 46.16.76.132:3128... connected. Proxy request sent, awaiting response... 200 OK Length: 2321 (2.3K) [text/prs.lines.tag] Saving to: ‘milib_2.2.0+dfsg-1.dsc’ 0K .. 100% 311M=0s 2024-05-23 12:52:49 (311 MB/s) - ‘milib_2.2.0+dfsg-1.dsc’ saved [2321/2321] Thu May 23 12:52:49 UTC 2024 I: milib_2.2.0+dfsg-1.dsc -----BEGIN PGP SIGNED MESSAGE----- Hash: SHA512 Format: 3.0 (quilt) Source: milib Binary: libmilib-java Architecture: all Version: 2.2.0+dfsg-1 Maintainer: Debian Med Packaging Team Uploaders: Steffen Moeller , Pierre Gruet Homepage: https://milaboratory.com/ Standards-Version: 4.6.2 Vcs-Browser: https://salsa.debian.org/med-team/milib Vcs-Git: https://salsa.debian.org/med-team/milib.git Build-Depends: debhelper-compat (= 13), default-jdk, gradle-debian-helper, javahelper, maven-repo-helper Build-Depends-Indep: junit4 , libcommons-compress-java, libcommons-io-java, libcommons-math3-java, libguava-java, libjackson2-annotations-java, libjackson2-core-java, libjackson2-databind-java, libjcommander-java, liblz4-java, libmockito-java , libredberry-pipe-java, libtrove3-java Package-List: libmilib-java deb java optional arch=all Checksums-Sha1: 8bdc2c9f5b41fb8f019e40aa92319f8f44cf53b0 297272 milib_2.2.0+dfsg.orig.tar.xz 8679f47ef3b51a7903c90aec7b1cc0f03d5519ba 7164 milib_2.2.0+dfsg-1.debian.tar.xz Checksums-Sha256: fcb526a82893ed03e0e2ee03fc903068ab0e1ba3756882fde5772570d925bea8 297272 milib_2.2.0+dfsg.orig.tar.xz 3580819348a335020267872364231b07d94acc187fe8f8d1e725cd435ca99da0 7164 milib_2.2.0+dfsg-1.debian.tar.xz Files: 0f3366106ffc38854a4ecb1291948b37 297272 milib_2.2.0+dfsg.orig.tar.xz 1ccdc6feb357479034ab0802e1ec790f 7164 milib_2.2.0+dfsg-1.debian.tar.xz -----BEGIN PGP SIGNATURE----- iQIzBAEBCgAdFiEEM8soQxPpC9J9y0UjYAMWptwndHYFAmOu8MEACgkQYAMWptwn dHb8exAAgNgcLCIp51bVmOXq+5+TMCGtZH0+gUjZYfnhqvzgRcVtjsY4KyVRaxvv 43ldjF+xJOnapBdgG9Yk/JwyooGIk3L7x2d2fSflxqfvCqjRqCWC7EZ43FDESdWx +Xb48U+1t5rW6ucA+GIGuaI3/wL8UTxm9O/ZCdk0zdFoUFeNHOEMPw8/Fysy7z6U gCg2TbPTfrgsnGbTCv9pHqT7/FE8cMNLbd5P61acd/Afa1qym01RxcUlMcGqOS4R 4gf49LshEB1ftRu4XjE9ka6S9svWWxPFK3Qq6qM8otWcsn91BJEsRx7qo0iY/cw6 JoALJr/kq/3QXIiP4a2A6WuP5l53xrNyLZ8E5B95JZnDw887seHibv0BMvKIAxEG GGvsIhd3qWMHSfu5IQckXkg+Vl6spdb82shQpkUOUy7+Nshnplw5Vn5KQ2Ll39j/ sNZpLsb1IMaagRQVp57cFgFCPyHgbTnuHMMhUZJ7n6W7Gqb3bkFDjdKtJnrcSB7i Dltz0RpNUNRmCzfzKNRWORRMQ1CD2cUD8CZK7yqdoSv5S6cGGsMIHuAT2pY4vA6N FE/usfcq76Eghl8xO6XLFLIJxrVSM8iBXQ4TTmA+oUf+ESZ0yb09OwwuEh60MWLM 8CiI7eUUWryGLXgJtjZZkcEFj9qxSblrje70pr9KGmDoWFQQ2R8= =eoDq -----END PGP SIGNATURE----- Thu May 23 12:52:49 UTC 2024 I: Checking whether the package is not for us Thu May 23 12:52:49 UTC 2024 I: Starting 1st build on remote node ionos1-amd64.debian.net. Thu May 23 12:52:49 UTC 2024 I: Preparing to do remote build '1' on ionos1-amd64.debian.net. Thu May 23 13:03:56 UTC 2024 I: Deleting $TMPDIR on ionos1-amd64.debian.net. I: pbuilder: network access will be disabled during build I: Current time: Thu May 23 00:52:51 -12 2024 I: pbuilder-time-stamp: 1716468771 I: Building the build Environment I: extracting base tarball [/var/cache/pbuilder/unstable-reproducible-base.tgz] I: copying local configuration W: --override-config is not set; not updating apt.conf Read the manpage for details. I: mounting /proc filesystem I: mounting /sys filesystem I: creating /{dev,run}/shm I: mounting /dev/pts filesystem I: redirecting /dev/ptmx to /dev/pts/ptmx I: policy-rc.d already exists I: Copying source file I: copying [milib_2.2.0+dfsg-1.dsc] I: copying [./milib_2.2.0+dfsg.orig.tar.xz] I: copying [./milib_2.2.0+dfsg-1.debian.tar.xz] I: Extracting source gpgv: Signature made Fri Dec 30 14:08:01 2022 gpgv: using RSA key 33CB284313E90BD27DCB4523600316A6DC277476 gpgv: Can't check signature: No public key dpkg-source: warning: cannot verify inline signature for ./milib_2.2.0+dfsg-1.dsc: no acceptable signature found dpkg-source: info: extracting milib in milib-2.2.0+dfsg dpkg-source: info: unpacking milib_2.2.0+dfsg.orig.tar.xz dpkg-source: info: unpacking milib_2.2.0+dfsg-1.debian.tar.xz dpkg-source: info: using patch list from debian/patches/series dpkg-source: info: applying build_gradle.patch dpkg-source: info: applying guava_interface.patch dpkg-source: info: applying deactivate_test_reading_build_properties.patch dpkg-source: info: applying flaky_test.patch I: Not using root during the build. I: Installing the build-deps I: user script /srv/workspace/pbuilder/1771205/tmp/hooks/D02_print_environment starting I: set BUILDDIR='/build/reproducible-path' BUILDUSERGECOS='first user,first room,first work-phone,first home-phone,first other' BUILDUSERNAME='pbuilder1' BUILD_ARCH='amd64' DEBIAN_FRONTEND='noninteractive' DEB_BUILD_OPTIONS='buildinfo=+all reproducible=+all parallel=20 ' DISTRIBUTION='unstable' HOME='/root' HOST_ARCH='amd64' IFS=' ' INVOCATION_ID='5e986ec4c3104a7294c394719ed5458e' LANG='C' LANGUAGE='en_US:en' LC_ALL='C' MAIL='/var/mail/root' OPTIND='1' PATH='/usr/sbin:/usr/bin:/sbin:/bin:/usr/games' PBCURRENTCOMMANDLINEOPERATION='build' PBUILDER_OPERATION='build' PBUILDER_PKGDATADIR='/usr/share/pbuilder' PBUILDER_PKGLIBDIR='/usr/lib/pbuilder' PBUILDER_SYSCONFDIR='/etc' PPID='1771205' PS1='# ' PS2='> ' PS4='+ ' PWD='/' SHELL='/bin/bash' SHLVL='2' SUDO_COMMAND='/usr/bin/timeout -k 18.1h 18h /usr/bin/ionice -c 3 /usr/bin/nice /usr/sbin/pbuilder --build --configfile /srv/reproducible-results/rbuild-debian/r-b-build.n3PaST7J/pbuilderrc_42KZ --distribution unstable --hookdir /etc/pbuilder/first-build-hooks --debbuildopts -b --basetgz /var/cache/pbuilder/unstable-reproducible-base.tgz --buildresult /srv/reproducible-results/rbuild-debian/r-b-build.n3PaST7J/b1 --logfile b1/build.log milib_2.2.0+dfsg-1.dsc' SUDO_GID='110' SUDO_UID='105' SUDO_USER='jenkins' TERM='unknown' TZ='/usr/share/zoneinfo/Etc/GMT+12' USER='root' _='/usr/bin/systemd-run' http_proxy='http://46.16.76.132:3128' I: uname -a Linux ionos1-amd64 6.1.0-21-amd64 #1 SMP PREEMPT_DYNAMIC Debian 6.1.90-1 (2024-05-03) x86_64 GNU/Linux I: ls -l /bin lrwxrwxrwx 1 root root 7 May 23 07:43 /bin -> usr/bin I: user script /srv/workspace/pbuilder/1771205/tmp/hooks/D02_print_environment finished -> Attempting to satisfy build-dependencies -> Creating pbuilder-satisfydepends-dummy package Package: pbuilder-satisfydepends-dummy Version: 0.invalid.0 Architecture: amd64 Maintainer: Debian Pbuilder Team Description: Dummy package to satisfy dependencies with aptitude - created by pbuilder This package was created automatically by pbuilder to satisfy the build-dependencies of the package being currently built. Depends: debhelper-compat (= 13), default-jdk, gradle-debian-helper, javahelper, maven-repo-helper, junit4, libcommons-compress-java, libcommons-io-java, libcommons-math3-java, libguava-java, libjackson2-annotations-java, libjackson2-core-java, libjackson2-databind-java, libjcommander-java, liblz4-java, libmockito-java, libredberry-pipe-java, libtrove3-java dpkg-deb: building package 'pbuilder-satisfydepends-dummy' in '/tmp/satisfydepends-aptitude/pbuilder-satisfydepends-dummy.deb'. Selecting previously unselected package pbuilder-satisfydepends-dummy. (Reading database ... 19718 files and directories currently installed.) Preparing to unpack .../pbuilder-satisfydepends-dummy.deb ... Unpacking pbuilder-satisfydepends-dummy (0.invalid.0) ... dpkg: pbuilder-satisfydepends-dummy: dependency problems, but configuring anyway as you requested: pbuilder-satisfydepends-dummy depends on debhelper-compat (= 13); however: Package debhelper-compat is not installed. pbuilder-satisfydepends-dummy depends on default-jdk; however: Package default-jdk is not installed. pbuilder-satisfydepends-dummy depends on gradle-debian-helper; however: Package gradle-debian-helper is not installed. pbuilder-satisfydepends-dummy depends on javahelper; however: Package javahelper is not installed. pbuilder-satisfydepends-dummy depends on maven-repo-helper; however: Package maven-repo-helper is not installed. pbuilder-satisfydepends-dummy depends on junit4; however: Package junit4 is not installed. pbuilder-satisfydepends-dummy depends on libcommons-compress-java; however: Package libcommons-compress-java is not installed. pbuilder-satisfydepends-dummy depends on libcommons-io-java; however: Package libcommons-io-java is not installed. pbuilder-satisfydepends-dummy depends on libcommons-math3-java; however: Package libcommons-math3-java is not installed. pbuilder-satisfydepends-dummy depends on libguava-java; however: Package libguava-java is not installed. pbuilder-satisfydepends-dummy depends on libjackson2-annotations-java; however: Package libjackson2-annotations-java is not installed. pbuilder-satisfydepends-dummy depends on libjackson2-core-java; however: Package libjackson2-core-java is not installed. pbuilder-satisfydepends-dummy depends on libjackson2-databind-java; however: Package libjackson2-databind-java is not installed. pbuilder-satisfydepends-dummy depends on libjcommander-java; however: Package libjcommander-java is not installed. pbuilder-satisfydepends-dummy depends on liblz4-java; however: Package liblz4-java is not installed. pbuilder-satisfydepends-dummy depends on libmockito-java; however: Package libmockito-java is not installed. pbuilder-satisfydepends-dummy depends on libredberry-pipe-java; however: Package libredberry-pipe-java is not installed. pbuilder-satisfydepends-dummy depends on libtrove3-java; however: Package libtrove3-java is not installed. Setting up pbuilder-satisfydepends-dummy (0.invalid.0) ... Reading package lists... Building dependency tree... Reading state information... Initializing package states... Writing extended state information... Building tag database... pbuilder-satisfydepends-dummy is already installed at the requested version (0.invalid.0) pbuilder-satisfydepends-dummy is already installed at the requested version (0.invalid.0) The following NEW packages will be installed: adwaita-icon-theme{a} ant{a} ant-optional{a} antlr{a} at-spi2-common{a} autoconf{a} automake{a} autopoint{a} autotools-dev{a} binfmt-support{a} bnd{a} bsdextrautils{a} ca-certificates{a} ca-certificates-java{a} dctrl-tools{a} debhelper{a} default-jdk{a} default-jdk-headless{a} default-jre{a} default-jre-headless{a} devscripts{a} dh-autoreconf{a} dh-strip-nondeterminism{a} dirmngr{a} dwz{a} fastjar{a} file{a} fontconfig{a} fontconfig-config{a} fonts-dejavu-core{a} fonts-dejavu-mono{a} gettext{a} gettext-base{a} gnupg{a} gnupg-l10n{a} gnupg-utils{a} gpg{a} gpg-agent{a} gpg-wks-client{a} gpgconf{a} gpgsm{a} gradle{a} gradle-debian-helper{a} groff-base{a} groovy{a} gtk-update-icon-cache{a} hicolor-icon-theme{a} intltool-debian{a} ivy{a} jarwrapper{a} java-common{a} java-wrappers{a} javahelper{a} junit4{a} libantlr-java{a} libaopalliance-java{a} libapache-pom-java{a} libarchive-zip-perl{a} libasm-java{a} libasound2-data{a} libasound2t64{a} libassuan0{a} libatinject-jsr330-api-java{a} libatk1.0-0t64{a} libavahi-client3{a} libavahi-common-data{a} libavahi-common3{a} libb-hooks-op-check-perl{a} libbcel-java{a} libbcpg-java{a} libbcprov-java{a} libbrotli1{a} libbsd0{a} libbsf-java{a} libbsh-java{a} libbyte-buddy-java{a} libcairo2{a} libcdi-api-java{a} libclass-method-modifiers-perl{a} libclass-xsaccessor-perl{a} libclone-perl{a} libcom-err2{a} libcommons-cli-java{a} libcommons-codec-java{a} libcommons-collections3-java{a} libcommons-compress-java{a} libcommons-io-java{a} libcommons-lang-java{a} libcommons-lang3-java{a} libcommons-logging-java{a} libcommons-math3-java{a} libcommons-parent-java{a} libcups2t64{a} libdata-optlist-perl{a} libdatrie1{a} libdbus-1-3{a} libdd-plist-java{a} libdebhelper-perl{a} libdeflate0{a} libdevel-callchecker-perl{a} libdom4j-java{a} libdrm-amdgpu1{a} libdrm-common{a} libdrm-intel1{a} libdrm-nouveau2{a} libdrm-radeon1{a} libdrm2{a} libdynaloader-functions-perl{a} libeclipse-jdt-annotation-java{a} libedit2{a} libel-api-java{a} libelf1t64{a} libencode-locale-perl{a} liberror-prone-java{a} libexpat1{a} libfelix-framework-java{a} libfelix-gogo-runtime-java{a} libfelix-resolver-java{a} libfile-dirlist-perl{a} libfile-homedir-perl{a} libfile-listing-perl{a} libfile-stripnondeterminism-perl{a} libfile-touch-perl{a} libfile-which-perl{a} libfindbugs-java{a} libfontconfig1{a} libfreetype6{a} libfribidi0{a} libgdk-pixbuf-2.0-0{a} libgdk-pixbuf2.0-common{a} libgeronimo-annotation-1.3-spec-java{a} libgeronimo-interceptor-3.0-spec-java{a} libgif7{a} libgl1{a} libgl1-mesa-dri{a} libglapi-mesa{a} libglib2.0-0t64{a} libglvnd0{a} libglx-mesa0{a} libglx0{a} libgoogle-gson-java{a} libgradle-core-java{a} libgradle-plugins-java{a} libgraphite2-3{a} libgssapi-krb5-2{a} libgtk2.0-0t64{a} libgtk2.0-common{a} libguava-java{a} libguice-java{a} libhamcrest-java{a} libharfbuzz0b{a} libhawtjni-runtime-java{a} libhtml-parser-perl{a} libhtml-tagset-perl{a} libhtml-tree-perl{a} libhttp-cookies-perl{a} libhttp-date-perl{a} libhttp-message-perl{a} libhttp-negotiate-perl{a} libhttpclient-java{a} libhttpcore-java{a} libicu72{a} libimport-into-perl{a} libio-html-perl{a} libio-pty-perl{a} libio-socket-ssl-perl{a} libipc-run-perl{a} libjackson2-annotations-java{a} libjackson2-core-java{a} libjackson2-databind-java{a} libjansi-java{a} libjansi-native-java{a} libjansi1-java{a} libjarjar-java{a} libjatl-java{a} libjavaewah-java{a} libjaxen-java{a} libjbig0{a} libjcifs-java{a} libjcip-annotations-java{a} libjcommander-java{a} libjetty9-java{a} libjformatstring-java{a} libjgit-java{a} libjline2-java{a} libjna-java{a} libjna-jni{a} libjpeg62-turbo{a} libjs-jquery{a} libjsch-java{a} libjsoup-java{a} libjsp-api-java{a} libjsr305-java{a} libjzlib-java{a} libk5crypto3{a} libkeyutils1{a} libkrb5-3{a} libkrb5support0{a} libkryo-java{a} libksba8{a} liblcms2-2{a} libldap-2.5-0{a} liblerc4{a} libllvm17t64{a} liblogback-java{a} liblwp-mediatypes-perl{a} liblwp-protocol-https-perl{a} liblz4-java{a} liblz4-jni{a} libmagic-mgc{a} libmagic1t64{a} libmaven-parent-java{a} libmaven-resolver-java{a} libmaven-shared-utils-java{a} libmaven3-core-java{a} libminlog-java{a} libmockito-java{a} libmodule-runtime-perl{a} libmoo-perl{a} libnative-platform-java{a} libnative-platform-jni{a} libnekohtml-java{a} libnet-http-perl{a} libnet-ssleay-perl{a} libnpth0t64{a} libnspr4{a} libnss3{a} libobjenesis-java{a} libosgi-annotation-java{a} libosgi-compendium-java{a} libosgi-core-java{a} libpango-1.0-0{a} libpangocairo-1.0-0{a} libpangoft2-1.0-0{a} libparams-classify-perl{a} libparams-util-perl{a} libpciaccess0{a} libpcsclite1{a} libpipeline1{a} libpixman-1-0{a} libplexus-cipher-java{a} libplexus-classworlds-java{a} libplexus-component-annotations-java{a} libplexus-container-default-java{a} libplexus-interpolation-java{a} libplexus-sec-dispatcher-java{a} libplexus-utils2-java{a} libpng16-16t64{a} libpolyglot-maven-java{a} libpython3-stdlib{a} libpython3.11-minimal{a} libpython3.11-stdlib{a} libqdox-java{a} libreadline8t64{a} libredberry-pipe-java{a} libreflectasm-java{a} librhino-java{a} librole-tiny-perl{a} libsasl2-2{a} libsasl2-modules-db{a} libsensors-config{a} libsensors5{a} libservlet-api-java{a} libsharpyuv0{a} libsimple-http-java{a} libsisu-inject-java{a} libsisu-plexus-java{a} libslf4j-java{a} libsub-exporter-perl{a} libsub-install-perl{a} libsub-override-perl{a} libsub-prototype-perl{a} libsub-quote-perl{a} libthai-data{a} libthai0{a} libtiff6{a} libtimedate-perl{a} libtool{a} libtrove3-java{a} libtry-tiny-perl{a} libuchardet0{a} liburi-perl{a} libvulkan1{a} libwagon-file-java{a} libwagon-http-java{a} libwagon-provider-api-java{a} libwebp7{a} libwebsocket-api-java{a} libwww-perl{a} libwww-robotrules-perl{a} libx11-6{a} libx11-data{a} libx11-xcb1{a} libxau6{a} libxbean-reflect-java{a} libxcb-dri2-0{a} libxcb-dri3-0{a} libxcb-glx0{a} libxcb-present0{a} libxcb-randr0{a} libxcb-render0{a} libxcb-shm0{a} libxcb-sync1{a} libxcb-xfixes0{a} libxcb1{a} libxcomposite1{a} libxcursor1{a} libxdamage1{a} libxdmcp6{a} libxerces2-java{a} libxext6{a} libxfixes3{a} libxi6{a} libxinerama1{a} libxml-commons-external-java{a} libxml-commons-resolver1.1-java{a} libxml2{a} libxpp3-java{a} libxrandr2{a} libxrender1{a} libxshmfence1{a} libxstream-java{a} libxtst6{a} libxxf86vm1{a} libxz-java{a} libyaml-snake-java{a} libz3-4{a} m4{a} man-db{a} maven-repo-helper{a} media-types{a} netbase{a} openjdk-17-jdk{a} openjdk-17-jdk-headless{a} openjdk-17-jre{a} openjdk-17-jre-headless{a} openssl{a} patchutils{a} perl-openssl-defaults{a} pinentry-curses{a} po-debconf{a} python3{a} python3-minimal{a} python3.11{a} python3.11-minimal{a} readline-common{a} sensible-utils{a} shared-mime-info{a} testng{a} tzdata{a} unzip{a} wdiff{a} x11-common{a} The following packages are RECOMMENDED but will NOT be installed: alsa-topology-conf alsa-ucm-conf curl dbus debian-keyring dput dput-ng dupload equivs fonts-dejavu-extra javascript-common krb5-locales libarchive-cpio-perl libatk-wrapper-java-jni libbindex-java libdata-dump-perl libdistro-info-perl libgail-common libgdk-pixbuf2.0-bin libgit-wrapper-perl libgitlab-api-v4-perl libglib2.0-data libgpars-groovy-java libgtk2.0-bin libhtml-form-perl libhtml-format-perl libhttp-daemon-perl libio-compress-brotli-perl libjson-perl libldap-common liblist-compare-perl libltdl-dev libmail-sendmail-perl libmailtools-perl libnamespace-clean-perl libreflectasm-java-doc librsvg2-common libsasl2-modules libsoap-lite-perl libstring-shellquote-perl libxstring-perl libxt-dev licensecheck lintian lynx mesa-vulkan-drivers pristine-tar python3-apt python3-debian python3-magic python3-requests python3-unidiff python3-xdg strace wget xdg-user-dirs 0 packages upgraded, 353 newly installed, 0 to remove and 0 not upgraded. Need to get 304 MB of archives. After unpacking 808 MB will be used. Writing extended state information... Get: 1 http://deb.debian.org/debian unstable/main amd64 libpipeline1 amd64 1.5.7-2 [38.0 kB] Get: 2 http://deb.debian.org/debian unstable/main amd64 binfmt-support amd64 2.2.2-7 [64.3 kB] Get: 3 http://deb.debian.org/debian unstable/main amd64 libpython3.11-minimal amd64 3.11.9-1 [817 kB] Get: 4 http://deb.debian.org/debian unstable/main amd64 libexpat1 amd64 2.6.2-1 [103 kB] Get: 5 http://deb.debian.org/debian unstable/main amd64 python3.11-minimal amd64 3.11.9-1 [1879 kB] Get: 6 http://deb.debian.org/debian unstable/main amd64 python3-minimal amd64 3.11.8-1 [26.3 kB] Get: 7 http://deb.debian.org/debian unstable/main amd64 media-types all 10.1.0 [26.9 kB] Get: 8 http://deb.debian.org/debian unstable/main amd64 netbase all 6.4 [12.8 kB] Get: 9 http://deb.debian.org/debian unstable/main amd64 tzdata all 2024a-4 [255 kB] Get: 10 http://deb.debian.org/debian unstable/main amd64 readline-common all 8.2-4 [69.3 kB] Get: 11 http://deb.debian.org/debian unstable/main amd64 libreadline8t64 amd64 8.2-4 [167 kB] Get: 12 http://deb.debian.org/debian unstable/main amd64 libpython3.11-stdlib amd64 3.11.9-1 [1792 kB] Get: 13 http://deb.debian.org/debian unstable/main amd64 python3.11 amd64 3.11.9-1 [602 kB] Get: 14 http://deb.debian.org/debian unstable/main amd64 libpython3-stdlib amd64 3.11.8-1 [9332 B] Get: 15 http://deb.debian.org/debian unstable/main amd64 python3 amd64 3.11.8-1 [27.4 kB] Get: 16 http://deb.debian.org/debian unstable/main amd64 sensible-utils all 0.0.22 [22.4 kB] Get: 17 http://deb.debian.org/debian unstable/main amd64 openssl amd64 3.2.1-3 [1360 kB] Get: 18 http://deb.debian.org/debian unstable/main amd64 ca-certificates all 20240203 [158 kB] Get: 19 http://deb.debian.org/debian unstable/main amd64 libmagic-mgc amd64 1:5.45-3 [314 kB] Get: 20 http://deb.debian.org/debian unstable/main amd64 libmagic1t64 amd64 1:5.45-3 [105 kB] Get: 21 http://deb.debian.org/debian unstable/main amd64 file amd64 1:5.45-3 [42.9 kB] Get: 22 http://deb.debian.org/debian unstable/main amd64 gettext-base amd64 0.21-14+b1 [161 kB] Get: 23 http://deb.debian.org/debian unstable/main amd64 libuchardet0 amd64 0.0.8-1+b1 [68.8 kB] Get: 24 http://deb.debian.org/debian unstable/main amd64 groff-base amd64 1.23.0-4 [1180 kB] Get: 25 http://deb.debian.org/debian unstable/main amd64 bsdextrautils amd64 2.40.1-1 [94.1 kB] Get: 26 http://deb.debian.org/debian unstable/main amd64 man-db amd64 2.12.1-1 [1411 kB] Get: 27 http://deb.debian.org/debian unstable/main amd64 libgdk-pixbuf2.0-common all 2.42.12+dfsg-1 [311 kB] Get: 28 http://deb.debian.org/debian unstable/main amd64 libglib2.0-0t64 amd64 2.80.2-1 [1485 kB] Get: 29 http://deb.debian.org/debian unstable/main amd64 libicu72 amd64 72.1-4+b1 [9395 kB] Get: 30 http://deb.debian.org/debian unstable/main amd64 libxml2 amd64 2.9.14+dfsg-1.3+b3 [692 kB] Get: 31 http://deb.debian.org/debian unstable/main amd64 shared-mime-info amd64 2.4-4 [759 kB] Get: 32 http://deb.debian.org/debian unstable/main amd64 libjpeg62-turbo amd64 1:2.1.5-3 [167 kB] Get: 33 http://deb.debian.org/debian unstable/main amd64 libpng16-16t64 amd64 1.6.43-5 [278 kB] Get: 34 http://deb.debian.org/debian unstable/main amd64 libdeflate0 amd64 1.20-1 [46.0 kB] Get: 35 http://deb.debian.org/debian unstable/main amd64 libjbig0 amd64 2.1-6.1+b1 [32.0 kB] Get: 36 http://deb.debian.org/debian unstable/main amd64 liblerc4 amd64 4.0.0+ds-4+b1 [171 kB] Get: 37 http://deb.debian.org/debian unstable/main amd64 libsharpyuv0 amd64 1.4.0-0.1 [113 kB] Get: 38 http://deb.debian.org/debian unstable/main amd64 libwebp7 amd64 1.4.0-0.1 [311 kB] Get: 39 http://deb.debian.org/debian unstable/main amd64 libtiff6 amd64 4.5.1+git230720-4 [322 kB] Get: 40 http://deb.debian.org/debian unstable/main amd64 libgdk-pixbuf-2.0-0 amd64 2.42.12+dfsg-1 [139 kB] Get: 41 http://deb.debian.org/debian unstable/main amd64 gtk-update-icon-cache amd64 3.24.41-4 [46.6 kB] Get: 42 http://deb.debian.org/debian unstable/main amd64 hicolor-icon-theme all 0.18-1 [12.0 kB] Get: 43 http://deb.debian.org/debian unstable/main amd64 adwaita-icon-theme all 46.0-1 [614 kB] Get: 44 http://deb.debian.org/debian unstable/main amd64 ca-certificates-java all 20240118 [11.6 kB] Get: 45 http://deb.debian.org/debian unstable/main amd64 java-common all 0.75 [6640 B] Get: 46 http://deb.debian.org/debian unstable/main amd64 liblcms2-2 amd64 2.14-2+b1 [154 kB] Get: 47 http://deb.debian.org/debian unstable/main amd64 libnspr4 amd64 2:4.35-1.1+b1 [109 kB] Get: 48 http://deb.debian.org/debian unstable/main amd64 libnss3 amd64 2:3.100-1 [1406 kB] Get: 49 http://deb.debian.org/debian unstable/main amd64 libpcsclite1 amd64 2.2.2-1 [54.9 kB] Get: 50 http://deb.debian.org/debian unstable/main amd64 openjdk-17-jre-headless amd64 17.0.11+9-1 [43.8 MB] Get: 51 http://deb.debian.org/debian unstable/main amd64 default-jre-headless amd64 2:1.17-75 [3068 B] Get: 52 http://deb.debian.org/debian unstable/main amd64 ant all 1.10.14-1 [2162 kB] Get: 53 http://deb.debian.org/debian unstable/main amd64 ant-optional all 1.10.14-1 [455 kB] Get: 54 http://deb.debian.org/debian unstable/main amd64 libantlr-java all 2.7.7+dfsg-13 [458 kB] Get: 55 http://deb.debian.org/debian unstable/main amd64 antlr all 2.7.7+dfsg-13 [8272 B] Get: 56 http://deb.debian.org/debian unstable/main amd64 at-spi2-common all 2.52.0-1 [166 kB] Get: 57 http://deb.debian.org/debian unstable/main amd64 m4 amd64 1.4.19-4 [287 kB] Get: 58 http://deb.debian.org/debian unstable/main amd64 autoconf all 2.71-3 [332 kB] Get: 59 http://deb.debian.org/debian unstable/main amd64 autotools-dev all 20220109.1 [51.6 kB] Get: 60 http://deb.debian.org/debian unstable/main amd64 automake all 1:1.16.5-1.3 [823 kB] Get: 61 http://deb.debian.org/debian unstable/main amd64 autopoint all 0.21-14 [496 kB] Get: 62 http://deb.debian.org/debian unstable/main amd64 unzip amd64 6.0-28 [166 kB] Get: 63 http://deb.debian.org/debian unstable/main amd64 java-wrappers all 0.4 [8916 B] Get: 64 http://deb.debian.org/debian unstable/main amd64 libhamcrest-java all 2.2-2 [121 kB] Get: 65 http://deb.debian.org/debian unstable/main amd64 junit4 all 4.13.2-4 [349 kB] Get: 66 http://deb.debian.org/debian unstable/main amd64 libfelix-framework-java all 4.6.1-2.1 [569 kB] Get: 67 http://deb.debian.org/debian unstable/main amd64 libfelix-gogo-runtime-java all 0.16.2-1.1 [114 kB] Get: 68 http://deb.debian.org/debian unstable/main amd64 libosgi-annotation-java all 8.1.0-1 [9436 B] Get: 69 http://deb.debian.org/debian unstable/main amd64 libosgi-core-java all 8.0.0-2 [182 kB] Get: 70 http://deb.debian.org/debian unstable/main amd64 libfelix-resolver-java all 1.16.0-1 [180 kB] Get: 71 http://deb.debian.org/debian unstable/main amd64 libhawtjni-runtime-java all 1.18-1 [36.3 kB] Get: 72 http://deb.debian.org/debian unstable/main amd64 libjansi-native-java all 1.8-2 [26.0 kB] Get: 73 http://deb.debian.org/debian unstable/main amd64 libjansi1-java all 1.18-3 [66.5 kB] Get: 74 http://deb.debian.org/debian unstable/main amd64 libjline2-java all 2.14.6-5 [151 kB] Get: 75 http://deb.debian.org/debian unstable/main amd64 libosgi-compendium-java all 7.0.0-1 [477 kB] Get: 76 http://deb.debian.org/debian unstable/main amd64 libslf4j-java all 1.7.32-1 [144 kB] Get: 77 http://deb.debian.org/debian unstable/main amd64 libxz-java all 1.9-1 [143 kB] Get: 78 http://deb.debian.org/debian unstable/main amd64 libyaml-snake-java all 1.33-2 [321 kB] Get: 79 http://deb.debian.org/debian unstable/main amd64 bnd all 5.0.1-5 [10.1 MB] Get: 80 http://deb.debian.org/debian unstable/main amd64 dctrl-tools amd64 2.24-3+b1 [104 kB] Get: 81 http://deb.debian.org/debian unstable/main amd64 libdebhelper-perl all 13.15.3 [88.0 kB] Get: 82 http://deb.debian.org/debian unstable/main amd64 libtool all 2.4.7-7 [517 kB] Get: 83 http://deb.debian.org/debian unstable/main amd64 dh-autoreconf all 20 [17.1 kB] Get: 84 http://deb.debian.org/debian unstable/main amd64 libarchive-zip-perl all 1.68-1 [104 kB] Get: 85 http://deb.debian.org/debian unstable/main amd64 libparams-util-perl amd64 1.102-3 [24.0 kB] Get: 86 http://deb.debian.org/debian unstable/main amd64 libsub-install-perl all 0.929-1 [10.5 kB] Get: 87 http://deb.debian.org/debian unstable/main amd64 libdata-optlist-perl all 0.114-1 [10.6 kB] Get: 88 http://deb.debian.org/debian unstable/main amd64 libsub-exporter-perl all 0.990-1 [50.6 kB] Get: 89 http://deb.debian.org/debian unstable/main amd64 libsub-prototype-perl amd64 0.03-2+b2 [9744 B] Get: 90 http://deb.debian.org/debian unstable/main amd64 libsub-override-perl all 0.11-1 [10.4 kB] Get: 91 http://deb.debian.org/debian unstable/main amd64 libfile-stripnondeterminism-perl all 1.13.1-1 [19.4 kB] Get: 92 http://deb.debian.org/debian unstable/main amd64 dh-strip-nondeterminism all 1.13.1-1 [8620 B] Get: 93 http://deb.debian.org/debian unstable/main amd64 libelf1t64 amd64 0.191-1+b1 [189 kB] Get: 94 http://deb.debian.org/debian unstable/main amd64 dwz amd64 0.15-1+b1 [110 kB] Get: 95 http://deb.debian.org/debian unstable/main amd64 gettext amd64 0.21-14+b1 [1301 kB] Get: 96 http://deb.debian.org/debian unstable/main amd64 intltool-debian all 0.35.0+20060710.6 [22.9 kB] Get: 97 http://deb.debian.org/debian unstable/main amd64 po-debconf all 1.0.21+nmu1 [248 kB] Get: 98 http://deb.debian.org/debian unstable/main amd64 debhelper all 13.15.3 [901 kB] Get: 99 http://deb.debian.org/debian unstable/main amd64 libgtk2.0-common all 2.24.33-4 [2661 kB] Get: 100 http://deb.debian.org/debian unstable/main amd64 libatk1.0-0t64 amd64 2.52.0-1 [50.8 kB] Get: 101 http://deb.debian.org/debian unstable/main amd64 libbrotli1 amd64 1.1.0-2+b3 [305 kB] Get: 102 http://deb.debian.org/debian unstable/main amd64 libfreetype6 amd64 2.13.2+dfsg-1+b4 [439 kB] Get: 103 http://deb.debian.org/debian unstable/main amd64 fonts-dejavu-mono all 2.37-8 [489 kB] Get: 104 http://deb.debian.org/debian unstable/main amd64 fonts-dejavu-core all 2.37-8 [840 kB] Get: 105 http://deb.debian.org/debian unstable/main amd64 fontconfig-config amd64 2.15.0-1.1 [317 kB] Get: 106 http://deb.debian.org/debian unstable/main amd64 libfontconfig1 amd64 2.15.0-1.1 [388 kB] Get: 107 http://deb.debian.org/debian unstable/main amd64 libpixman-1-0 amd64 0.42.2-1+b1 [556 kB] Get: 108 http://deb.debian.org/debian unstable/main amd64 libxau6 amd64 1:1.0.9-1+b1 [18.1 kB] Get: 109 http://deb.debian.org/debian unstable/main amd64 libbsd0 amd64 0.12.2-1 [131 kB] Get: 110 http://deb.debian.org/debian unstable/main amd64 libxdmcp6 amd64 1:1.1.2-3+b1 [24.3 kB] Get: 111 http://deb.debian.org/debian unstable/main amd64 libxcb1 amd64 1.17.0-2 [144 kB] Get: 112 http://deb.debian.org/debian unstable/main amd64 libx11-data all 2:1.8.7-1 [328 kB] Get: 113 http://deb.debian.org/debian unstable/main amd64 libx11-6 amd64 2:1.8.7-1+b1 [799 kB] Get: 114 http://deb.debian.org/debian unstable/main amd64 libxcb-render0 amd64 1.17.0-2 [115 kB] Get: 115 http://deb.debian.org/debian unstable/main amd64 libxcb-shm0 amd64 1.17.0-2 [105 kB] Get: 116 http://deb.debian.org/debian unstable/main amd64 libxext6 amd64 2:1.3.4-1+b1 [52.9 kB] Get: 117 http://deb.debian.org/debian unstable/main amd64 libxrender1 amd64 1:0.9.10-1.1+b1 [27.9 kB] Get: 118 http://deb.debian.org/debian unstable/main amd64 libcairo2 amd64 1.18.0-3+b1 [531 kB] Get: 119 http://deb.debian.org/debian unstable/main amd64 libavahi-common-data amd64 0.8-13+b2 [112 kB] Get: 120 http://deb.debian.org/debian unstable/main amd64 libavahi-common3 amd64 0.8-13+b2 [43.3 kB] Get: 121 http://deb.debian.org/debian unstable/main amd64 libdbus-1-3 amd64 1.14.10-4+b1 [203 kB] Get: 122 http://deb.debian.org/debian unstable/main amd64 libavahi-client3 amd64 0.8-13+b2 [47.0 kB] Get: 123 http://deb.debian.org/debian unstable/main amd64 libkrb5support0 amd64 1.20.1-6+b1 [33.3 kB] Get: 124 http://deb.debian.org/debian unstable/main amd64 libcom-err2 amd64 1.47.1-1 [22.9 kB] Get: 125 http://deb.debian.org/debian unstable/main amd64 libk5crypto3 amd64 1.20.1-6+b1 [79.8 kB] Get: 126 http://deb.debian.org/debian unstable/main amd64 libkeyutils1 amd64 1.6.3-3 [8952 B] Get: 127 http://deb.debian.org/debian unstable/main amd64 libkrb5-3 amd64 1.20.1-6+b1 [333 kB] Get: 128 http://deb.debian.org/debian unstable/main amd64 libgssapi-krb5-2 amd64 1.20.1-6+b1 [135 kB] Get: 129 http://deb.debian.org/debian unstable/main amd64 libcups2t64 amd64 2.4.7-1.2+b1 [247 kB] Get: 130 http://deb.debian.org/debian unstable/main amd64 fontconfig amd64 2.15.0-1.1 [463 kB] Get: 131 http://deb.debian.org/debian unstable/main amd64 libfribidi0 amd64 1.0.13-3+b1 [71.4 kB] Get: 132 http://deb.debian.org/debian unstable/main amd64 libgraphite2-3 amd64 1.3.14-2 [74.9 kB] Get: 133 http://deb.debian.org/debian unstable/main amd64 libharfbuzz0b amd64 8.3.0-2+b1 [2214 kB] Get: 134 http://deb.debian.org/debian unstable/main amd64 libthai-data all 0.1.29-2 [168 kB] Get: 135 http://deb.debian.org/debian unstable/main amd64 libdatrie1 amd64 0.2.13-3 [37.7 kB] Get: 136 http://deb.debian.org/debian unstable/main amd64 libthai0 amd64 0.1.29-2 [49.1 kB] Get: 137 http://deb.debian.org/debian unstable/main amd64 libpango-1.0-0 amd64 1.52.2+ds-1 [218 kB] Get: 138 http://deb.debian.org/debian unstable/main amd64 libpangoft2-1.0-0 amd64 1.52.2+ds-1 [48.1 kB] Get: 139 http://deb.debian.org/debian unstable/main amd64 libpangocairo-1.0-0 amd64 1.52.2+ds-1 [35.0 kB] Get: 140 http://deb.debian.org/debian unstable/main amd64 libxcomposite1 amd64 1:0.4.5-1+b1 [14.9 kB] Get: 141 http://deb.debian.org/debian unstable/main amd64 libxfixes3 amd64 1:6.0.0-2+b1 [20.3 kB] Get: 142 http://deb.debian.org/debian unstable/main amd64 libxcursor1 amd64 1:1.2.1-1+b1 [36.2 kB] Get: 143 http://deb.debian.org/debian unstable/main amd64 libxdamage1 amd64 1:1.1.6-1+b1 [15.5 kB] Get: 144 http://deb.debian.org/debian unstable/main amd64 libxi6 amd64 2:1.8.1-1 [79.0 kB] Get: 145 http://deb.debian.org/debian unstable/main amd64 libxinerama1 amd64 2:1.1.4-3+b1 [16.0 kB] Get: 146 http://deb.debian.org/debian unstable/main amd64 libxrandr2 amd64 2:1.5.4-1 [36.1 kB] Get: 147 http://deb.debian.org/debian unstable/main amd64 libgtk2.0-0t64 amd64 2.24.33-4 [1816 kB] Get: 148 http://deb.debian.org/debian unstable/main amd64 libglvnd0 amd64 1.7.0-1+b1 [56.3 kB] Get: 149 http://deb.debian.org/debian unstable/main amd64 libdrm-common all 2.4.120-2 [7688 B] Get: 150 http://deb.debian.org/debian unstable/main amd64 libdrm2 amd64 2.4.120-2 [38.1 kB] Get: 151 http://deb.debian.org/debian unstable/main amd64 libglapi-mesa amd64 24.0.7-1 [36.4 kB] Get: 152 http://deb.debian.org/debian unstable/main amd64 libx11-xcb1 amd64 2:1.8.7-1+b1 [232 kB] Get: 153 http://deb.debian.org/debian unstable/main amd64 libxcb-dri2-0 amd64 1.17.0-2 [106 kB] Get: 154 http://deb.debian.org/debian unstable/main amd64 libxcb-dri3-0 amd64 1.17.0-2 [107 kB] Get: 155 http://deb.debian.org/debian unstable/main amd64 libxcb-glx0 amd64 1.17.0-2 [122 kB] Get: 156 http://deb.debian.org/debian unstable/main amd64 libxcb-present0 amd64 1.17.0-2 [105 kB] Get: 157 http://deb.debian.org/debian unstable/main amd64 libxcb-randr0 amd64 1.17.0-2 [116 kB] Get: 158 http://deb.debian.org/debian unstable/main amd64 libxcb-sync1 amd64 1.17.0-2 [108 kB] Get: 159 http://deb.debian.org/debian unstable/main amd64 libxcb-xfixes0 amd64 1.17.0-2 [109 kB] Get: 160 http://deb.debian.org/debian unstable/main amd64 libxshmfence1 amd64 1.3-1+b1 [8852 B] Get: 161 http://deb.debian.org/debian unstable/main amd64 libxxf86vm1 amd64 1:1.1.4-1+b2 [20.8 kB] Get: 162 http://deb.debian.org/debian unstable/main amd64 libvulkan1 amd64 1.3.280.0-1 [123 kB] Get: 163 http://deb.debian.org/debian unstable/main amd64 libdrm-amdgpu1 amd64 2.4.120-2 [21.4 kB] Get: 164 http://deb.debian.org/debian unstable/main amd64 libpciaccess0 amd64 0.17-3+b1 [51.9 kB] Get: 165 http://deb.debian.org/debian unstable/main amd64 libdrm-intel1 amd64 2.4.120-2 [62.7 kB] Get: 166 http://deb.debian.org/debian unstable/main amd64 libdrm-nouveau2 amd64 2.4.120-2 [19.3 kB] Get: 167 http://deb.debian.org/debian unstable/main amd64 libdrm-radeon1 amd64 2.4.120-2 [22.2 kB] Get: 168 http://deb.debian.org/debian unstable/main amd64 libedit2 amd64 3.1-20230828-1+b1 [93.5 kB] Get: 169 http://deb.debian.org/debian unstable/main amd64 libz3-4 amd64 4.8.12-3.1+b2 [7346 kB] Get: 170 http://deb.debian.org/debian unstable/main amd64 libllvm17t64 amd64 1:17.0.6-12 [23.7 MB] Get: 171 http://deb.debian.org/debian unstable/main amd64 libsensors-config all 1:3.6.0-9 [14.6 kB] Get: 172 http://deb.debian.org/debian unstable/main amd64 libsensors5 amd64 1:3.6.0-9 [34.6 kB] Get: 173 http://deb.debian.org/debian unstable/main amd64 libgl1-mesa-dri amd64 24.0.7-1 [8277 kB] Get: 174 http://deb.debian.org/debian unstable/main amd64 libglx-mesa0 amd64 24.0.7-1 [151 kB] Get: 175 http://deb.debian.org/debian unstable/main amd64 libglx0 amd64 1.7.0-1+b1 [35.0 kB] Get: 176 http://deb.debian.org/debian unstable/main amd64 libgl1 amd64 1.7.0-1+b1 [89.8 kB] Get: 177 http://deb.debian.org/debian unstable/main amd64 libasound2-data all 1.2.11-1 [20.9 kB] Get: 178 http://deb.debian.org/debian unstable/main amd64 libasound2t64 amd64 1.2.11-1+b1 [369 kB] Get: 179 http://deb.debian.org/debian unstable/main amd64 libgif7 amd64 5.2.2-1 [43.9 kB] Get: 180 http://deb.debian.org/debian unstable/main amd64 x11-common all 1:7.7+23 [252 kB] Get: 181 http://deb.debian.org/debian unstable/main amd64 libxtst6 amd64 2:1.2.3-1.1+b1 [25.9 kB] Get: 182 http://deb.debian.org/debian unstable/main amd64 openjdk-17-jre amd64 17.0.11+9-1 [185 kB] Get: 183 http://deb.debian.org/debian unstable/main amd64 default-jre amd64 2:1.17-75 [1056 B] Get: 184 http://deb.debian.org/debian unstable/main amd64 openjdk-17-jdk-headless amd64 17.0.11+9-1 [71.4 MB] Get: 185 http://deb.debian.org/debian unstable/main amd64 default-jdk-headless amd64 2:1.17-75 [1108 B] Get: 186 http://deb.debian.org/debian unstable/main amd64 openjdk-17-jdk amd64 17.0.11+9-1 [10.4 kB] Get: 187 http://deb.debian.org/debian unstable/main amd64 default-jdk amd64 2:1.17-75 [1068 B] Get: 188 http://deb.debian.org/debian unstable/main amd64 libassuan0 amd64 2.5.6-1+b1 [50.4 kB] Get: 189 http://deb.debian.org/debian unstable/main amd64 gpgconf amd64 2.2.43-6 [119 kB] Get: 190 http://deb.debian.org/debian unstable/main amd64 libksba8 amd64 1.6.6-1 [131 kB] Get: 191 http://deb.debian.org/debian unstable/main amd64 libsasl2-modules-db amd64 2.1.28+dfsg1-6 [19.5 kB] Get: 192 http://deb.debian.org/debian unstable/main amd64 libsasl2-2 amd64 2.1.28+dfsg1-6 [56.9 kB] Get: 193 http://deb.debian.org/debian unstable/main amd64 libldap-2.5-0 amd64 2.5.17+dfsg-1 [186 kB] Get: 194 http://deb.debian.org/debian unstable/main amd64 libnpth0t64 amd64 1.6-3.1 [17.9 kB] Get: 195 http://deb.debian.org/debian unstable/main amd64 dirmngr amd64 2.2.43-6 [363 kB] Get: 196 http://deb.debian.org/debian unstable/main amd64 gnupg-l10n all 2.2.43-6 [701 kB] Get: 197 http://deb.debian.org/debian unstable/main amd64 gnupg-utils amd64 2.2.43-6 [500 kB] Get: 198 http://deb.debian.org/debian unstable/main amd64 gpg amd64 2.2.43-6 [523 kB] Get: 199 http://deb.debian.org/debian unstable/main amd64 pinentry-curses amd64 1.2.1-3+b2 [78.3 kB] Get: 200 http://deb.debian.org/debian unstable/main amd64 gpg-agent amd64 2.2.43-6 [248 kB] Get: 201 http://deb.debian.org/debian unstable/main amd64 gpg-wks-client amd64 2.2.43-6 [100 kB] Get: 202 http://deb.debian.org/debian unstable/main amd64 gpgsm amd64 2.2.43-6 [250 kB] Get: 203 http://deb.debian.org/debian unstable/main amd64 gnupg all 2.2.43-6 [374 kB] Get: 204 http://deb.debian.org/debian unstable/main amd64 libfile-dirlist-perl all 0.05-3 [7600 B] Get: 205 http://deb.debian.org/debian unstable/main amd64 libfile-which-perl all 1.27-2 [15.1 kB] Get: 206 http://deb.debian.org/debian unstable/main amd64 libfile-homedir-perl all 1.006-2 [42.4 kB] Get: 207 http://deb.debian.org/debian unstable/main amd64 libfile-touch-perl all 0.12-2 [8816 B] Get: 208 http://deb.debian.org/debian unstable/main amd64 libio-pty-perl amd64 1:1.20-1+b1 [34.4 kB] Get: 209 http://deb.debian.org/debian unstable/main amd64 libipc-run-perl all 20231003.0-2 [101 kB] Get: 210 http://deb.debian.org/debian unstable/main amd64 libclass-method-modifiers-perl all 2.15-1 [18.0 kB] Get: 211 http://deb.debian.org/debian unstable/main amd64 libclass-xsaccessor-perl amd64 1.19-4+b3 [36.2 kB] Get: 212 http://deb.debian.org/debian unstable/main amd64 libb-hooks-op-check-perl amd64 0.22-3+b1 [10.6 kB] Get: 213 http://deb.debian.org/debian unstable/main amd64 libdynaloader-functions-perl all 0.003-3 [12.7 kB] Get: 214 http://deb.debian.org/debian unstable/main amd64 libdevel-callchecker-perl amd64 0.009-1 [15.9 kB] Get: 215 http://deb.debian.org/debian unstable/main amd64 libparams-classify-perl amd64 0.015-2+b3 [22.4 kB] Get: 216 http://deb.debian.org/debian unstable/main amd64 libmodule-runtime-perl all 0.016-2 [19.6 kB] Get: 217 http://deb.debian.org/debian unstable/main amd64 libimport-into-perl all 1.002005-2 [11.3 kB] Get: 218 http://deb.debian.org/debian unstable/main amd64 librole-tiny-perl all 2.002004-1 [21.4 kB] Get: 219 http://deb.debian.org/debian unstable/main amd64 libsub-quote-perl all 2.006008-1 [21.8 kB] Get: 220 http://deb.debian.org/debian unstable/main amd64 libmoo-perl all 2.005005-1 [58.0 kB] Get: 221 http://deb.debian.org/debian unstable/main amd64 libencode-locale-perl all 1.05-3 [12.9 kB] Get: 222 http://deb.debian.org/debian unstable/main amd64 libtimedate-perl all 2.3300-2 [39.3 kB] Get: 223 http://deb.debian.org/debian unstable/main amd64 libhttp-date-perl all 6.06-1 [10.7 kB] Get: 224 http://deb.debian.org/debian unstable/main amd64 libfile-listing-perl all 6.16-1 [12.4 kB] Get: 225 http://deb.debian.org/debian unstable/main amd64 libhtml-tagset-perl all 3.24-1 [14.7 kB] Get: 226 http://deb.debian.org/debian unstable/main amd64 liburi-perl all 5.28-1 [98.6 kB] Get: 227 http://deb.debian.org/debian unstable/main amd64 libhtml-parser-perl amd64 3.82-1 [98.9 kB] Get: 228 http://deb.debian.org/debian unstable/main amd64 libhtml-tree-perl all 5.07-3 [211 kB] Get: 229 http://deb.debian.org/debian unstable/main amd64 libclone-perl amd64 0.46-1+b2 [13.7 kB] Get: 230 http://deb.debian.org/debian unstable/main amd64 libio-html-perl all 1.004-3 [16.2 kB] Get: 231 http://deb.debian.org/debian unstable/main amd64 liblwp-mediatypes-perl all 6.04-2 [20.2 kB] Get: 232 http://deb.debian.org/debian unstable/main amd64 libhttp-message-perl all 6.45-1 [82.0 kB] Get: 233 http://deb.debian.org/debian unstable/main amd64 libhttp-cookies-perl all 6.11-1 [19.1 kB] Get: 234 http://deb.debian.org/debian unstable/main amd64 libhttp-negotiate-perl all 6.01-2 [13.1 kB] Get: 235 http://deb.debian.org/debian unstable/main amd64 perl-openssl-defaults amd64 7+b2 [6724 B] Get: 236 http://deb.debian.org/debian unstable/main amd64 libnet-ssleay-perl amd64 1.94-1+b1 [339 kB] Get: 237 http://deb.debian.org/debian unstable/main amd64 libio-socket-ssl-perl all 2.085-1 [218 kB] Get: 238 http://deb.debian.org/debian unstable/main amd64 libnet-http-perl all 6.23-1 [23.9 kB] Get: 239 http://deb.debian.org/debian unstable/main amd64 liblwp-protocol-https-perl all 6.14-1 [10.8 kB] Get: 240 http://deb.debian.org/debian unstable/main amd64 libtry-tiny-perl all 0.31-2 [22.6 kB] Get: 241 http://deb.debian.org/debian unstable/main amd64 libwww-robotrules-perl all 6.02-1 [12.9 kB] Get: 242 http://deb.debian.org/debian unstable/main amd64 libwww-perl all 6.77-1 [183 kB] Get: 243 http://deb.debian.org/debian unstable/main amd64 patchutils amd64 0.4.2-1 [77.5 kB] Get: 244 http://deb.debian.org/debian unstable/main amd64 wdiff amd64 1.2.2-6 [119 kB] Get: 245 http://deb.debian.org/debian unstable/main amd64 devscripts all 2.23.7 [1068 kB] Get: 246 http://deb.debian.org/debian unstable/main amd64 fastjar amd64 2:0.98-7 [80.1 kB] Get: 247 http://deb.debian.org/debian unstable/main amd64 ivy all 2.5.2-1 [1295 kB] Get: 248 http://deb.debian.org/debian unstable/main amd64 libasm-java all 9.7-1 [394 kB] Get: 249 http://deb.debian.org/debian unstable/main amd64 libbsf-java all 1:2.4.0-8 [76.3 kB] Get: 250 http://deb.debian.org/debian unstable/main amd64 libcommons-cli-java all 1.6.0-1 [60.4 kB] Get: 251 http://deb.debian.org/debian unstable/main amd64 libapache-pom-java all 29-2 [5276 B] Get: 252 http://deb.debian.org/debian unstable/main amd64 libcommons-parent-java all 56-1 [10.8 kB] Get: 253 http://deb.debian.org/debian unstable/main amd64 libcommons-logging-java all 1.3.0-1 [68.6 kB] Get: 254 http://deb.debian.org/debian unstable/main amd64 libjansi-java all 2.4.1-2 [100 kB] Get: 255 http://deb.debian.org/debian unstable/main amd64 libjsp-api-java all 2.3.4-3 [53.7 kB] Get: 256 http://deb.debian.org/debian unstable/main amd64 libqdox-java all 1.12.1-3 [172 kB] Get: 257 http://deb.debian.org/debian unstable/main amd64 libservlet-api-java all 4.0.1-2 [81.0 kB] Get: 258 http://deb.debian.org/debian unstable/main amd64 libxpp3-java all 1.1.4c-3 [292 kB] Get: 259 http://deb.debian.org/debian unstable/main amd64 libxstream-java all 1.4.20-1 [565 kB] Get: 260 http://deb.debian.org/debian unstable/main amd64 groovy all 2.4.21-10 [12.8 MB] Get: 261 http://deb.debian.org/debian unstable/main amd64 libatinject-jsr330-api-java all 1.0+ds1-5 [5312 B] Get: 262 http://deb.debian.org/debian unstable/main amd64 libcommons-collections3-java all 3.2.2-3 [530 kB] Get: 263 http://deb.debian.org/debian unstable/main amd64 libcommons-compress-java all 1.25.0-1 [635 kB] Get: 264 http://deb.debian.org/debian unstable/main amd64 libcommons-io-java all 2.16.1-1 [480 kB] Get: 265 http://deb.debian.org/debian unstable/main amd64 libcommons-lang-java all 2.6-10 [273 kB] Get: 266 http://deb.debian.org/debian unstable/main amd64 liberror-prone-java all 2.18.0-1 [22.5 kB] Get: 267 http://deb.debian.org/debian unstable/main amd64 libjsr305-java all 0.1~+svn49-11 [26.9 kB] Get: 268 http://deb.debian.org/debian unstable/main amd64 libguava-java all 32.0.1-1 [2708 kB] Get: 269 http://deb.debian.org/debian unstable/main amd64 libcommons-codec-java all 1.16.0-1 [297 kB] Get: 270 http://deb.debian.org/debian unstable/main amd64 libhttpcore-java all 4.4.16-1 [636 kB] Get: 271 http://deb.debian.org/debian unstable/main amd64 libhttpclient-java all 4.5.14-1 [1247 kB] Get: 272 http://deb.debian.org/debian unstable/main amd64 libjarjar-java all 1.4+svn142-12 [205 kB] Get: 273 http://deb.debian.org/debian unstable/main amd64 libjcip-annotations-java all 20060626-6 [11.8 kB] Get: 274 http://deb.debian.org/debian unstable/main amd64 libjna-jni amd64 5.14.0-1 [64.0 kB] Get: 275 http://deb.debian.org/debian unstable/main amd64 libjna-java all 5.14.0-1 [237 kB] Get: 276 http://deb.debian.org/debian unstable/main amd64 libjzlib-java all 1.1.3-3 [79.4 kB] Get: 277 http://deb.debian.org/debian unstable/main amd64 libjsch-java all 0.1.55-1 [298 kB] Get: 278 http://deb.debian.org/debian unstable/main amd64 libminlog-java all 1.3.0-1.1 [7928 B] Get: 279 http://deb.debian.org/debian unstable/main amd64 libobjenesis-java all 3.3-3 [41.3 kB] Get: 280 http://deb.debian.org/debian unstable/main amd64 libreflectasm-java all 1.11.9+dfsg-4 [25.0 kB] Get: 281 http://deb.debian.org/debian unstable/main amd64 libkryo-java all 2.20-7 [158 kB] Get: 282 http://deb.debian.org/debian unstable/main amd64 liblogback-java all 1:1.2.11-5 [701 kB] Get: 283 http://deb.debian.org/debian unstable/main amd64 libnative-platform-jni amd64 0.14-6 [11.5 kB] Get: 284 http://deb.debian.org/debian unstable/main amd64 libnative-platform-java all 0.14-6 [69.8 kB] Get: 285 http://deb.debian.org/debian unstable/main amd64 libxml-commons-external-java all 1.4.01-6 [240 kB] Get: 286 http://deb.debian.org/debian unstable/main amd64 libxml-commons-resolver1.1-java all 1.2-11 [98.3 kB] Get: 287 http://deb.debian.org/debian unstable/main amd64 libxerces2-java all 2.12.2-1 [1440 kB] Get: 288 http://deb.debian.org/debian unstable/main amd64 libnekohtml-java all 1.9.22.noko2-0.1 [125 kB] Get: 289 http://deb.debian.org/debian unstable/main amd64 libxbean-reflect-java all 4.5-8 [133 kB] Get: 290 http://deb.debian.org/debian unstable/main amd64 libgradle-core-java all 4.4.1-20 [4293 kB] Get: 291 http://deb.debian.org/debian unstable/main amd64 libbcprov-java all 1.77-1 [5300 kB] Get: 292 http://deb.debian.org/debian unstable/main amd64 libbcpg-java all 1.77-1 [428 kB] Get: 293 http://deb.debian.org/debian unstable/main amd64 libbsh-java all 2.0b4-20 [291 kB] Get: 294 http://deb.debian.org/debian unstable/main amd64 libdd-plist-java all 1.20-1.1 [72.6 kB] Get: 295 http://deb.debian.org/debian unstable/main amd64 libjaxen-java all 1.1.6-4 [214 kB] Get: 296 http://deb.debian.org/debian unstable/main amd64 libdom4j-java all 2.1.4-1 [312 kB] Get: 297 http://deb.debian.org/debian unstable/main amd64 libbcel-java all 6.5.0-2 [634 kB] Get: 298 http://deb.debian.org/debian unstable/main amd64 libjformatstring-java all 0.10~20131207-2.1 [34.5 kB] Get: 299 http://deb.debian.org/debian unstable/main amd64 libfindbugs-java all 3.1.0~preview2-3 [3502 kB] Get: 300 http://deb.debian.org/debian unstable/main amd64 libgoogle-gson-java all 2.10.1-1 [262 kB] Get: 301 http://deb.debian.org/debian unstable/main amd64 libaopalliance-java all 20070526-7 [8572 B] Get: 302 http://deb.debian.org/debian unstable/main amd64 libguice-java all 4.2.3-2 [1435 kB] Get: 303 http://deb.debian.org/debian unstable/main amd64 libjatl-java all 0.2.3-1.1 [29.0 kB] Get: 304 http://deb.debian.org/debian unstable/main amd64 libjcifs-java all 1.3.19-2 [394 kB] Get: 305 http://deb.debian.org/debian unstable/main amd64 libeclipse-jdt-annotation-java all 2.2.700+eclipse4.26-2 [25.3 kB] Get: 306 http://deb.debian.org/debian unstable/main amd64 libjavaewah-java all 1.2.3-1 [159 kB] Get: 307 http://deb.debian.org/debian unstable/main amd64 libel-api-java all 3.0.0-3 [64.9 kB] Get: 308 http://deb.debian.org/debian unstable/main amd64 libwebsocket-api-java all 1.1-2 [40.1 kB] Get: 309 http://deb.debian.org/debian unstable/main amd64 libjetty9-java all 9.4.54-1 [2980 kB] Get: 310 http://deb.debian.org/debian unstable/main amd64 libjgit-java all 6.7.0-1 [3153 kB] Get: 311 http://deb.debian.org/debian unstable/main amd64 libjs-jquery all 3.6.1+dfsg+~3.5.14-1 [326 kB] Get: 312 http://deb.debian.org/debian unstable/main amd64 libcommons-lang3-java all 3.14.0-1 [621 kB] Get: 313 http://deb.debian.org/debian unstable/main amd64 libplexus-utils2-java all 3.4.2-1 [258 kB] Get: 314 http://deb.debian.org/debian unstable/main amd64 libwagon-provider-api-java all 3.5.3-1 [48.2 kB] Get: 315 http://deb.debian.org/debian unstable/main amd64 libmaven-resolver-java all 1.6.3-1 [548 kB] Get: 316 http://deb.debian.org/debian unstable/main amd64 libgeronimo-annotation-1.3-spec-java all 1.3-1 [11.1 kB] Get: 317 http://deb.debian.org/debian unstable/main amd64 libmaven-parent-java all 35-1 [6140 B] Get: 318 http://deb.debian.org/debian unstable/main amd64 libmaven-shared-utils-java all 3.3.4-1 [138 kB] Get: 319 http://deb.debian.org/debian unstable/main amd64 libplexus-cipher-java all 2.0-1 [14.9 kB] Get: 320 http://deb.debian.org/debian unstable/main amd64 libplexus-classworlds-java all 2.7.0-1 [50.6 kB] Get: 321 http://deb.debian.org/debian unstable/main amd64 libplexus-component-annotations-java all 2.1.1-1 [7660 B] Get: 322 http://deb.debian.org/debian unstable/main amd64 libplexus-interpolation-java all 1.26-1 [76.8 kB] Get: 323 http://deb.debian.org/debian unstable/main amd64 libplexus-sec-dispatcher-java all 2.0-3 [28.3 kB] Get: 324 http://deb.debian.org/debian unstable/main amd64 libgeronimo-interceptor-3.0-spec-java all 1.0.1-4 [8484 B] Get: 325 http://deb.debian.org/debian unstable/main amd64 libcdi-api-java all 1.2-3 [54.3 kB] Get: 326 http://deb.debian.org/debian unstable/main amd64 libsisu-inject-java all 0.3.4-2 [347 kB] Get: 327 http://deb.debian.org/debian unstable/main amd64 libsisu-plexus-java all 0.3.4-3 [181 kB] Get: 328 http://deb.debian.org/debian unstable/main amd64 libmaven3-core-java all 3.8.7-2 [1573 kB] Get: 329 http://deb.debian.org/debian unstable/main amd64 libplexus-container-default-java all 2.1.1-1 [193 kB] Get: 330 http://deb.debian.org/debian unstable/main amd64 libpolyglot-maven-java all 0.8~tobrien+git20120905-10 [74.9 kB] Get: 331 http://deb.debian.org/debian unstable/main amd64 librhino-java all 1.7.14-2.1 [1357 kB] Get: 332 http://deb.debian.org/debian unstable/main amd64 libsimple-http-java all 4.1.21-1.1 [211 kB] Get: 333 http://deb.debian.org/debian unstable/main amd64 libwagon-file-java all 3.5.3-1 [8388 B] Get: 334 http://deb.debian.org/debian unstable/main amd64 libjsoup-java all 1.15.3-1 [431 kB] Get: 335 http://deb.debian.org/debian unstable/main amd64 libwagon-http-java all 3.5.3-1 [49.5 kB] Get: 336 http://deb.debian.org/debian unstable/main amd64 libjcommander-java all 1.71-4 [73.0 kB] Get: 337 http://deb.debian.org/debian unstable/main amd64 testng all 6.9.12-4 [795 kB] Get: 338 http://deb.debian.org/debian unstable/main amd64 libgradle-plugins-java all 4.4.1-20 [5206 kB] Get: 339 http://deb.debian.org/debian unstable/main amd64 gradle all 4.4.1-20 [398 kB] Get: 340 http://deb.debian.org/debian unstable/main amd64 maven-repo-helper all 1.11 [142 kB] Get: 341 http://deb.debian.org/debian unstable/main amd64 gradle-debian-helper all 2.4 [24.5 kB] Get: 342 http://deb.debian.org/debian unstable/main amd64 jarwrapper all 0.79 [10.1 kB] Get: 343 http://deb.debian.org/debian unstable/main amd64 javahelper all 0.79 [84.6 kB] Get: 344 http://deb.debian.org/debian unstable/main amd64 libbyte-buddy-java all 1.14.13-1 [4709 kB] Get: 345 http://deb.debian.org/debian unstable/main amd64 libcommons-math3-java all 3.6.1-3 [2018 kB] Get: 346 http://deb.debian.org/debian unstable/main amd64 libjackson2-annotations-java all 2.14.0-1 [68.8 kB] Get: 347 http://deb.debian.org/debian unstable/main amd64 libjackson2-core-java all 2.14.1-1 [447 kB] Get: 348 http://deb.debian.org/debian unstable/main amd64 libjackson2-databind-java all 2.14.0-1 [1584 kB] Get: 349 http://deb.debian.org/debian unstable/main amd64 liblz4-jni amd64 1.8.0-4 [10.1 kB] Get: 350 http://deb.debian.org/debian unstable/main amd64 liblz4-java all 1.8.0-4 [116 kB] Get: 351 http://deb.debian.org/debian unstable/main amd64 libmockito-java all 2.23.0-2 [479 kB] Get: 352 http://deb.debian.org/debian unstable/main amd64 libredberry-pipe-java all 1.0.0~alpha0-3 [62.7 kB] Get: 353 http://deb.debian.org/debian unstable/main amd64 libtrove3-java all 3.0.3-5 [2146 kB] Fetched 304 MB in 26s (11.5 MB/s) debconf: delaying package configuration, since apt-utils is not installed Selecting previously unselected package libpipeline1:amd64. (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 19718 files and directories currently installed.) Preparing to unpack .../libpipeline1_1.5.7-2_amd64.deb ... Unpacking libpipeline1:amd64 (1.5.7-2) ... Selecting previously unselected package binfmt-support. Preparing to unpack .../binfmt-support_2.2.2-7_amd64.deb ... Unpacking binfmt-support (2.2.2-7) ... Selecting previously unselected package libpython3.11-minimal:amd64. Preparing to unpack .../libpython3.11-minimal_3.11.9-1_amd64.deb ... Unpacking libpython3.11-minimal:amd64 (3.11.9-1) ... Selecting previously unselected package libexpat1:amd64. Preparing to unpack .../libexpat1_2.6.2-1_amd64.deb ... Unpacking libexpat1:amd64 (2.6.2-1) ... Selecting previously unselected package python3.11-minimal. Preparing to unpack .../python3.11-minimal_3.11.9-1_amd64.deb ... Unpacking python3.11-minimal (3.11.9-1) ... Setting up libpython3.11-minimal:amd64 (3.11.9-1) ... Setting up libexpat1:amd64 (2.6.2-1) ... Setting up python3.11-minimal (3.11.9-1) ... Selecting previously unselected package python3-minimal. (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 20057 files and directories currently installed.) Preparing to unpack .../0-python3-minimal_3.11.8-1_amd64.deb ... Unpacking python3-minimal (3.11.8-1) ... Selecting previously unselected package media-types. Preparing to unpack .../1-media-types_10.1.0_all.deb ... Unpacking media-types (10.1.0) ... Selecting previously unselected package netbase. Preparing to unpack .../2-netbase_6.4_all.deb ... Unpacking netbase (6.4) ... Selecting previously unselected package tzdata. Preparing to unpack .../3-tzdata_2024a-4_all.deb ... Unpacking tzdata (2024a-4) ... Selecting previously unselected package readline-common. Preparing to unpack .../4-readline-common_8.2-4_all.deb ... Unpacking readline-common (8.2-4) ... Selecting previously unselected package libreadline8t64:amd64. Preparing to unpack .../5-libreadline8t64_8.2-4_amd64.deb ... Adding 'diversion of /lib/x86_64-linux-gnu/libhistory.so.8 to /lib/x86_64-linux-gnu/libhistory.so.8.usr-is-merged by libreadline8t64' Adding 'diversion of /lib/x86_64-linux-gnu/libhistory.so.8.2 to /lib/x86_64-linux-gnu/libhistory.so.8.2.usr-is-merged by libreadline8t64' Adding 'diversion of /lib/x86_64-linux-gnu/libreadline.so.8 to /lib/x86_64-linux-gnu/libreadline.so.8.usr-is-merged by libreadline8t64' Adding 'diversion of /lib/x86_64-linux-gnu/libreadline.so.8.2 to /lib/x86_64-linux-gnu/libreadline.so.8.2.usr-is-merged by libreadline8t64' Unpacking libreadline8t64:amd64 (8.2-4) ... Selecting previously unselected package libpython3.11-stdlib:amd64. Preparing to unpack .../6-libpython3.11-stdlib_3.11.9-1_amd64.deb ... Unpacking libpython3.11-stdlib:amd64 (3.11.9-1) ... Selecting previously unselected package python3.11. Preparing to unpack .../7-python3.11_3.11.9-1_amd64.deb ... Unpacking python3.11 (3.11.9-1) ... Selecting previously unselected package libpython3-stdlib:amd64. Preparing to unpack .../8-libpython3-stdlib_3.11.8-1_amd64.deb ... Unpacking libpython3-stdlib:amd64 (3.11.8-1) ... Setting up python3-minimal (3.11.8-1) ... Selecting previously unselected package python3. (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 21049 files and directories currently installed.) Preparing to unpack .../000-python3_3.11.8-1_amd64.deb ... Unpacking python3 (3.11.8-1) ... Selecting previously unselected package sensible-utils. Preparing to unpack .../001-sensible-utils_0.0.22_all.deb ... Unpacking sensible-utils (0.0.22) ... Selecting previously unselected package openssl. Preparing to unpack .../002-openssl_3.2.1-3_amd64.deb ... Unpacking openssl (3.2.1-3) ... Selecting previously unselected package ca-certificates. Preparing to unpack .../003-ca-certificates_20240203_all.deb ... Unpacking ca-certificates (20240203) ... Selecting previously unselected package libmagic-mgc. Preparing to unpack .../004-libmagic-mgc_1%3a5.45-3_amd64.deb ... Unpacking libmagic-mgc (1:5.45-3) ... Selecting previously unselected package libmagic1t64:amd64. Preparing to unpack .../005-libmagic1t64_1%3a5.45-3_amd64.deb ... Unpacking libmagic1t64:amd64 (1:5.45-3) ... Selecting previously unselected package file. Preparing to unpack .../006-file_1%3a5.45-3_amd64.deb ... Unpacking file (1:5.45-3) ... Selecting previously unselected package gettext-base. Preparing to unpack .../007-gettext-base_0.21-14+b1_amd64.deb ... Unpacking gettext-base (0.21-14+b1) ... Selecting previously unselected package libuchardet0:amd64. Preparing to unpack .../008-libuchardet0_0.0.8-1+b1_amd64.deb ... Unpacking libuchardet0:amd64 (0.0.8-1+b1) ... Selecting previously unselected package groff-base. Preparing to unpack .../009-groff-base_1.23.0-4_amd64.deb ... Unpacking groff-base (1.23.0-4) ... Selecting previously unselected package bsdextrautils. Preparing to unpack .../010-bsdextrautils_2.40.1-1_amd64.deb ... Unpacking bsdextrautils (2.40.1-1) ... Selecting previously unselected package man-db. Preparing to unpack .../011-man-db_2.12.1-1_amd64.deb ... Unpacking man-db (2.12.1-1) ... Selecting previously unselected package libgdk-pixbuf2.0-common. Preparing to unpack .../012-libgdk-pixbuf2.0-common_2.42.12+dfsg-1_all.deb ... Unpacking libgdk-pixbuf2.0-common (2.42.12+dfsg-1) ... Selecting previously unselected package libglib2.0-0t64:amd64. Preparing to unpack .../013-libglib2.0-0t64_2.80.2-1_amd64.deb ... Unpacking libglib2.0-0t64:amd64 (2.80.2-1) ... Selecting previously unselected package libicu72:amd64. Preparing to unpack .../014-libicu72_72.1-4+b1_amd64.deb ... Unpacking libicu72:amd64 (72.1-4+b1) ... Selecting previously unselected package libxml2:amd64. Preparing to unpack .../015-libxml2_2.9.14+dfsg-1.3+b3_amd64.deb ... Unpacking libxml2:amd64 (2.9.14+dfsg-1.3+b3) ... Selecting previously unselected package shared-mime-info. Preparing to unpack .../016-shared-mime-info_2.4-4_amd64.deb ... Unpacking shared-mime-info (2.4-4) ... Selecting previously unselected package libjpeg62-turbo:amd64. Preparing to unpack .../017-libjpeg62-turbo_1%3a2.1.5-3_amd64.deb ... Unpacking libjpeg62-turbo:amd64 (1:2.1.5-3) ... Selecting previously unselected package libpng16-16t64:amd64. Preparing to unpack .../018-libpng16-16t64_1.6.43-5_amd64.deb ... Unpacking libpng16-16t64:amd64 (1.6.43-5) ... Selecting previously unselected package libdeflate0:amd64. Preparing to unpack .../019-libdeflate0_1.20-1_amd64.deb ... Unpacking libdeflate0:amd64 (1.20-1) ... Selecting previously unselected package libjbig0:amd64. Preparing to unpack .../020-libjbig0_2.1-6.1+b1_amd64.deb ... Unpacking libjbig0:amd64 (2.1-6.1+b1) ... Selecting previously unselected package liblerc4:amd64. Preparing to unpack .../021-liblerc4_4.0.0+ds-4+b1_amd64.deb ... Unpacking liblerc4:amd64 (4.0.0+ds-4+b1) ... Selecting previously unselected package libsharpyuv0:amd64. Preparing to unpack .../022-libsharpyuv0_1.4.0-0.1_amd64.deb ... Unpacking libsharpyuv0:amd64 (1.4.0-0.1) ... Selecting previously unselected package libwebp7:amd64. Preparing to unpack .../023-libwebp7_1.4.0-0.1_amd64.deb ... Unpacking libwebp7:amd64 (1.4.0-0.1) ... Selecting previously unselected package libtiff6:amd64. Preparing to unpack .../024-libtiff6_4.5.1+git230720-4_amd64.deb ... Unpacking libtiff6:amd64 (4.5.1+git230720-4) ... Selecting previously unselected package libgdk-pixbuf-2.0-0:amd64. Preparing to unpack .../025-libgdk-pixbuf-2.0-0_2.42.12+dfsg-1_amd64.deb ... Unpacking libgdk-pixbuf-2.0-0:amd64 (2.42.12+dfsg-1) ... Selecting previously unselected package gtk-update-icon-cache. Preparing to unpack .../026-gtk-update-icon-cache_3.24.41-4_amd64.deb ... Unpacking gtk-update-icon-cache (3.24.41-4) ... Selecting previously unselected package hicolor-icon-theme. Preparing to unpack .../027-hicolor-icon-theme_0.18-1_all.deb ... Unpacking hicolor-icon-theme (0.18-1) ... Selecting previously unselected package adwaita-icon-theme. Preparing to unpack .../028-adwaita-icon-theme_46.0-1_all.deb ... Unpacking adwaita-icon-theme (46.0-1) ... Selecting previously unselected package ca-certificates-java. Preparing to unpack .../029-ca-certificates-java_20240118_all.deb ... Unpacking ca-certificates-java (20240118) ... Selecting previously unselected package java-common. Preparing to unpack .../030-java-common_0.75_all.deb ... Unpacking java-common (0.75) ... Selecting previously unselected package liblcms2-2:amd64. Preparing to unpack .../031-liblcms2-2_2.14-2+b1_amd64.deb ... Unpacking liblcms2-2:amd64 (2.14-2+b1) ... Selecting previously unselected package libnspr4:amd64. Preparing to unpack .../032-libnspr4_2%3a4.35-1.1+b1_amd64.deb ... Unpacking libnspr4:amd64 (2:4.35-1.1+b1) ... Selecting previously unselected package libnss3:amd64. Preparing to unpack .../033-libnss3_2%3a3.100-1_amd64.deb ... Unpacking libnss3:amd64 (2:3.100-1) ... Selecting previously unselected package libpcsclite1:amd64. Preparing to unpack .../034-libpcsclite1_2.2.2-1_amd64.deb ... Unpacking libpcsclite1:amd64 (2.2.2-1) ... Selecting previously unselected package openjdk-17-jre-headless:amd64. Preparing to unpack .../035-openjdk-17-jre-headless_17.0.11+9-1_amd64.deb ... Unpacking openjdk-17-jre-headless:amd64 (17.0.11+9-1) ... Selecting previously unselected package default-jre-headless. Preparing to unpack .../036-default-jre-headless_2%3a1.17-75_amd64.deb ... Unpacking default-jre-headless (2:1.17-75) ... Selecting previously unselected package ant. Preparing to unpack .../037-ant_1.10.14-1_all.deb ... Unpacking ant (1.10.14-1) ... Selecting previously unselected package ant-optional. Preparing to unpack .../038-ant-optional_1.10.14-1_all.deb ... Unpacking ant-optional (1.10.14-1) ... Selecting previously unselected package libantlr-java. Preparing to unpack .../039-libantlr-java_2.7.7+dfsg-13_all.deb ... Unpacking libantlr-java (2.7.7+dfsg-13) ... Selecting previously unselected package antlr. Preparing to unpack .../040-antlr_2.7.7+dfsg-13_all.deb ... Unpacking antlr (2.7.7+dfsg-13) ... Selecting previously unselected package at-spi2-common. Preparing to unpack .../041-at-spi2-common_2.52.0-1_all.deb ... Unpacking at-spi2-common (2.52.0-1) ... Selecting previously unselected package m4. Preparing to unpack .../042-m4_1.4.19-4_amd64.deb ... Unpacking m4 (1.4.19-4) ... Selecting previously unselected package autoconf. Preparing to unpack .../043-autoconf_2.71-3_all.deb ... Unpacking autoconf (2.71-3) ... Selecting previously unselected package autotools-dev. Preparing to unpack .../044-autotools-dev_20220109.1_all.deb ... Unpacking autotools-dev (20220109.1) ... Selecting previously unselected package automake. Preparing to unpack .../045-automake_1%3a1.16.5-1.3_all.deb ... Unpacking automake (1:1.16.5-1.3) ... Selecting previously unselected package autopoint. Preparing to unpack .../046-autopoint_0.21-14_all.deb ... Unpacking autopoint (0.21-14) ... Selecting previously unselected package unzip. Preparing to unpack .../047-unzip_6.0-28_amd64.deb ... Unpacking unzip (6.0-28) ... Selecting previously unselected package java-wrappers. Preparing to unpack .../048-java-wrappers_0.4_all.deb ... Unpacking java-wrappers (0.4) ... Selecting previously unselected package libhamcrest-java. Preparing to unpack .../049-libhamcrest-java_2.2-2_all.deb ... Unpacking libhamcrest-java (2.2-2) ... Selecting previously unselected package junit4. Preparing to unpack .../050-junit4_4.13.2-4_all.deb ... Unpacking junit4 (4.13.2-4) ... Selecting previously unselected package libfelix-framework-java. Preparing to unpack .../051-libfelix-framework-java_4.6.1-2.1_all.deb ... Unpacking libfelix-framework-java (4.6.1-2.1) ... Selecting previously unselected package libfelix-gogo-runtime-java. Preparing to unpack .../052-libfelix-gogo-runtime-java_0.16.2-1.1_all.deb ... Unpacking libfelix-gogo-runtime-java (0.16.2-1.1) ... Selecting previously unselected package libosgi-annotation-java. Preparing to unpack .../053-libosgi-annotation-java_8.1.0-1_all.deb ... Unpacking libosgi-annotation-java (8.1.0-1) ... Selecting previously unselected package libosgi-core-java. Preparing to unpack .../054-libosgi-core-java_8.0.0-2_all.deb ... Unpacking libosgi-core-java (8.0.0-2) ... Selecting previously unselected package libfelix-resolver-java. Preparing to unpack .../055-libfelix-resolver-java_1.16.0-1_all.deb ... Unpacking libfelix-resolver-java (1.16.0-1) ... Selecting previously unselected package libhawtjni-runtime-java. Preparing to unpack .../056-libhawtjni-runtime-java_1.18-1_all.deb ... Unpacking libhawtjni-runtime-java (1.18-1) ... Selecting previously unselected package libjansi-native-java. Preparing to unpack .../057-libjansi-native-java_1.8-2_all.deb ... Unpacking libjansi-native-java (1.8-2) ... Selecting previously unselected package libjansi1-java. Preparing to unpack .../058-libjansi1-java_1.18-3_all.deb ... Unpacking libjansi1-java (1.18-3) ... Selecting previously unselected package libjline2-java. Preparing to unpack .../059-libjline2-java_2.14.6-5_all.deb ... Unpacking libjline2-java (2.14.6-5) ... Selecting previously unselected package libosgi-compendium-java. Preparing to unpack .../060-libosgi-compendium-java_7.0.0-1_all.deb ... Unpacking libosgi-compendium-java (7.0.0-1) ... Selecting previously unselected package libslf4j-java. Preparing to unpack .../061-libslf4j-java_1.7.32-1_all.deb ... Unpacking libslf4j-java (1.7.32-1) ... Selecting previously unselected package libxz-java. Preparing to unpack .../062-libxz-java_1.9-1_all.deb ... Unpacking libxz-java (1.9-1) ... Selecting previously unselected package libyaml-snake-java. Preparing to unpack .../063-libyaml-snake-java_1.33-2_all.deb ... Unpacking libyaml-snake-java (1.33-2) ... Selecting previously unselected package bnd. Preparing to unpack .../064-bnd_5.0.1-5_all.deb ... Unpacking bnd (5.0.1-5) ... Selecting previously unselected package dctrl-tools. Preparing to unpack .../065-dctrl-tools_2.24-3+b1_amd64.deb ... Unpacking dctrl-tools (2.24-3+b1) ... Selecting previously unselected package libdebhelper-perl. Preparing to unpack .../066-libdebhelper-perl_13.15.3_all.deb ... Unpacking libdebhelper-perl (13.15.3) ... Selecting previously unselected package libtool. Preparing to unpack .../067-libtool_2.4.7-7_all.deb ... Unpacking libtool (2.4.7-7) ... Selecting previously unselected package dh-autoreconf. Preparing to unpack .../068-dh-autoreconf_20_all.deb ... Unpacking dh-autoreconf (20) ... Selecting previously unselected package libarchive-zip-perl. Preparing to unpack .../069-libarchive-zip-perl_1.68-1_all.deb ... Unpacking libarchive-zip-perl (1.68-1) ... Selecting previously unselected package libparams-util-perl. Preparing to unpack .../070-libparams-util-perl_1.102-3_amd64.deb ... Unpacking libparams-util-perl (1.102-3) ... Selecting previously unselected package libsub-install-perl. Preparing to unpack .../071-libsub-install-perl_0.929-1_all.deb ... Unpacking libsub-install-perl (0.929-1) ... Selecting previously unselected package libdata-optlist-perl. Preparing to unpack .../072-libdata-optlist-perl_0.114-1_all.deb ... Unpacking libdata-optlist-perl (0.114-1) ... Selecting previously unselected package libsub-exporter-perl. Preparing to unpack .../073-libsub-exporter-perl_0.990-1_all.deb ... Unpacking libsub-exporter-perl (0.990-1) ... Selecting previously unselected package libsub-prototype-perl. Preparing to unpack .../074-libsub-prototype-perl_0.03-2+b2_amd64.deb ... Unpacking libsub-prototype-perl (0.03-2+b2) ... Selecting previously unselected package libsub-override-perl. Preparing to unpack .../075-libsub-override-perl_0.11-1_all.deb ... Unpacking libsub-override-perl (0.11-1) ... Selecting previously unselected package libfile-stripnondeterminism-perl. Preparing to unpack .../076-libfile-stripnondeterminism-perl_1.13.1-1_all.deb ... Unpacking libfile-stripnondeterminism-perl (1.13.1-1) ... Selecting previously unselected package dh-strip-nondeterminism. Preparing to unpack .../077-dh-strip-nondeterminism_1.13.1-1_all.deb ... Unpacking dh-strip-nondeterminism (1.13.1-1) ... Selecting previously unselected package libelf1t64:amd64. Preparing to unpack .../078-libelf1t64_0.191-1+b1_amd64.deb ... Unpacking libelf1t64:amd64 (0.191-1+b1) ... Selecting previously unselected package dwz. Preparing to unpack .../079-dwz_0.15-1+b1_amd64.deb ... Unpacking dwz (0.15-1+b1) ... Selecting previously unselected package gettext. Preparing to unpack .../080-gettext_0.21-14+b1_amd64.deb ... Unpacking gettext (0.21-14+b1) ... Selecting previously unselected package intltool-debian. Preparing to unpack .../081-intltool-debian_0.35.0+20060710.6_all.deb ... Unpacking intltool-debian (0.35.0+20060710.6) ... Selecting previously unselected package po-debconf. Preparing to unpack .../082-po-debconf_1.0.21+nmu1_all.deb ... Unpacking po-debconf (1.0.21+nmu1) ... Selecting previously unselected package debhelper. Preparing to unpack .../083-debhelper_13.15.3_all.deb ... Unpacking debhelper (13.15.3) ... Selecting previously unselected package libgtk2.0-common. Preparing to unpack .../084-libgtk2.0-common_2.24.33-4_all.deb ... Unpacking libgtk2.0-common (2.24.33-4) ... Selecting previously unselected package libatk1.0-0t64:amd64. Preparing to unpack .../085-libatk1.0-0t64_2.52.0-1_amd64.deb ... Unpacking libatk1.0-0t64:amd64 (2.52.0-1) ... Selecting previously unselected package libbrotli1:amd64. Preparing to unpack .../086-libbrotli1_1.1.0-2+b3_amd64.deb ... Unpacking libbrotli1:amd64 (1.1.0-2+b3) ... Selecting previously unselected package libfreetype6:amd64. Preparing to unpack .../087-libfreetype6_2.13.2+dfsg-1+b4_amd64.deb ... Unpacking libfreetype6:amd64 (2.13.2+dfsg-1+b4) ... Selecting previously unselected package fonts-dejavu-mono. Preparing to unpack .../088-fonts-dejavu-mono_2.37-8_all.deb ... Unpacking fonts-dejavu-mono (2.37-8) ... Selecting previously unselected package fonts-dejavu-core. Preparing to unpack .../089-fonts-dejavu-core_2.37-8_all.deb ... Unpacking fonts-dejavu-core (2.37-8) ... Selecting previously unselected package fontconfig-config. Preparing to unpack .../090-fontconfig-config_2.15.0-1.1_amd64.deb ... Unpacking fontconfig-config (2.15.0-1.1) ... Selecting previously unselected package libfontconfig1:amd64. Preparing to unpack .../091-libfontconfig1_2.15.0-1.1_amd64.deb ... Unpacking libfontconfig1:amd64 (2.15.0-1.1) ... Selecting previously unselected package libpixman-1-0:amd64. Preparing to unpack .../092-libpixman-1-0_0.42.2-1+b1_amd64.deb ... Unpacking libpixman-1-0:amd64 (0.42.2-1+b1) ... Selecting previously unselected package libxau6:amd64. Preparing to unpack .../093-libxau6_1%3a1.0.9-1+b1_amd64.deb ... Unpacking libxau6:amd64 (1:1.0.9-1+b1) ... Selecting previously unselected package libbsd0:amd64. Preparing to unpack .../094-libbsd0_0.12.2-1_amd64.deb ... Unpacking libbsd0:amd64 (0.12.2-1) ... Selecting previously unselected package libxdmcp6:amd64. Preparing to unpack .../095-libxdmcp6_1%3a1.1.2-3+b1_amd64.deb ... Unpacking libxdmcp6:amd64 (1:1.1.2-3+b1) ... Selecting previously unselected package libxcb1:amd64. Preparing to unpack .../096-libxcb1_1.17.0-2_amd64.deb ... Unpacking libxcb1:amd64 (1.17.0-2) ... Selecting previously unselected package libx11-data. Preparing to unpack .../097-libx11-data_2%3a1.8.7-1_all.deb ... Unpacking libx11-data (2:1.8.7-1) ... Selecting previously unselected package libx11-6:amd64. Preparing to unpack .../098-libx11-6_2%3a1.8.7-1+b1_amd64.deb ... Unpacking libx11-6:amd64 (2:1.8.7-1+b1) ... Selecting previously unselected package libxcb-render0:amd64. Preparing to unpack .../099-libxcb-render0_1.17.0-2_amd64.deb ... Unpacking libxcb-render0:amd64 (1.17.0-2) ... Selecting previously unselected package libxcb-shm0:amd64. Preparing to unpack .../100-libxcb-shm0_1.17.0-2_amd64.deb ... Unpacking libxcb-shm0:amd64 (1.17.0-2) ... Selecting previously unselected package libxext6:amd64. Preparing to unpack .../101-libxext6_2%3a1.3.4-1+b1_amd64.deb ... Unpacking libxext6:amd64 (2:1.3.4-1+b1) ... Selecting previously unselected package libxrender1:amd64. Preparing to unpack .../102-libxrender1_1%3a0.9.10-1.1+b1_amd64.deb ... Unpacking libxrender1:amd64 (1:0.9.10-1.1+b1) ... Selecting previously unselected package libcairo2:amd64. Preparing to unpack .../103-libcairo2_1.18.0-3+b1_amd64.deb ... Unpacking libcairo2:amd64 (1.18.0-3+b1) ... Selecting previously unselected package libavahi-common-data:amd64. Preparing to unpack .../104-libavahi-common-data_0.8-13+b2_amd64.deb ... Unpacking libavahi-common-data:amd64 (0.8-13+b2) ... Selecting previously unselected package libavahi-common3:amd64. Preparing to unpack .../105-libavahi-common3_0.8-13+b2_amd64.deb ... Unpacking libavahi-common3:amd64 (0.8-13+b2) ... Selecting previously unselected package libdbus-1-3:amd64. Preparing to unpack .../106-libdbus-1-3_1.14.10-4+b1_amd64.deb ... Unpacking libdbus-1-3:amd64 (1.14.10-4+b1) ... Selecting previously unselected package libavahi-client3:amd64. Preparing to unpack .../107-libavahi-client3_0.8-13+b2_amd64.deb ... Unpacking libavahi-client3:amd64 (0.8-13+b2) ... Selecting previously unselected package libkrb5support0:amd64. Preparing to unpack .../108-libkrb5support0_1.20.1-6+b1_amd64.deb ... Unpacking libkrb5support0:amd64 (1.20.1-6+b1) ... Selecting previously unselected package libcom-err2:amd64. Preparing to unpack .../109-libcom-err2_1.47.1-1_amd64.deb ... Unpacking libcom-err2:amd64 (1.47.1-1) ... Selecting previously unselected package libk5crypto3:amd64. Preparing to unpack .../110-libk5crypto3_1.20.1-6+b1_amd64.deb ... Unpacking libk5crypto3:amd64 (1.20.1-6+b1) ... Selecting previously unselected package libkeyutils1:amd64. Preparing to unpack .../111-libkeyutils1_1.6.3-3_amd64.deb ... Unpacking libkeyutils1:amd64 (1.6.3-3) ... Selecting previously unselected package libkrb5-3:amd64. Preparing to unpack .../112-libkrb5-3_1.20.1-6+b1_amd64.deb ... Unpacking libkrb5-3:amd64 (1.20.1-6+b1) ... Selecting previously unselected package libgssapi-krb5-2:amd64. Preparing to unpack .../113-libgssapi-krb5-2_1.20.1-6+b1_amd64.deb ... Unpacking libgssapi-krb5-2:amd64 (1.20.1-6+b1) ... Selecting previously unselected package libcups2t64:amd64. Preparing to unpack .../114-libcups2t64_2.4.7-1.2+b1_amd64.deb ... Unpacking libcups2t64:amd64 (2.4.7-1.2+b1) ... Selecting previously unselected package fontconfig. Preparing to unpack .../115-fontconfig_2.15.0-1.1_amd64.deb ... Unpacking fontconfig (2.15.0-1.1) ... Selecting previously unselected package libfribidi0:amd64. Preparing to unpack .../116-libfribidi0_1.0.13-3+b1_amd64.deb ... Unpacking libfribidi0:amd64 (1.0.13-3+b1) ... Selecting previously unselected package libgraphite2-3:amd64. Preparing to unpack .../117-libgraphite2-3_1.3.14-2_amd64.deb ... Unpacking libgraphite2-3:amd64 (1.3.14-2) ... Selecting previously unselected package libharfbuzz0b:amd64. Preparing to unpack .../118-libharfbuzz0b_8.3.0-2+b1_amd64.deb ... Unpacking libharfbuzz0b:amd64 (8.3.0-2+b1) ... Selecting previously unselected package libthai-data. Preparing to unpack .../119-libthai-data_0.1.29-2_all.deb ... Unpacking libthai-data (0.1.29-2) ... Selecting previously unselected package libdatrie1:amd64. Preparing to unpack .../120-libdatrie1_0.2.13-3_amd64.deb ... Unpacking libdatrie1:amd64 (0.2.13-3) ... Selecting previously unselected package libthai0:amd64. Preparing to unpack .../121-libthai0_0.1.29-2_amd64.deb ... Unpacking libthai0:amd64 (0.1.29-2) ... Selecting previously unselected package libpango-1.0-0:amd64. Preparing to unpack .../122-libpango-1.0-0_1.52.2+ds-1_amd64.deb ... Unpacking libpango-1.0-0:amd64 (1.52.2+ds-1) ... Selecting previously unselected package libpangoft2-1.0-0:amd64. Preparing to unpack .../123-libpangoft2-1.0-0_1.52.2+ds-1_amd64.deb ... Unpacking libpangoft2-1.0-0:amd64 (1.52.2+ds-1) ... Selecting previously unselected package libpangocairo-1.0-0:amd64. Preparing to unpack .../124-libpangocairo-1.0-0_1.52.2+ds-1_amd64.deb ... Unpacking libpangocairo-1.0-0:amd64 (1.52.2+ds-1) ... Selecting previously unselected package libxcomposite1:amd64. Preparing to unpack .../125-libxcomposite1_1%3a0.4.5-1+b1_amd64.deb ... Unpacking libxcomposite1:amd64 (1:0.4.5-1+b1) ... Selecting previously unselected package libxfixes3:amd64. Preparing to unpack .../126-libxfixes3_1%3a6.0.0-2+b1_amd64.deb ... Unpacking libxfixes3:amd64 (1:6.0.0-2+b1) ... Selecting previously unselected package libxcursor1:amd64. Preparing to unpack .../127-libxcursor1_1%3a1.2.1-1+b1_amd64.deb ... Unpacking libxcursor1:amd64 (1:1.2.1-1+b1) ... Selecting previously unselected package libxdamage1:amd64. Preparing to unpack .../128-libxdamage1_1%3a1.1.6-1+b1_amd64.deb ... Unpacking libxdamage1:amd64 (1:1.1.6-1+b1) ... Selecting previously unselected package libxi6:amd64. Preparing to unpack .../129-libxi6_2%3a1.8.1-1_amd64.deb ... Unpacking libxi6:amd64 (2:1.8.1-1) ... Selecting previously unselected package libxinerama1:amd64. Preparing to unpack .../130-libxinerama1_2%3a1.1.4-3+b1_amd64.deb ... Unpacking libxinerama1:amd64 (2:1.1.4-3+b1) ... Selecting previously unselected package libxrandr2:amd64. Preparing to unpack .../131-libxrandr2_2%3a1.5.4-1_amd64.deb ... Unpacking libxrandr2:amd64 (2:1.5.4-1) ... Selecting previously unselected package libgtk2.0-0t64:amd64. Preparing to unpack .../132-libgtk2.0-0t64_2.24.33-4_amd64.deb ... Unpacking libgtk2.0-0t64:amd64 (2.24.33-4) ... Selecting previously unselected package libglvnd0:amd64. Preparing to unpack .../133-libglvnd0_1.7.0-1+b1_amd64.deb ... Unpacking libglvnd0:amd64 (1.7.0-1+b1) ... Selecting previously unselected package libdrm-common. Preparing to unpack .../134-libdrm-common_2.4.120-2_all.deb ... Unpacking libdrm-common (2.4.120-2) ... Selecting previously unselected package libdrm2:amd64. Preparing to unpack .../135-libdrm2_2.4.120-2_amd64.deb ... Unpacking libdrm2:amd64 (2.4.120-2) ... Selecting previously unselected package libglapi-mesa:amd64. Preparing to unpack .../136-libglapi-mesa_24.0.7-1_amd64.deb ... Unpacking libglapi-mesa:amd64 (24.0.7-1) ... Selecting previously unselected package libx11-xcb1:amd64. Preparing to unpack .../137-libx11-xcb1_2%3a1.8.7-1+b1_amd64.deb ... Unpacking libx11-xcb1:amd64 (2:1.8.7-1+b1) ... Selecting previously unselected package libxcb-dri2-0:amd64. Preparing to unpack .../138-libxcb-dri2-0_1.17.0-2_amd64.deb ... Unpacking libxcb-dri2-0:amd64 (1.17.0-2) ... Selecting previously unselected package libxcb-dri3-0:amd64. Preparing to unpack .../139-libxcb-dri3-0_1.17.0-2_amd64.deb ... Unpacking libxcb-dri3-0:amd64 (1.17.0-2) ... Selecting previously unselected package libxcb-glx0:amd64. Preparing to unpack .../140-libxcb-glx0_1.17.0-2_amd64.deb ... Unpacking libxcb-glx0:amd64 (1.17.0-2) ... Selecting previously unselected package libxcb-present0:amd64. Preparing to unpack .../141-libxcb-present0_1.17.0-2_amd64.deb ... Unpacking libxcb-present0:amd64 (1.17.0-2) ... Selecting previously unselected package libxcb-randr0:amd64. Preparing to unpack .../142-libxcb-randr0_1.17.0-2_amd64.deb ... Unpacking libxcb-randr0:amd64 (1.17.0-2) ... Selecting previously unselected package libxcb-sync1:amd64. Preparing to unpack .../143-libxcb-sync1_1.17.0-2_amd64.deb ... Unpacking libxcb-sync1:amd64 (1.17.0-2) ... Selecting previously unselected package libxcb-xfixes0:amd64. Preparing to unpack .../144-libxcb-xfixes0_1.17.0-2_amd64.deb ... Unpacking libxcb-xfixes0:amd64 (1.17.0-2) ... Selecting previously unselected package libxshmfence1:amd64. Preparing to unpack .../145-libxshmfence1_1.3-1+b1_amd64.deb ... Unpacking libxshmfence1:amd64 (1.3-1+b1) ... Selecting previously unselected package libxxf86vm1:amd64. Preparing to unpack .../146-libxxf86vm1_1%3a1.1.4-1+b2_amd64.deb ... Unpacking libxxf86vm1:amd64 (1:1.1.4-1+b2) ... Selecting previously unselected package libvulkan1:amd64. Preparing to unpack .../147-libvulkan1_1.3.280.0-1_amd64.deb ... Unpacking libvulkan1:amd64 (1.3.280.0-1) ... Selecting previously unselected package libdrm-amdgpu1:amd64. Preparing to unpack .../148-libdrm-amdgpu1_2.4.120-2_amd64.deb ... Unpacking libdrm-amdgpu1:amd64 (2.4.120-2) ... Selecting previously unselected package libpciaccess0:amd64. Preparing to unpack .../149-libpciaccess0_0.17-3+b1_amd64.deb ... Unpacking libpciaccess0:amd64 (0.17-3+b1) ... Selecting previously unselected package libdrm-intel1:amd64. Preparing to unpack .../150-libdrm-intel1_2.4.120-2_amd64.deb ... Unpacking libdrm-intel1:amd64 (2.4.120-2) ... Selecting previously unselected package libdrm-nouveau2:amd64. Preparing to unpack .../151-libdrm-nouveau2_2.4.120-2_amd64.deb ... Unpacking libdrm-nouveau2:amd64 (2.4.120-2) ... Selecting previously unselected package libdrm-radeon1:amd64. Preparing to unpack .../152-libdrm-radeon1_2.4.120-2_amd64.deb ... Unpacking libdrm-radeon1:amd64 (2.4.120-2) ... Selecting previously unselected package libedit2:amd64. Preparing to unpack .../153-libedit2_3.1-20230828-1+b1_amd64.deb ... Unpacking libedit2:amd64 (3.1-20230828-1+b1) ... Selecting previously unselected package libz3-4:amd64. Preparing to unpack .../154-libz3-4_4.8.12-3.1+b2_amd64.deb ... Unpacking libz3-4:amd64 (4.8.12-3.1+b2) ... Selecting previously unselected package libllvm17t64:amd64. Preparing to unpack .../155-libllvm17t64_1%3a17.0.6-12_amd64.deb ... Unpacking libllvm17t64:amd64 (1:17.0.6-12) ... Selecting previously unselected package libsensors-config. Preparing to unpack .../156-libsensors-config_1%3a3.6.0-9_all.deb ... Unpacking libsensors-config (1:3.6.0-9) ... Selecting previously unselected package libsensors5:amd64. Preparing to unpack .../157-libsensors5_1%3a3.6.0-9_amd64.deb ... Unpacking libsensors5:amd64 (1:3.6.0-9) ... Selecting previously unselected package libgl1-mesa-dri:amd64. Preparing to unpack .../158-libgl1-mesa-dri_24.0.7-1_amd64.deb ... Unpacking libgl1-mesa-dri:amd64 (24.0.7-1) ... Selecting previously unselected package libglx-mesa0:amd64. Preparing to unpack .../159-libglx-mesa0_24.0.7-1_amd64.deb ... Unpacking libglx-mesa0:amd64 (24.0.7-1) ... Selecting previously unselected package libglx0:amd64. Preparing to unpack .../160-libglx0_1.7.0-1+b1_amd64.deb ... Unpacking libglx0:amd64 (1.7.0-1+b1) ... Selecting previously unselected package libgl1:amd64. Preparing to unpack .../161-libgl1_1.7.0-1+b1_amd64.deb ... Unpacking libgl1:amd64 (1.7.0-1+b1) ... Selecting previously unselected package libasound2-data. Preparing to unpack .../162-libasound2-data_1.2.11-1_all.deb ... Unpacking libasound2-data (1.2.11-1) ... Selecting previously unselected package libasound2t64:amd64. Preparing to unpack .../163-libasound2t64_1.2.11-1+b1_amd64.deb ... Unpacking libasound2t64:amd64 (1.2.11-1+b1) ... Selecting previously unselected package libgif7:amd64. Preparing to unpack .../164-libgif7_5.2.2-1_amd64.deb ... Unpacking libgif7:amd64 (5.2.2-1) ... Selecting previously unselected package x11-common. Preparing to unpack .../165-x11-common_1%3a7.7+23_all.deb ... Unpacking x11-common (1:7.7+23) ... Selecting previously unselected package libxtst6:amd64. Preparing to unpack .../166-libxtst6_2%3a1.2.3-1.1+b1_amd64.deb ... Unpacking libxtst6:amd64 (2:1.2.3-1.1+b1) ... Selecting previously unselected package openjdk-17-jre:amd64. Preparing to unpack .../167-openjdk-17-jre_17.0.11+9-1_amd64.deb ... Unpacking openjdk-17-jre:amd64 (17.0.11+9-1) ... Selecting previously unselected package default-jre. Preparing to unpack .../168-default-jre_2%3a1.17-75_amd64.deb ... Unpacking default-jre (2:1.17-75) ... Selecting previously unselected package openjdk-17-jdk-headless:amd64. Preparing to unpack .../169-openjdk-17-jdk-headless_17.0.11+9-1_amd64.deb ... Unpacking openjdk-17-jdk-headless:amd64 (17.0.11+9-1) ... Selecting previously unselected package default-jdk-headless. Preparing to unpack .../170-default-jdk-headless_2%3a1.17-75_amd64.deb ... Unpacking default-jdk-headless (2:1.17-75) ... Selecting previously unselected package openjdk-17-jdk:amd64. Preparing to unpack .../171-openjdk-17-jdk_17.0.11+9-1_amd64.deb ... Unpacking openjdk-17-jdk:amd64 (17.0.11+9-1) ... Selecting previously unselected package default-jdk. Preparing to unpack .../172-default-jdk_2%3a1.17-75_amd64.deb ... Unpacking default-jdk (2:1.17-75) ... Selecting previously unselected package libassuan0:amd64. Preparing to unpack .../173-libassuan0_2.5.6-1+b1_amd64.deb ... Unpacking libassuan0:amd64 (2.5.6-1+b1) ... Selecting previously unselected package gpgconf. Preparing to unpack .../174-gpgconf_2.2.43-6_amd64.deb ... Unpacking gpgconf (2.2.43-6) ... Selecting previously unselected package libksba8:amd64. Preparing to unpack .../175-libksba8_1.6.6-1_amd64.deb ... Unpacking libksba8:amd64 (1.6.6-1) ... Selecting previously unselected package libsasl2-modules-db:amd64. Preparing to unpack .../176-libsasl2-modules-db_2.1.28+dfsg1-6_amd64.deb ... Unpacking libsasl2-modules-db:amd64 (2.1.28+dfsg1-6) ... Selecting previously unselected package libsasl2-2:amd64. Preparing to unpack .../177-libsasl2-2_2.1.28+dfsg1-6_amd64.deb ... Unpacking libsasl2-2:amd64 (2.1.28+dfsg1-6) ... Selecting previously unselected package libldap-2.5-0:amd64. Preparing to unpack .../178-libldap-2.5-0_2.5.17+dfsg-1_amd64.deb ... Unpacking libldap-2.5-0:amd64 (2.5.17+dfsg-1) ... Selecting previously unselected package libnpth0t64:amd64. Preparing to unpack .../179-libnpth0t64_1.6-3.1_amd64.deb ... Unpacking libnpth0t64:amd64 (1.6-3.1) ... Selecting previously unselected package dirmngr. Preparing to unpack .../180-dirmngr_2.2.43-6_amd64.deb ... Unpacking dirmngr (2.2.43-6) ... Selecting previously unselected package gnupg-l10n. Preparing to unpack .../181-gnupg-l10n_2.2.43-6_all.deb ... Unpacking gnupg-l10n (2.2.43-6) ... Selecting previously unselected package gnupg-utils. Preparing to unpack .../182-gnupg-utils_2.2.43-6_amd64.deb ... Unpacking gnupg-utils (2.2.43-6) ... Selecting previously unselected package gpg. Preparing to unpack .../183-gpg_2.2.43-6_amd64.deb ... Unpacking gpg (2.2.43-6) ... Selecting previously unselected package pinentry-curses. Preparing to unpack .../184-pinentry-curses_1.2.1-3+b2_amd64.deb ... Unpacking pinentry-curses (1.2.1-3+b2) ... Selecting previously unselected package gpg-agent. Preparing to unpack .../185-gpg-agent_2.2.43-6_amd64.deb ... Unpacking gpg-agent (2.2.43-6) ... Selecting previously unselected package gpg-wks-client. Preparing to unpack .../186-gpg-wks-client_2.2.43-6_amd64.deb ... Unpacking gpg-wks-client (2.2.43-6) ... Selecting previously unselected package gpgsm. Preparing to unpack .../187-gpgsm_2.2.43-6_amd64.deb ... Unpacking gpgsm (2.2.43-6) ... Selecting previously unselected package gnupg. Preparing to unpack .../188-gnupg_2.2.43-6_all.deb ... Unpacking gnupg (2.2.43-6) ... Selecting previously unselected package libfile-dirlist-perl. Preparing to unpack .../189-libfile-dirlist-perl_0.05-3_all.deb ... Unpacking libfile-dirlist-perl (0.05-3) ... Selecting previously unselected package libfile-which-perl. Preparing to unpack .../190-libfile-which-perl_1.27-2_all.deb ... Unpacking libfile-which-perl (1.27-2) ... Selecting previously unselected package libfile-homedir-perl. Preparing to unpack .../191-libfile-homedir-perl_1.006-2_all.deb ... Unpacking libfile-homedir-perl (1.006-2) ... Selecting previously unselected package libfile-touch-perl. Preparing to unpack .../192-libfile-touch-perl_0.12-2_all.deb ... Unpacking libfile-touch-perl (0.12-2) ... Selecting previously unselected package libio-pty-perl. Preparing to unpack .../193-libio-pty-perl_1%3a1.20-1+b1_amd64.deb ... Unpacking libio-pty-perl (1:1.20-1+b1) ... Selecting previously unselected package libipc-run-perl. Preparing to unpack .../194-libipc-run-perl_20231003.0-2_all.deb ... Unpacking libipc-run-perl (20231003.0-2) ... Selecting previously unselected package libclass-method-modifiers-perl. Preparing to unpack .../195-libclass-method-modifiers-perl_2.15-1_all.deb ... Unpacking libclass-method-modifiers-perl (2.15-1) ... Selecting previously unselected package libclass-xsaccessor-perl. Preparing to unpack .../196-libclass-xsaccessor-perl_1.19-4+b3_amd64.deb ... Unpacking libclass-xsaccessor-perl (1.19-4+b3) ... Selecting previously unselected package libb-hooks-op-check-perl:amd64. Preparing to unpack .../197-libb-hooks-op-check-perl_0.22-3+b1_amd64.deb ... Unpacking libb-hooks-op-check-perl:amd64 (0.22-3+b1) ... Selecting previously unselected package libdynaloader-functions-perl. Preparing to unpack .../198-libdynaloader-functions-perl_0.003-3_all.deb ... Unpacking libdynaloader-functions-perl (0.003-3) ... Selecting previously unselected package libdevel-callchecker-perl:amd64. Preparing to unpack .../199-libdevel-callchecker-perl_0.009-1_amd64.deb ... Unpacking libdevel-callchecker-perl:amd64 (0.009-1) ... Selecting previously unselected package libparams-classify-perl:amd64. Preparing to unpack .../200-libparams-classify-perl_0.015-2+b3_amd64.deb ... Unpacking libparams-classify-perl:amd64 (0.015-2+b3) ... Selecting previously unselected package libmodule-runtime-perl. Preparing to unpack .../201-libmodule-runtime-perl_0.016-2_all.deb ... Unpacking libmodule-runtime-perl (0.016-2) ... Selecting previously unselected package libimport-into-perl. Preparing to unpack .../202-libimport-into-perl_1.002005-2_all.deb ... Unpacking libimport-into-perl (1.002005-2) ... Selecting previously unselected package librole-tiny-perl. Preparing to unpack .../203-librole-tiny-perl_2.002004-1_all.deb ... Unpacking librole-tiny-perl (2.002004-1) ... Selecting previously unselected package libsub-quote-perl. Preparing to unpack .../204-libsub-quote-perl_2.006008-1_all.deb ... Unpacking libsub-quote-perl (2.006008-1) ... Selecting previously unselected package libmoo-perl. Preparing to unpack .../205-libmoo-perl_2.005005-1_all.deb ... Unpacking libmoo-perl (2.005005-1) ... Selecting previously unselected package libencode-locale-perl. Preparing to unpack .../206-libencode-locale-perl_1.05-3_all.deb ... Unpacking libencode-locale-perl (1.05-3) ... Selecting previously unselected package libtimedate-perl. Preparing to unpack .../207-libtimedate-perl_2.3300-2_all.deb ... Unpacking libtimedate-perl (2.3300-2) ... Selecting previously unselected package libhttp-date-perl. Preparing to unpack .../208-libhttp-date-perl_6.06-1_all.deb ... Unpacking libhttp-date-perl (6.06-1) ... Selecting previously unselected package libfile-listing-perl. Preparing to unpack .../209-libfile-listing-perl_6.16-1_all.deb ... Unpacking libfile-listing-perl (6.16-1) ... Selecting previously unselected package libhtml-tagset-perl. Preparing to unpack .../210-libhtml-tagset-perl_3.24-1_all.deb ... Unpacking libhtml-tagset-perl (3.24-1) ... Selecting previously unselected package liburi-perl. Preparing to unpack .../211-liburi-perl_5.28-1_all.deb ... Unpacking liburi-perl (5.28-1) ... Selecting previously unselected package libhtml-parser-perl:amd64. Preparing to unpack .../212-libhtml-parser-perl_3.82-1_amd64.deb ... Unpacking libhtml-parser-perl:amd64 (3.82-1) ... Selecting previously unselected package libhtml-tree-perl. Preparing to unpack .../213-libhtml-tree-perl_5.07-3_all.deb ... Unpacking libhtml-tree-perl (5.07-3) ... Selecting previously unselected package libclone-perl:amd64. Preparing to unpack .../214-libclone-perl_0.46-1+b2_amd64.deb ... Unpacking libclone-perl:amd64 (0.46-1+b2) ... Selecting previously unselected package libio-html-perl. Preparing to unpack .../215-libio-html-perl_1.004-3_all.deb ... Unpacking libio-html-perl (1.004-3) ... Selecting previously unselected package liblwp-mediatypes-perl. Preparing to unpack .../216-liblwp-mediatypes-perl_6.04-2_all.deb ... Unpacking liblwp-mediatypes-perl (6.04-2) ... Selecting previously unselected package libhttp-message-perl. Preparing to unpack .../217-libhttp-message-perl_6.45-1_all.deb ... Unpacking libhttp-message-perl (6.45-1) ... Selecting previously unselected package libhttp-cookies-perl. Preparing to unpack .../218-libhttp-cookies-perl_6.11-1_all.deb ... Unpacking libhttp-cookies-perl (6.11-1) ... Selecting previously unselected package libhttp-negotiate-perl. Preparing to unpack .../219-libhttp-negotiate-perl_6.01-2_all.deb ... Unpacking libhttp-negotiate-perl (6.01-2) ... Selecting previously unselected package perl-openssl-defaults:amd64. Preparing to unpack .../220-perl-openssl-defaults_7+b2_amd64.deb ... Unpacking perl-openssl-defaults:amd64 (7+b2) ... Selecting previously unselected package libnet-ssleay-perl:amd64. Preparing to unpack .../221-libnet-ssleay-perl_1.94-1+b1_amd64.deb ... Unpacking libnet-ssleay-perl:amd64 (1.94-1+b1) ... Selecting previously unselected package libio-socket-ssl-perl. Preparing to unpack .../222-libio-socket-ssl-perl_2.085-1_all.deb ... Unpacking libio-socket-ssl-perl (2.085-1) ... Selecting previously unselected package libnet-http-perl. Preparing to unpack .../223-libnet-http-perl_6.23-1_all.deb ... Unpacking libnet-http-perl (6.23-1) ... Selecting previously unselected package liblwp-protocol-https-perl. Preparing to unpack .../224-liblwp-protocol-https-perl_6.14-1_all.deb ... Unpacking liblwp-protocol-https-perl (6.14-1) ... Selecting previously unselected package libtry-tiny-perl. Preparing to unpack .../225-libtry-tiny-perl_0.31-2_all.deb ... Unpacking libtry-tiny-perl (0.31-2) ... Selecting previously unselected package libwww-robotrules-perl. Preparing to unpack .../226-libwww-robotrules-perl_6.02-1_all.deb ... Unpacking libwww-robotrules-perl (6.02-1) ... Selecting previously unselected package libwww-perl. Preparing to unpack .../227-libwww-perl_6.77-1_all.deb ... Unpacking libwww-perl (6.77-1) ... Selecting previously unselected package patchutils. Preparing to unpack .../228-patchutils_0.4.2-1_amd64.deb ... Unpacking patchutils (0.4.2-1) ... Selecting previously unselected package wdiff. Preparing to unpack .../229-wdiff_1.2.2-6_amd64.deb ... Unpacking wdiff (1.2.2-6) ... Selecting previously unselected package devscripts. Preparing to unpack .../230-devscripts_2.23.7_all.deb ... Unpacking devscripts (2.23.7) ... Selecting previously unselected package fastjar. Preparing to unpack .../231-fastjar_2%3a0.98-7_amd64.deb ... Unpacking fastjar (2:0.98-7) ... Selecting previously unselected package ivy. Preparing to unpack .../232-ivy_2.5.2-1_all.deb ... Unpacking ivy (2.5.2-1) ... Selecting previously unselected package libasm-java. Preparing to unpack .../233-libasm-java_9.7-1_all.deb ... Unpacking libasm-java (9.7-1) ... Selecting previously unselected package libbsf-java. Preparing to unpack .../234-libbsf-java_1%3a2.4.0-8_all.deb ... Unpacking libbsf-java (1:2.4.0-8) ... Selecting previously unselected package libcommons-cli-java. Preparing to unpack .../235-libcommons-cli-java_1.6.0-1_all.deb ... Unpacking libcommons-cli-java (1.6.0-1) ... Selecting previously unselected package libapache-pom-java. Preparing to unpack .../236-libapache-pom-java_29-2_all.deb ... Unpacking libapache-pom-java (29-2) ... Selecting previously unselected package libcommons-parent-java. Preparing to unpack .../237-libcommons-parent-java_56-1_all.deb ... Unpacking libcommons-parent-java (56-1) ... Selecting previously unselected package libcommons-logging-java. Preparing to unpack .../238-libcommons-logging-java_1.3.0-1_all.deb ... Unpacking libcommons-logging-java (1.3.0-1) ... Selecting previously unselected package libjansi-java. Preparing to unpack .../239-libjansi-java_2.4.1-2_all.deb ... Unpacking libjansi-java (2.4.1-2) ... Selecting previously unselected package libjsp-api-java. Preparing to unpack .../240-libjsp-api-java_2.3.4-3_all.deb ... Unpacking libjsp-api-java (2.3.4-3) ... Selecting previously unselected package libqdox-java. Preparing to unpack .../241-libqdox-java_1.12.1-3_all.deb ... Unpacking libqdox-java (1.12.1-3) ... Selecting previously unselected package libservlet-api-java. Preparing to unpack .../242-libservlet-api-java_4.0.1-2_all.deb ... Unpacking libservlet-api-java (4.0.1-2) ... Selecting previously unselected package libxpp3-java. Preparing to unpack .../243-libxpp3-java_1.1.4c-3_all.deb ... Unpacking libxpp3-java (1.1.4c-3) ... Selecting previously unselected package libxstream-java. Preparing to unpack .../244-libxstream-java_1.4.20-1_all.deb ... Unpacking libxstream-java (1.4.20-1) ... Selecting previously unselected package groovy. Preparing to unpack .../245-groovy_2.4.21-10_all.deb ... Unpacking groovy (2.4.21-10) ... Selecting previously unselected package libatinject-jsr330-api-java. Preparing to unpack .../246-libatinject-jsr330-api-java_1.0+ds1-5_all.deb ... Unpacking libatinject-jsr330-api-java (1.0+ds1-5) ... Selecting previously unselected package libcommons-collections3-java. Preparing to unpack .../247-libcommons-collections3-java_3.2.2-3_all.deb ... Unpacking libcommons-collections3-java (3.2.2-3) ... Selecting previously unselected package libcommons-compress-java. Preparing to unpack .../248-libcommons-compress-java_1.25.0-1_all.deb ... Unpacking libcommons-compress-java (1.25.0-1) ... Selecting previously unselected package libcommons-io-java. Preparing to unpack .../249-libcommons-io-java_2.16.1-1_all.deb ... Unpacking libcommons-io-java (2.16.1-1) ... Selecting previously unselected package libcommons-lang-java. Preparing to unpack .../250-libcommons-lang-java_2.6-10_all.deb ... Unpacking libcommons-lang-java (2.6-10) ... Selecting previously unselected package liberror-prone-java. Preparing to unpack .../251-liberror-prone-java_2.18.0-1_all.deb ... Unpacking liberror-prone-java (2.18.0-1) ... Selecting previously unselected package libjsr305-java. Preparing to unpack .../252-libjsr305-java_0.1~+svn49-11_all.deb ... Unpacking libjsr305-java (0.1~+svn49-11) ... Selecting previously unselected package libguava-java. Preparing to unpack .../253-libguava-java_32.0.1-1_all.deb ... Unpacking libguava-java (32.0.1-1) ... Selecting previously unselected package libcommons-codec-java. Preparing to unpack .../254-libcommons-codec-java_1.16.0-1_all.deb ... Unpacking libcommons-codec-java (1.16.0-1) ... Selecting previously unselected package libhttpcore-java. Preparing to unpack .../255-libhttpcore-java_4.4.16-1_all.deb ... Unpacking libhttpcore-java (4.4.16-1) ... Selecting previously unselected package libhttpclient-java. Preparing to unpack .../256-libhttpclient-java_4.5.14-1_all.deb ... Unpacking libhttpclient-java (4.5.14-1) ... Selecting previously unselected package libjarjar-java. Preparing to unpack .../257-libjarjar-java_1.4+svn142-12_all.deb ... Unpacking libjarjar-java (1.4+svn142-12) ... Selecting previously unselected package libjcip-annotations-java. Preparing to unpack .../258-libjcip-annotations-java_20060626-6_all.deb ... Unpacking libjcip-annotations-java (20060626-6) ... Selecting previously unselected package libjna-jni. Preparing to unpack .../259-libjna-jni_5.14.0-1_amd64.deb ... Unpacking libjna-jni (5.14.0-1) ... Selecting previously unselected package libjna-java. Preparing to unpack .../260-libjna-java_5.14.0-1_all.deb ... Unpacking libjna-java (5.14.0-1) ... Selecting previously unselected package libjzlib-java. Preparing to unpack .../261-libjzlib-java_1.1.3-3_all.deb ... Unpacking libjzlib-java (1.1.3-3) ... Selecting previously unselected package libjsch-java. Preparing to unpack .../262-libjsch-java_0.1.55-1_all.deb ... Unpacking libjsch-java (0.1.55-1) ... Selecting previously unselected package libminlog-java. Preparing to unpack .../263-libminlog-java_1.3.0-1.1_all.deb ... Unpacking libminlog-java (1.3.0-1.1) ... Selecting previously unselected package libobjenesis-java. Preparing to unpack .../264-libobjenesis-java_3.3-3_all.deb ... Unpacking libobjenesis-java (3.3-3) ... Selecting previously unselected package libreflectasm-java. Preparing to unpack .../265-libreflectasm-java_1.11.9+dfsg-4_all.deb ... Unpacking libreflectasm-java (1.11.9+dfsg-4) ... Selecting previously unselected package libkryo-java. Preparing to unpack .../266-libkryo-java_2.20-7_all.deb ... Unpacking libkryo-java (2.20-7) ... Selecting previously unselected package liblogback-java. Preparing to unpack .../267-liblogback-java_1%3a1.2.11-5_all.deb ... Unpacking liblogback-java (1:1.2.11-5) ... Selecting previously unselected package libnative-platform-jni. Preparing to unpack .../268-libnative-platform-jni_0.14-6_amd64.deb ... Unpacking libnative-platform-jni (0.14-6) ... Selecting previously unselected package libnative-platform-java. Preparing to unpack .../269-libnative-platform-java_0.14-6_all.deb ... Unpacking libnative-platform-java (0.14-6) ... Selecting previously unselected package libxml-commons-external-java. Preparing to unpack .../270-libxml-commons-external-java_1.4.01-6_all.deb ... Unpacking libxml-commons-external-java (1.4.01-6) ... Selecting previously unselected package libxml-commons-resolver1.1-java. Preparing to unpack .../271-libxml-commons-resolver1.1-java_1.2-11_all.deb ... Unpacking libxml-commons-resolver1.1-java (1.2-11) ... Selecting previously unselected package libxerces2-java. Preparing to unpack .../272-libxerces2-java_2.12.2-1_all.deb ... Unpacking libxerces2-java (2.12.2-1) ... Selecting previously unselected package libnekohtml-java. Preparing to unpack .../273-libnekohtml-java_1.9.22.noko2-0.1_all.deb ... Unpacking libnekohtml-java (1.9.22.noko2-0.1) ... Selecting previously unselected package libxbean-reflect-java. Preparing to unpack .../274-libxbean-reflect-java_4.5-8_all.deb ... Unpacking libxbean-reflect-java (4.5-8) ... Selecting previously unselected package libgradle-core-java. Preparing to unpack .../275-libgradle-core-java_4.4.1-20_all.deb ... Unpacking libgradle-core-java (4.4.1-20) ... Selecting previously unselected package libbcprov-java. Preparing to unpack .../276-libbcprov-java_1.77-1_all.deb ... Unpacking libbcprov-java (1.77-1) ... Selecting previously unselected package libbcpg-java. Preparing to unpack .../277-libbcpg-java_1.77-1_all.deb ... Unpacking libbcpg-java (1.77-1) ... Selecting previously unselected package libbsh-java. Preparing to unpack .../278-libbsh-java_2.0b4-20_all.deb ... Unpacking libbsh-java (2.0b4-20) ... Selecting previously unselected package libdd-plist-java. Preparing to unpack .../279-libdd-plist-java_1.20-1.1_all.deb ... Unpacking libdd-plist-java (1.20-1.1) ... Selecting previously unselected package libjaxen-java. Preparing to unpack .../280-libjaxen-java_1.1.6-4_all.deb ... Unpacking libjaxen-java (1.1.6-4) ... Selecting previously unselected package libdom4j-java. Preparing to unpack .../281-libdom4j-java_2.1.4-1_all.deb ... Unpacking libdom4j-java (2.1.4-1) ... Selecting previously unselected package libbcel-java. Preparing to unpack .../282-libbcel-java_6.5.0-2_all.deb ... Unpacking libbcel-java (6.5.0-2) ... Selecting previously unselected package libjformatstring-java. Preparing to unpack .../283-libjformatstring-java_0.10~20131207-2.1_all.deb ... Unpacking libjformatstring-java (0.10~20131207-2.1) ... Selecting previously unselected package libfindbugs-java. Preparing to unpack .../284-libfindbugs-java_3.1.0~preview2-3_all.deb ... Unpacking libfindbugs-java (3.1.0~preview2-3) ... Selecting previously unselected package libgoogle-gson-java. Preparing to unpack .../285-libgoogle-gson-java_2.10.1-1_all.deb ... Unpacking libgoogle-gson-java (2.10.1-1) ... Selecting previously unselected package libaopalliance-java. Preparing to unpack .../286-libaopalliance-java_20070526-7_all.deb ... Unpacking libaopalliance-java (20070526-7) ... Selecting previously unselected package libguice-java. Preparing to unpack .../287-libguice-java_4.2.3-2_all.deb ... Unpacking libguice-java (4.2.3-2) ... Selecting previously unselected package libjatl-java. Preparing to unpack .../288-libjatl-java_0.2.3-1.1_all.deb ... Unpacking libjatl-java (0.2.3-1.1) ... Selecting previously unselected package libjcifs-java. Preparing to unpack .../289-libjcifs-java_1.3.19-2_all.deb ... Unpacking libjcifs-java (1.3.19-2) ... Selecting previously unselected package libeclipse-jdt-annotation-java. Preparing to unpack .../290-libeclipse-jdt-annotation-java_2.2.700+eclipse4.26-2_all.deb ... Unpacking libeclipse-jdt-annotation-java (2.2.700+eclipse4.26-2) ... Selecting previously unselected package libjavaewah-java. Preparing to unpack .../291-libjavaewah-java_1.2.3-1_all.deb ... Unpacking libjavaewah-java (1.2.3-1) ... Selecting previously unselected package libel-api-java. Preparing to unpack .../292-libel-api-java_3.0.0-3_all.deb ... Unpacking libel-api-java (3.0.0-3) ... Selecting previously unselected package libwebsocket-api-java. Preparing to unpack .../293-libwebsocket-api-java_1.1-2_all.deb ... Unpacking libwebsocket-api-java (1.1-2) ... Selecting previously unselected package libjetty9-java. Preparing to unpack .../294-libjetty9-java_9.4.54-1_all.deb ... Unpacking libjetty9-java (9.4.54-1) ... Selecting previously unselected package libjgit-java. Preparing to unpack .../295-libjgit-java_6.7.0-1_all.deb ... Unpacking libjgit-java (6.7.0-1) ... Selecting previously unselected package libjs-jquery. Preparing to unpack .../296-libjs-jquery_3.6.1+dfsg+~3.5.14-1_all.deb ... Unpacking libjs-jquery (3.6.1+dfsg+~3.5.14-1) ... Selecting previously unselected package libcommons-lang3-java. Preparing to unpack .../297-libcommons-lang3-java_3.14.0-1_all.deb ... Unpacking libcommons-lang3-java (3.14.0-1) ... Selecting previously unselected package libplexus-utils2-java. Preparing to unpack .../298-libplexus-utils2-java_3.4.2-1_all.deb ... Unpacking libplexus-utils2-java (3.4.2-1) ... Selecting previously unselected package libwagon-provider-api-java. Preparing to unpack .../299-libwagon-provider-api-java_3.5.3-1_all.deb ... Unpacking libwagon-provider-api-java (3.5.3-1) ... Selecting previously unselected package libmaven-resolver-java. Preparing to unpack .../300-libmaven-resolver-java_1.6.3-1_all.deb ... Unpacking libmaven-resolver-java (1.6.3-1) ... Selecting previously unselected package libgeronimo-annotation-1.3-spec-java. Preparing to unpack .../301-libgeronimo-annotation-1.3-spec-java_1.3-1_all.deb ... Unpacking libgeronimo-annotation-1.3-spec-java (1.3-1) ... Selecting previously unselected package libmaven-parent-java. Preparing to unpack .../302-libmaven-parent-java_35-1_all.deb ... Unpacking libmaven-parent-java (35-1) ... Selecting previously unselected package libmaven-shared-utils-java. Preparing to unpack .../303-libmaven-shared-utils-java_3.3.4-1_all.deb ... Unpacking libmaven-shared-utils-java (3.3.4-1) ... Selecting previously unselected package libplexus-cipher-java. Preparing to unpack .../304-libplexus-cipher-java_2.0-1_all.deb ... Unpacking libplexus-cipher-java (2.0-1) ... Selecting previously unselected package libplexus-classworlds-java. Preparing to unpack .../305-libplexus-classworlds-java_2.7.0-1_all.deb ... Unpacking libplexus-classworlds-java (2.7.0-1) ... Selecting previously unselected package libplexus-component-annotations-java. Preparing to unpack .../306-libplexus-component-annotations-java_2.1.1-1_all.deb ... Unpacking libplexus-component-annotations-java (2.1.1-1) ... Selecting previously unselected package libplexus-interpolation-java. Preparing to unpack .../307-libplexus-interpolation-java_1.26-1_all.deb ... Unpacking libplexus-interpolation-java (1.26-1) ... Selecting previously unselected package libplexus-sec-dispatcher-java. Preparing to unpack .../308-libplexus-sec-dispatcher-java_2.0-3_all.deb ... Unpacking libplexus-sec-dispatcher-java (2.0-3) ... Selecting previously unselected package libgeronimo-interceptor-3.0-spec-java. Preparing to unpack .../309-libgeronimo-interceptor-3.0-spec-java_1.0.1-4_all.deb ... Unpacking libgeronimo-interceptor-3.0-spec-java (1.0.1-4) ... Selecting previously unselected package libcdi-api-java. Preparing to unpack .../310-libcdi-api-java_1.2-3_all.deb ... Unpacking libcdi-api-java (1.2-3) ... Selecting previously unselected package libsisu-inject-java. Preparing to unpack .../311-libsisu-inject-java_0.3.4-2_all.deb ... Unpacking libsisu-inject-java (0.3.4-2) ... Selecting previously unselected package libsisu-plexus-java. Preparing to unpack .../312-libsisu-plexus-java_0.3.4-3_all.deb ... Unpacking libsisu-plexus-java (0.3.4-3) ... Selecting previously unselected package libmaven3-core-java. Preparing to unpack .../313-libmaven3-core-java_3.8.7-2_all.deb ... Unpacking libmaven3-core-java (3.8.7-2) ... Selecting previously unselected package libplexus-container-default-java. Preparing to unpack .../314-libplexus-container-default-java_2.1.1-1_all.deb ... Unpacking libplexus-container-default-java (2.1.1-1) ... Selecting previously unselected package libpolyglot-maven-java. Preparing to unpack .../315-libpolyglot-maven-java_0.8~tobrien+git20120905-10_all.deb ... Unpacking libpolyglot-maven-java (0.8~tobrien+git20120905-10) ... Selecting previously unselected package librhino-java. Preparing to unpack .../316-librhino-java_1.7.14-2.1_all.deb ... Unpacking librhino-java (1.7.14-2.1) ... Selecting previously unselected package libsimple-http-java. Preparing to unpack .../317-libsimple-http-java_4.1.21-1.1_all.deb ... Unpacking libsimple-http-java (4.1.21-1.1) ... Selecting previously unselected package libwagon-file-java. Preparing to unpack .../318-libwagon-file-java_3.5.3-1_all.deb ... Unpacking libwagon-file-java (3.5.3-1) ... Selecting previously unselected package libjsoup-java. Preparing to unpack .../319-libjsoup-java_1.15.3-1_all.deb ... Unpacking libjsoup-java (1.15.3-1) ... Selecting previously unselected package libwagon-http-java. Preparing to unpack .../320-libwagon-http-java_3.5.3-1_all.deb ... Unpacking libwagon-http-java (3.5.3-1) ... Selecting previously unselected package libjcommander-java. Preparing to unpack .../321-libjcommander-java_1.71-4_all.deb ... Unpacking libjcommander-java (1.71-4) ... Selecting previously unselected package testng. Preparing to unpack .../322-testng_6.9.12-4_all.deb ... Unpacking testng (6.9.12-4) ... Selecting previously unselected package libgradle-plugins-java. Preparing to unpack .../323-libgradle-plugins-java_4.4.1-20_all.deb ... Unpacking libgradle-plugins-java (4.4.1-20) ... Selecting previously unselected package gradle. Preparing to unpack .../324-gradle_4.4.1-20_all.deb ... Unpacking gradle (4.4.1-20) ... Selecting previously unselected package maven-repo-helper. Preparing to unpack .../325-maven-repo-helper_1.11_all.deb ... Unpacking maven-repo-helper (1.11) ... Selecting previously unselected package gradle-debian-helper. Preparing to unpack .../326-gradle-debian-helper_2.4_all.deb ... Unpacking gradle-debian-helper (2.4) ... Selecting previously unselected package jarwrapper. Preparing to unpack .../327-jarwrapper_0.79_all.deb ... Unpacking jarwrapper (0.79) ... Selecting previously unselected package javahelper. Preparing to unpack .../328-javahelper_0.79_all.deb ... Unpacking javahelper (0.79) ... Selecting previously unselected package libbyte-buddy-java. Preparing to unpack .../329-libbyte-buddy-java_1.14.13-1_all.deb ... Unpacking libbyte-buddy-java (1.14.13-1) ... Selecting previously unselected package libcommons-math3-java. Preparing to unpack .../330-libcommons-math3-java_3.6.1-3_all.deb ... Unpacking libcommons-math3-java (3.6.1-3) ... Selecting previously unselected package libjackson2-annotations-java. Preparing to unpack .../331-libjackson2-annotations-java_2.14.0-1_all.deb ... Unpacking libjackson2-annotations-java (2.14.0-1) ... Selecting previously unselected package libjackson2-core-java. Preparing to unpack .../332-libjackson2-core-java_2.14.1-1_all.deb ... Unpacking libjackson2-core-java (2.14.1-1) ... Selecting previously unselected package libjackson2-databind-java. Preparing to unpack .../333-libjackson2-databind-java_2.14.0-1_all.deb ... Unpacking libjackson2-databind-java (2.14.0-1) ... Selecting previously unselected package liblz4-jni. Preparing to unpack .../334-liblz4-jni_1.8.0-4_amd64.deb ... Unpacking liblz4-jni (1.8.0-4) ... Selecting previously unselected package liblz4-java. Preparing to unpack .../335-liblz4-java_1.8.0-4_all.deb ... Unpacking liblz4-java (1.8.0-4) ... Selecting previously unselected package libmockito-java. Preparing to unpack .../336-libmockito-java_2.23.0-2_all.deb ... Unpacking libmockito-java (2.23.0-2) ... Selecting previously unselected package libredberry-pipe-java. Preparing to unpack .../337-libredberry-pipe-java_1.0.0~alpha0-3_all.deb ... Unpacking libredberry-pipe-java (1.0.0~alpha0-3) ... Selecting previously unselected package libtrove3-java. Preparing to unpack .../338-libtrove3-java_3.0.3-5_all.deb ... Unpacking libtrove3-java (3.0.3-5) ... Setting up libjcifs-java (1.3.19-2) ... Setting up libbcprov-java (1.77-1) ... Setting up libksba8:amd64 (1.6.6-1) ... Setting up media-types (10.1.0) ... Setting up libpipeline1:amd64 (1.5.7-2) ... Setting up fastjar (2:0.98-7) ... Setting up libgraphite2-3:amd64 (1.3.14-2) ... Setting up liblcms2-2:amd64 (2.14-2+b1) ... Setting up libpixman-1-0:amd64 (0.42.2-1+b1) ... Setting up libjcommander-java (1.71-4) ... Setting up libjackson2-annotations-java (2.14.0-1) ... Setting up wdiff (1.2.2-6) ... Setting up libsharpyuv0:amd64 (1.4.0-0.1) ... Setting up libpciaccess0:amd64 (0.17-3+b1) ... Setting up libslf4j-java (1.7.32-1) ... Setting up libfile-which-perl (1.27-2) ... Setting up libxau6:amd64 (1:1.0.9-1+b1) ... Setting up libplexus-utils2-java (3.4.2-1) ... Setting up libnpth0t64:amd64 (1.6-3.1) ... Setting up libredberry-pipe-java (1.0.0~alpha0-3) ... Setting up libkeyutils1:amd64 (1.6.3-3) ... Setting up libplexus-classworlds-java (2.7.0-1) ... Setting up libqdox-java (1.12.1-3) ... Setting up libicu72:amd64 (72.1-4+b1) ... Setting up liblerc4:amd64 (4.0.0+ds-4+b1) ... Setting up libjsr305-java (0.1~+svn49-11) ... Setting up libsimple-http-java (4.1.21-1.1) ... Setting up bsdextrautils (2.40.1-1) ... Setting up hicolor-icon-theme (0.18-1) ... Setting up java-common (0.75) ... Setting up libdynaloader-functions-perl (0.003-3) ... Setting up libdatrie1:amd64 (0.2.13-3) ... Setting up libjcip-annotations-java (20060626-6) ... Setting up libobjenesis-java (3.3-3) ... Setting up libclass-method-modifiers-perl (2.15-1) ... Setting up libaopalliance-java (20070526-7) ... Setting up libcommons-cli-java (1.6.0-1) ... Setting up libio-pty-perl (1:1.20-1+b1) ... Setting up libmagic-mgc (1:5.45-3) ... Setting up liblogback-java (1:1.2.11-5) ... Setting up libclone-perl:amd64 (0.46-1+b2) ... Setting up libminlog-java (1.3.0-1.1) ... Setting up libarchive-zip-perl (1.68-1) ... Setting up libglvnd0:amd64 (1.7.0-1+b1) ... Setting up libgoogle-gson-java (2.10.1-1) ... Setting up libhtml-tagset-perl (3.24-1) ... Setting up unzip (6.0-28) ... Setting up libdebhelper-perl (13.15.3) ... Setting up libbrotli1:amd64 (1.1.0-2+b3) ... Setting up liblwp-mediatypes-perl (6.04-2) ... Setting up libgdk-pixbuf2.0-common (2.42.12+dfsg-1) ... Setting up libmagic1t64:amd64 (1:5.45-3) ... Setting up libasm-java (9.7-1) ... Setting up x11-common (1:7.7+23) ... invoke-rc.d: could not determine current runlevel Setting up X socket directories... /tmp/.X11-unix /tmp/.ICE-unix. Setting up libtry-tiny-perl (0.31-2) ... Setting up libsensors-config (1:3.6.0-9) ... Setting up libdeflate0:amd64 (1.20-1) ... Setting up perl-openssl-defaults:amd64 (7+b2) ... Setting up libdd-plist-java (1.20-1.1) ... Setting up gettext-base (0.21-14+b1) ... Setting up m4 (1.4.19-4) ... Setting up libel-api-java (3.0.0-3) ... Setting up libencode-locale-perl (1.05-3) ... Setting up libplexus-component-annotations-java (2.1.1-1) ... Setting up libcom-err2:amd64 (1.47.1-1) ... Setting up file (1:5.45-3) ... Setting up libpolyglot-maven-java (0.8~tobrien+git20120905-10) ... Setting up libfelix-gogo-runtime-java (0.16.2-1.1) ... Setting up libassuan0:amd64 (2.5.6-1+b1) ... Setting up libjzlib-java (1.1.3-3) ... Setting up libjbig0:amd64 (2.1-6.1+b1) ... Setting up libsub-install-perl (0.929-1) ... Setting up libelf1t64:amd64 (0.191-1+b1) ... Setting up libkrb5support0:amd64 (1.20.1-6+b1) ... Setting up libsasl2-modules-db:amd64 (2.1.28+dfsg1-6) ... Setting up tzdata (2024a-4) ... Current default time zone: 'Etc/UTC' Local time is now: Thu May 23 12:56:22 UTC 2024. Universal Time is now: Thu May 23 12:56:22 UTC 2024. Run 'dpkg-reconfigure tzdata' if you wish to change it. Setting up libgeronimo-annotation-1.3-spec-java (1.3-1) ... Setting up libgeronimo-interceptor-3.0-spec-java (1.0.1-4) ... Setting up libcommons-collections3-java (3.2.2-3) ... Setting up libasound2-data (1.2.11-1) ... Setting up libjsch-java (0.1.55-1) ... Setting up libreflectasm-java (1.11.9+dfsg-4) ... Setting up librhino-java (1.7.14-2.1) ... Setting up autotools-dev (20220109.1) ... Setting up libz3-4:amd64 (4.8.12-3.1+b2) ... Setting up libglib2.0-0t64:amd64 (2.80.2-1) ... No schema files found: doing nothing. Setting up libbsf-java (1:2.4.0-8) ... Setting up libosgi-annotation-java (8.1.0-1) ... Setting up libjformatstring-java (0.10~20131207-2.1) ... Setting up libasound2t64:amd64 (1.2.11-1+b1) ... Setting up libjavaewah-java (1.2.3-1) ... Setting up libjpeg62-turbo:amd64 (1:2.1.5-3) ... Setting up libjaxen-java (1.1.6-4) ... Setting up libx11-data (2:1.8.7-1) ... Setting up libnspr4:amd64 (2:4.35-1.1+b1) ... Setting up gnupg-l10n (2.2.43-6) ... Setting up libeclipse-jdt-annotation-java (2.2.700+eclipse4.26-2) ... Setting up libjansi-java (2.4.1-2) ... Setting up libapache-pom-java (29-2) ... Setting up libavahi-common-data:amd64 (0.8-13+b2) ... Setting up libxpp3-java (1.1.4c-3) ... Setting up libatinject-jsr330-api-java (1.0+ds1-5) ... Setting up libdbus-1-3:amd64 (1.14.10-4+b1) ... Setting up libwebsocket-api-java (1.1-2) ... Setting up libfribidi0:amd64 (1.0.13-3+b1) ... Setting up libplexus-interpolation-java (1.26-1) ... Setting up fonts-dejavu-mono (2.37-8) ... Setting up libpng16-16t64:amd64 (1.6.43-5) ... Setting up libxml-commons-resolver1.1-java (1.2-11) ... Setting up libkryo-java (2.20-7) ... Setting up libxz-java (1.9-1) ... Setting up libio-html-perl (1.004-3) ... Setting up libjna-jni (5.14.0-1) ... Setting up autopoint (0.21-14) ... Setting up binfmt-support (2.2.2-7) ... invoke-rc.d: could not determine current runlevel invoke-rc.d: policy-rc.d denied execution of start. Setting up libb-hooks-op-check-perl:amd64 (0.22-3+b1) ... Setting up fonts-dejavu-core (2.37-8) ... Setting up libfelix-framework-java (4.6.1-2.1) ... Setting up libipc-run-perl (20231003.0-2) ... Setting up libpcsclite1:amd64 (2.2.2-1) ... Setting up libsensors5:amd64 (1:3.6.0-9) ... Setting up libk5crypto3:amd64 (1.20.1-6+b1) ... Setting up libhamcrest-java (2.2-2) ... Setting up libglapi-mesa:amd64 (24.0.7-1) ... Setting up libbsh-java (2.0b4-20) ... Setting up libjsp-api-java (2.3.4-3) ... Setting up libparams-util-perl (1.102-3) ... Setting up libsasl2-2:amd64 (2.1.28+dfsg1-6) ... Setting up libvulkan1:amd64 (1.3.280.0-1) ... Setting up autoconf (2.71-3) ... Setting up libwebp7:amd64 (1.4.0-0.1) ... Setting up libtimedate-perl (2.3300-2) ... Setting up libgif7:amd64 (5.2.2-1) ... Setting up libjarjar-java (1.4+svn142-12) ... Setting up libtrove3-java (3.0.3-5) ... Setting up dwz (0.15-1+b1) ... Setting up sensible-utils (0.0.22) ... Setting up libxshmfence1:amd64 (1.3-1+b1) ... Setting up libjsoup-java (1.15.3-1) ... Setting up at-spi2-common (2.52.0-1) ... Setting up libtiff6:amd64 (4.5.1+git230720-4) ... Setting up libuchardet0:amd64 (0.0.8-1+b1) ... Setting up libxml-commons-external-java (1.4.01-6) ... Setting up libjna-java (5.14.0-1) ... Setting up libxbean-reflect-java (4.5-8) ... Setting up libservlet-api-java (4.0.1-2) ... Setting up librole-tiny-perl (2.002004-1) ... Setting up libjackson2-core-java (2.14.1-1) ... Setting up libthai-data (0.1.29-2) ... Setting up netbase (6.4) ... Setting up libcommons-math3-java (3.6.1-3) ... Setting up libsub-quote-perl (2.006008-1) ... Setting up libnative-platform-jni (0.14-6) ... Setting up libclass-xsaccessor-perl (1.19-4+b3) ... Setting up libgtk2.0-common (2.24.33-4) ... Setting up libkrb5-3:amd64 (1.20.1-6+b1) ... Setting up liblz4-jni (1.8.0-4) ... Setting up libhttpcore-java (4.4.16-1) ... Setting up libbcpg-java (1.77-1) ... Setting up libjs-jquery (3.6.1+dfsg+~3.5.14-1) ... Setting up libxerces2-java (2.12.2-1) ... Setting up libfile-dirlist-perl (0.05-3) ... Setting up libfile-homedir-perl (1.006-2) ... Setting up libantlr-java (2.7.7+dfsg-13) ... Setting up libyaml-snake-java (1.33-2) ... Setting up openssl (3.2.1-3) ... Setting up libbsd0:amd64 (0.12.2-1) ... Setting up libdrm-common (2.4.120-2) ... Setting up libcdi-api-java (1.2-3) ... Setting up readline-common (8.2-4) ... Setting up libhawtjni-runtime-java (1.18-1) ... Setting up libxml2:amd64 (2.9.14+dfsg-1.3+b3) ... Setting up liburi-perl (5.28-1) ... Setting up libfile-touch-perl (0.12-2) ... Setting up dctrl-tools (2.24-3+b1) ... Setting up libjatl-java (0.2.3-1.1) ... Setting up libnet-ssleay-perl:amd64 (1.94-1+b1) ... Setting up automake (1:1.16.5-1.3) ... update-alternatives: using /usr/bin/automake-1.16 to provide /usr/bin/automake (automake) in auto mode Setting up pinentry-curses (1.2.1-3+b2) ... Setting up libdom4j-java (2.1.4-1) ... Setting up libwagon-provider-api-java (3.5.3-1) ... Setting up libnative-platform-java (0.14-6) ... Setting up libosgi-core-java (8.0.0-2) ... Setting up libhttp-date-perl (6.06-1) ... Setting up libxstream-java (1.4.20-1) ... Setting up libnekohtml-java (1.9.22.noko2-0.1) ... Setting up libxdmcp6:amd64 (1:1.1.2-3+b1) ... Setting up liblz4-java (1.8.0-4) ... Setting up libxcb1:amd64 (1.17.0-2) ... Setting up gettext (0.21-14+b1) ... Setting up libjetty9-java (9.4.54-1) ... Setting up libxcb-xfixes0:amd64 (1.17.0-2) ... Setting up java-wrappers (0.4) ... Setting up libatk1.0-0t64:amd64 (2.52.0-1) ... Setting up libfile-listing-perl (6.16-1) ... Setting up libosgi-compendium-java (7.0.0-1) ... Setting up jarwrapper (0.79) ... Setting up libtool (2.4.7-7) ... Setting up libxcb-render0:amd64 (1.17.0-2) ... Setting up fontconfig-config (2.15.0-1.1) ... Setting up libxcb-glx0:amd64 (1.17.0-2) ... Setting up libmaven-parent-java (35-1) ... Setting up libedit2:amd64 (3.1-20230828-1+b1) ... Setting up libcommons-parent-java (56-1) ... Setting up libavahi-common3:amd64 (0.8-13+b2) ... Setting up libcommons-logging-java (1.3.0-1) ... Setting up libnet-http-perl (6.23-1) ... Setting up libsisu-inject-java (0.3.4-2) ... Setting up libnss3:amd64 (2:3.100-1) ... Setting up libxcb-shm0:amd64 (1.17.0-2) ... Setting up libdevel-callchecker-perl:amd64 (0.009-1) ... Setting up libcommons-lang-java (2.6-10) ... Setting up libldap-2.5-0:amd64 (2.5.17+dfsg-1) ... Setting up libjackson2-databind-java (2.14.0-1) ... Setting up libplexus-cipher-java (2.0-1) ... Setting up intltool-debian (0.35.0+20060710.6) ... Setting up libxcb-present0:amd64 (1.17.0-2) ... Setting up dh-autoreconf (20) ... Setting up patchutils (0.4.2-1) ... Setting up libthai0:amd64 (0.1.29-2) ... Setting up ca-certificates (20240203) ... Updating certificates in /etc/ssl/certs... 146 added, 0 removed; done. Setting up libsisu-plexus-java (0.3.4-3) ... Setting up libbcel-java (6.5.0-2) ... Setting up libllvm17t64:amd64 (1:17.0.6-12) ... Setting up libfreetype6:amd64 (2.13.2+dfsg-1+b4) ... Setting up libxcb-sync1:amd64 (1.17.0-2) ... Setting up testng (6.9.12-4) ... Setting up shared-mime-info (2.4-4) ... Setting up libgssapi-krb5-2:amd64 (1.20.1-6+b1) ... Setting up libdata-optlist-perl (0.114-1) ... Setting up libcommons-lang3-java (3.14.0-1) ... Setting up libreadline8t64:amd64 (8.2-4) ... Setting up libxcb-dri2-0:amd64 (1.17.0-2) ... Setting up libwww-robotrules-perl (6.02-1) ... Setting up libfelix-resolver-java (1.16.0-1) ... Setting up libdrm2:amd64 (2.4.120-2) ... Setting up libjansi-native-java (1.8-2) ... Setting up groff-base (1.23.0-4) ... Setting up libxcb-randr0:amd64 (1.17.0-2) ... Setting up libhtml-parser-perl:amd64 (3.82-1) ... Setting up gpgconf (2.2.43-6) ... Setting up libjansi1-java (1.18-3) ... Setting up libplexus-sec-dispatcher-java (2.0-3) ... Setting up libx11-6:amd64 (2:1.8.7-1+b1) ... Setting up libharfbuzz0b:amd64 (8.3.0-2+b1) ... Setting up libgdk-pixbuf-2.0-0:amd64 (2.42.12+dfsg-1) ... Setting up libfontconfig1:amd64 (2.15.0-1.1) ... Setting up ca-certificates-java (20240118) ... No JRE found. Skipping Java certificates setup. Setting up libwagon-file-java (3.5.3-1) ... Setting up libcommons-codec-java (1.16.0-1) ... Setting up libjline2-java (2.14.6-5) ... Setting up libxcomposite1:amd64 (1:0.4.5-1+b1) ... Setting up libavahi-client3:amd64 (0.8-13+b2) ... Setting up libio-socket-ssl-perl (2.085-1) ... Setting up gpg (2.2.43-6) ... Setting up libsub-exporter-perl (0.990-1) ... Setting up gnupg-utils (2.2.43-6) ... Setting up libhttp-message-perl (6.45-1) ... Setting up libdrm-amdgpu1:amd64 (2.4.120-2) ... Setting up libxcb-dri3-0:amd64 (1.17.0-2) ... Setting up gtk-update-icon-cache (3.24.41-4) ... Setting up libx11-xcb1:amd64 (2:1.8.7-1+b1) ... Setting up libhttp-negotiate-perl (6.01-2) ... Setting up fontconfig (2.15.0-1.1) ... Regenerating fonts cache... done. Setting up libdrm-nouveau2:amd64 (2.4.120-2) ... Setting up libfindbugs-java (3.1.0~preview2-3) ... Setting up libxdamage1:amd64 (1:1.1.6-1+b1) ... Setting up gpg-agent (2.2.43-6) ... Setting up libxrender1:amd64 (1:0.9.10-1.1+b1) ... Setting up libcommons-compress-java (1.25.0-1) ... Setting up libhttp-cookies-perl (6.11-1) ... Setting up libcommons-io-java (2.16.1-1) ... Setting up libdrm-radeon1:amd64 (2.4.120-2) ... Setting up po-debconf (1.0.21+nmu1) ... Setting up libhtml-tree-perl (5.07-3) ... Setting up libpython3.11-stdlib:amd64 (3.11.9-1) ... Setting up libparams-classify-perl:amd64 (0.015-2+b3) ... Setting up gpgsm (2.2.43-6) ... Setting up libpango-1.0-0:amd64 (1.52.2+ds-1) ... Setting up libdrm-intel1:amd64 (2.4.120-2) ... Setting up libgl1-mesa-dri:amd64 (24.0.7-1) ... Setting up libxext6:amd64 (2:1.3.4-1+b1) ... Setting up libsub-prototype-perl (0.03-2+b2) ... Setting up man-db (2.12.1-1) ... Not building database; man-db/auto-update is not 'true'. Setting up libcairo2:amd64 (1.18.0-3+b1) ... Setting up libxxf86vm1:amd64 (1:1.1.4-1+b2) ... Setting up dirmngr (2.2.43-6) ... Setting up libmaven-resolver-java (1.6.3-1) ... Setting up adwaita-icon-theme (46.0-1) ... update-alternatives: using /usr/share/icons/Adwaita/cursor.theme to provide /usr/share/icons/default/index.theme (x-cursor-theme) in auto mode Setting up libmodule-runtime-perl (0.016-2) ... Setting up libxfixes3:amd64 (1:6.0.0-2+b1) ... Setting up libxinerama1:amd64 (2:1.1.4-3+b1) ... Setting up libxrandr2:amd64 (2:1.5.4-1) ... Setting up openjdk-17-jre-headless:amd64 (17.0.11+9-1) ... update-alternatives: using /usr/lib/jvm/java-17-openjdk-amd64/bin/java to provide /usr/bin/java (java) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-amd64/bin/jpackage to provide /usr/bin/jpackage (jpackage) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-amd64/bin/keytool to provide /usr/bin/keytool (keytool) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-amd64/bin/rmiregistry to provide /usr/bin/rmiregistry (rmiregistry) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-amd64/lib/jexec to provide /usr/bin/jexec (jexec) in auto mode Setting up libhttpclient-java (4.5.14-1) ... Setting up libsub-override-perl (0.11-1) ... Setting up libwagon-http-java (3.5.3-1) ... Setting up libmaven-shared-utils-java (3.3.4-1) ... Setting up libpangoft2-1.0-0:amd64 (1.52.2+ds-1) ... Setting up libcups2t64:amd64 (2.4.7-1.2+b1) ... Setting up libpangocairo-1.0-0:amd64 (1.52.2+ds-1) ... Setting up libpython3-stdlib:amd64 (3.11.8-1) ... Setting up libfile-stripnondeterminism-perl (1.13.1-1) ... Setting up python3.11 (3.11.9-1) ... Setting up libjgit-java (6.7.0-1) ... Setting up libglx-mesa0:amd64 (24.0.7-1) ... Setting up libxi6:amd64 (2:1.8.1-1) ... Setting up gpg-wks-client (2.2.43-6) ... Setting up libglx0:amd64 (1.7.0-1+b1) ... Setting up libimport-into-perl (1.002005-2) ... Setting up libxtst6:amd64 (2:1.2.3-1.1+b1) ... Setting up libmoo-perl (2.005005-1) ... Setting up libxcursor1:amd64 (1:1.2.1-1+b1) ... Setting up python3 (3.11.8-1) ... Setting up libgl1:amd64 (1.7.0-1+b1) ... Setting up libgtk2.0-0t64:amd64 (2.24.33-4) ... Setting up dh-strip-nondeterminism (1.13.1-1) ... Setting up gnupg (2.2.43-6) ... Setting up debhelper (13.15.3) ... Setting up liblwp-protocol-https-perl (6.14-1) ... Setting up liberror-prone-java (2.18.0-1) ... Setting up libwww-perl (6.77-1) ... Setting up devscripts (2.23.7) ... Setting up libguava-java (32.0.1-1) ... Setting up javahelper (0.79) ... Setting up libplexus-container-default-java (2.1.1-1) ... Setting up libguice-java (4.2.3-2) ... Setting up libmaven3-core-java (3.8.7-2) ... Setting up libbyte-buddy-java (1.14.13-1) ... Setting up libmockito-java (2.23.0-2) ... Processing triggers for libc-bin (2.38-11) ... Processing triggers for ca-certificates-java (20240118) ... Adding debian:ACCVRAIZ1.pem Adding debian:AC_RAIZ_FNMT-RCM.pem Adding debian:AC_RAIZ_FNMT-RCM_SERVIDORES_SEGUROS.pem Adding debian:ANF_Secure_Server_Root_CA.pem Adding debian:Actalis_Authentication_Root_CA.pem Adding debian:AffirmTrust_Commercial.pem Adding debian:AffirmTrust_Networking.pem Adding debian:AffirmTrust_Premium.pem Adding debian:AffirmTrust_Premium_ECC.pem Adding debian:Amazon_Root_CA_1.pem Adding debian:Amazon_Root_CA_2.pem Adding debian:Amazon_Root_CA_3.pem Adding debian:Amazon_Root_CA_4.pem Adding debian:Atos_TrustedRoot_2011.pem Adding debian:Atos_TrustedRoot_Root_CA_ECC_TLS_2021.pem Adding debian:Atos_TrustedRoot_Root_CA_RSA_TLS_2021.pem Adding debian:Autoridad_de_Certificacion_Firmaprofesional_CIF_A62634068.pem Adding debian:BJCA_Global_Root_CA1.pem Adding debian:BJCA_Global_Root_CA2.pem Adding debian:Baltimore_CyberTrust_Root.pem Adding debian:Buypass_Class_2_Root_CA.pem Adding debian:Buypass_Class_3_Root_CA.pem Adding debian:CA_Disig_Root_R2.pem Adding debian:CFCA_EV_ROOT.pem Adding debian:COMODO_Certification_Authority.pem Adding debian:COMODO_ECC_Certification_Authority.pem Adding debian:COMODO_RSA_Certification_Authority.pem Adding debian:Certainly_Root_E1.pem Adding debian:Certainly_Root_R1.pem Adding debian:Certigna.pem Adding debian:Certigna_Root_CA.pem Adding debian:Certum_EC-384_CA.pem Adding debian:Certum_Trusted_Network_CA.pem Adding debian:Certum_Trusted_Network_CA_2.pem Adding debian:Certum_Trusted_Root_CA.pem Adding debian:CommScope_Public_Trust_ECC_Root-01.pem Adding debian:CommScope_Public_Trust_ECC_Root-02.pem Adding debian:CommScope_Public_Trust_RSA_Root-01.pem Adding debian:CommScope_Public_Trust_RSA_Root-02.pem Adding debian:Comodo_AAA_Services_root.pem Adding debian:D-TRUST_BR_Root_CA_1_2020.pem Adding debian:D-TRUST_EV_Root_CA_1_2020.pem Adding debian:D-TRUST_Root_Class_3_CA_2_2009.pem Adding debian:D-TRUST_Root_Class_3_CA_2_EV_2009.pem Adding debian:DigiCert_Assured_ID_Root_CA.pem Adding debian:DigiCert_Assured_ID_Root_G2.pem Adding debian:DigiCert_Assured_ID_Root_G3.pem Adding debian:DigiCert_Global_Root_CA.pem Adding debian:DigiCert_Global_Root_G2.pem Adding debian:DigiCert_Global_Root_G3.pem Adding debian:DigiCert_High_Assurance_EV_Root_CA.pem Adding debian:DigiCert_TLS_ECC_P384_Root_G5.pem Adding debian:DigiCert_TLS_RSA4096_Root_G5.pem Adding debian:DigiCert_Trusted_Root_G4.pem Adding debian:Entrust.net_Premium_2048_Secure_Server_CA.pem Adding debian:Entrust_Root_Certification_Authority.pem Adding debian:Entrust_Root_Certification_Authority_-_EC1.pem Adding debian:Entrust_Root_Certification_Authority_-_G2.pem Adding debian:Entrust_Root_Certification_Authority_-_G4.pem Adding debian:GDCA_TrustAUTH_R5_ROOT.pem Adding debian:GLOBALTRUST_2020.pem Adding debian:GTS_Root_R1.pem Adding debian:GTS_Root_R2.pem Adding debian:GTS_Root_R3.pem Adding debian:GTS_Root_R4.pem Adding debian:GlobalSign_ECC_Root_CA_-_R4.pem Adding debian:GlobalSign_ECC_Root_CA_-_R5.pem Adding debian:GlobalSign_Root_CA.pem Adding debian:GlobalSign_Root_CA_-_R3.pem Adding debian:GlobalSign_Root_CA_-_R6.pem Adding debian:GlobalSign_Root_E46.pem Adding debian:GlobalSign_Root_R46.pem Adding debian:Go_Daddy_Class_2_CA.pem Adding debian:Go_Daddy_Root_Certificate_Authority_-_G2.pem Adding debian:HARICA_TLS_ECC_Root_CA_2021.pem Adding debian:HARICA_TLS_RSA_Root_CA_2021.pem Adding debian:Hellenic_Academic_and_Research_Institutions_ECC_RootCA_2015.pem Adding debian:Hellenic_Academic_and_Research_Institutions_RootCA_2015.pem Adding debian:HiPKI_Root_CA_-_G1.pem Adding debian:Hongkong_Post_Root_CA_3.pem Adding debian:ISRG_Root_X1.pem Adding debian:ISRG_Root_X2.pem Adding debian:IdenTrust_Commercial_Root_CA_1.pem Adding debian:IdenTrust_Public_Sector_Root_CA_1.pem Adding debian:Izenpe.com.pem Adding debian:Microsec_e-Szigno_Root_CA_2009.pem Adding debian:Microsoft_ECC_Root_Certificate_Authority_2017.pem Adding debian:Microsoft_RSA_Root_Certificate_Authority_2017.pem Adding debian:NAVER_Global_Root_Certification_Authority.pem Adding debian:NetLock_Arany_=Class_Gold=_Főtanúsítvány.pem Adding debian:OISTE_WISeKey_Global_Root_GB_CA.pem Adding debian:OISTE_WISeKey_Global_Root_GC_CA.pem Adding debian:QuoVadis_Root_CA_1_G3.pem Adding debian:QuoVadis_Root_CA_2.pem Adding debian:QuoVadis_Root_CA_2_G3.pem Adding debian:QuoVadis_Root_CA_3.pem Adding debian:QuoVadis_Root_CA_3_G3.pem Adding debian:SSL.com_EV_Root_Certification_Authority_ECC.pem Adding debian:SSL.com_EV_Root_Certification_Authority_RSA_R2.pem Adding debian:SSL.com_Root_Certification_Authority_ECC.pem Adding debian:SSL.com_Root_Certification_Authority_RSA.pem Adding debian:SSL.com_TLS_ECC_Root_CA_2022.pem Adding debian:SSL.com_TLS_RSA_Root_CA_2022.pem Adding debian:SZAFIR_ROOT_CA2.pem Adding debian:Sectigo_Public_Server_Authentication_Root_E46.pem Adding debian:Sectigo_Public_Server_Authentication_Root_R46.pem Adding debian:SecureSign_RootCA11.pem Adding debian:SecureTrust_CA.pem Adding debian:Secure_Global_CA.pem Adding debian:Security_Communication_ECC_RootCA1.pem Adding debian:Security_Communication_RootCA2.pem Adding debian:Security_Communication_RootCA3.pem Adding debian:Security_Communication_Root_CA.pem Adding debian:Starfield_Class_2_CA.pem Adding debian:Starfield_Root_Certificate_Authority_-_G2.pem Adding debian:Starfield_Services_Root_Certificate_Authority_-_G2.pem Adding debian:SwissSign_Gold_CA_-_G2.pem Adding debian:SwissSign_Silver_CA_-_G2.pem Adding debian:T-TeleSec_GlobalRoot_Class_2.pem Adding debian:T-TeleSec_GlobalRoot_Class_3.pem Adding debian:TUBITAK_Kamu_SM_SSL_Kok_Sertifikasi_-_Surum_1.pem Adding debian:TWCA_Global_Root_CA.pem Adding debian:TWCA_Root_Certification_Authority.pem Adding debian:TeliaSonera_Root_CA_v1.pem Adding debian:Telia_Root_CA_v2.pem Adding debian:TrustAsia_Global_Root_CA_G3.pem Adding debian:TrustAsia_Global_Root_CA_G4.pem Adding debian:Trustwave_Global_Certification_Authority.pem Adding debian:Trustwave_Global_ECC_P256_Certification_Authority.pem Adding debian:Trustwave_Global_ECC_P384_Certification_Authority.pem Adding debian:TunTrust_Root_CA.pem Adding debian:UCA_Extended_Validation_Root.pem Adding debian:UCA_Global_G2_Root.pem Adding debian:USERTrust_ECC_Certification_Authority.pem Adding debian:USERTrust_RSA_Certification_Authority.pem Adding debian:XRamp_Global_CA_Root.pem Adding debian:certSIGN_ROOT_CA.pem Adding debian:certSIGN_Root_CA_G2.pem Adding debian:e-Szigno_Root_CA_2017.pem Adding debian:ePKI_Root_Certification_Authority.pem Adding debian:emSign_ECC_Root_CA_-_C3.pem Adding debian:emSign_ECC_Root_CA_-_G3.pem Adding debian:emSign_Root_CA_-_C1.pem Adding debian:emSign_Root_CA_-_G1.pem Adding debian:vTrus_ECC_Root_CA.pem Adding debian:vTrus_Root_CA.pem done. Setting up maven-repo-helper (1.11) ... Setting up antlr (2.7.7+dfsg-13) ... Setting up openjdk-17-jdk-headless:amd64 (17.0.11+9-1) ... update-alternatives: using /usr/lib/jvm/java-17-openjdk-amd64/bin/jar to provide /usr/bin/jar (jar) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-amd64/bin/jarsigner to provide /usr/bin/jarsigner (jarsigner) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-amd64/bin/javac to provide /usr/bin/javac (javac) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-amd64/bin/javadoc to provide /usr/bin/javadoc (javadoc) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-amd64/bin/javap to provide /usr/bin/javap (javap) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-amd64/bin/jcmd to provide /usr/bin/jcmd (jcmd) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-amd64/bin/jdb to provide /usr/bin/jdb (jdb) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-amd64/bin/jdeprscan to provide /usr/bin/jdeprscan (jdeprscan) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-amd64/bin/jdeps to provide /usr/bin/jdeps (jdeps) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-amd64/bin/jfr to provide /usr/bin/jfr (jfr) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-amd64/bin/jimage to provide /usr/bin/jimage (jimage) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-amd64/bin/jinfo to provide /usr/bin/jinfo (jinfo) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-amd64/bin/jlink to provide /usr/bin/jlink (jlink) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-amd64/bin/jmap to provide /usr/bin/jmap (jmap) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-amd64/bin/jmod to provide /usr/bin/jmod (jmod) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-amd64/bin/jps to provide /usr/bin/jps (jps) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-amd64/bin/jrunscript to provide /usr/bin/jrunscript (jrunscript) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-amd64/bin/jshell to provide /usr/bin/jshell (jshell) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-amd64/bin/jstack to provide /usr/bin/jstack (jstack) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-amd64/bin/jstat to provide /usr/bin/jstat (jstat) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-amd64/bin/jstatd to provide /usr/bin/jstatd (jstatd) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-amd64/bin/serialver to provide /usr/bin/serialver (serialver) in auto mode update-alternatives: using /usr/lib/jvm/java-17-openjdk-amd64/bin/jhsdb to provide /usr/bin/jhsdb (jhsdb) in auto mode Setting up ivy (2.5.2-1) ... Setting up ant (1.10.14-1) ... Setting up junit4 (4.13.2-4) ... Setting up groovy (2.4.21-10) ... update-alternatives: using /usr/share/groovy/bin/groovy to provide /usr/bin/groovy (groovy) in auto mode update-alternatives: using /usr/share/groovy/bin/groovyc to provide /usr/bin/groovyc (groovyc) in auto mode update-alternatives: using /usr/share/groovy/bin/grape to provide /usr/bin/grape (grape) in auto mode update-alternatives: using /usr/share/groovy/bin/startGroovy to provide /usr/bin/startGroovy (startGroovy) in auto mode update-alternatives: using /usr/share/groovy/bin/groovysh to provide /usr/bin/groovysh (groovysh) in auto mode update-alternatives: using /usr/share/groovy/bin/java2groovy to provide /usr/bin/java2groovy (java2groovy) in auto mode update-alternatives: using /usr/share/groovy/bin/groovyConsole to provide /usr/bin/groovyConsole (groovyConsole) in auto mode update-alternatives: using /usr/share/groovy/bin/groovydoc to provide /usr/bin/groovydoc (groovydoc) in auto mode Setting up default-jre-headless (2:1.17-75) ... Setting up openjdk-17-jre:amd64 (17.0.11+9-1) ... Setting up default-jre (2:1.17-75) ... Setting up openjdk-17-jdk:amd64 (17.0.11+9-1) ... update-alternatives: using /usr/lib/jvm/java-17-openjdk-amd64/bin/jconsole to provide /usr/bin/jconsole (jconsole) in auto mode Setting up ant-optional (1.10.14-1) ... Setting up bnd (5.0.1-5) ... Setting up default-jdk-headless (2:1.17-75) ... Setting up libgradle-core-java (4.4.1-20) ... Setting up libgradle-plugins-java (4.4.1-20) ... Setting up gradle (4.4.1-20) ... Setting up default-jdk (2:1.17-75) ... Setting up gradle-debian-helper (2.4) ... Processing triggers for ca-certificates (20240203) ... Updating certificates in /etc/ssl/certs... 0 added, 0 removed; done. Running hooks in /etc/ca-certificates/update.d... done. Processing triggers for ca-certificates-java (20240118) ... done. Reading package lists... Building dependency tree... Reading state information... Reading extended state information... Initializing package states... Writing extended state information... Building tag database... -> Finished parsing the build-deps I: Building the package I: Running cd /build/reproducible-path/milib-2.2.0+dfsg/ && env PATH="/usr/sbin:/usr/bin:/sbin:/bin:/usr/games" HOME="/nonexistent/first-build" dpkg-buildpackage -us -uc -b && env PATH="/usr/sbin:/usr/bin:/sbin:/bin:/usr/games" HOME="/nonexistent/first-build" dpkg-genchanges -S > ../milib_2.2.0+dfsg-1_source.changes dpkg-buildpackage: info: source package milib dpkg-buildpackage: info: source version 2.2.0+dfsg-1 dpkg-buildpackage: info: source distribution unstable dpkg-buildpackage: info: source changed by Pierre Gruet dpkg-source --before-build . dpkg-buildpackage: info: host architecture amd64 debian/rules clean dh clean --with javahelper --with maven_repo_helper debian/rules override_dh_auto_clean make[1]: Entering directory '/build/reproducible-path/milib-2.2.0+dfsg' dh_auto_clean # Clearing the build.gradle file we provide rm build.gradle rm: cannot remove 'build.gradle': No such file or directory make[1]: [debian/rules:11: override_dh_auto_clean] Error 1 (ignored) make[1]: Leaving directory '/build/reproducible-path/milib-2.2.0+dfsg' jh_clean dh_clean debian/rules binary dh binary --with javahelper --with maven_repo_helper dh_update_autotools_config dh_autoreconf debian/rules override_dh_auto_configure make[1]: Entering directory '/build/reproducible-path/milib-2.2.0+dfsg' # Adding the upstream version number (without +dfsg) to the build.gradle file # we got by patching build.gradle.kts sed "s/\(^group.*\)/\1\nversion = '2.2.0+dfsg'/ ; s/\+dfsg[[:digit:]]*//" build.gradle.kts > build.gradle dh_auto_configure make[1]: Leaving directory '/build/reproducible-path/milib-2.2.0+dfsg' jh_linkjars dh_auto_build mkdir -p .gradle/init.d cp /usr/share/gradle-debian-helper/init.gradle .gradle/init.d/ gradle --info --console plain --offline --stacktrace --no-daemon --refresh-dependencies --gradle-user-home .gradle -Duser.home=. -Duser.name=debian -Ddebian.package=milib -Dfile.encoding=UTF-8 --parallel --max-workers=20 jar openjdk version "17.0.11" 2024-04-16 OpenJDK Runtime Environment (build 17.0.11+9-Debian-1) OpenJDK 64-Bit Server VM (build 17.0.11+9-Debian-1, mixed mode, sharing) Initialized native services in: /build/reproducible-path/milib-2.2.0+dfsg/.gradle/native To honour the JVM settings for this build a new JVM will be forked. Please consider using the daemon: https://docs.gradle.org/4.4.1/userguide/gradle_daemon.html. Starting process 'Gradle build daemon'. Working directory: /build/reproducible-path/milib-2.2.0+dfsg/.gradle/daemon/4.4.1 Command: /usr/lib/jvm/java-17-openjdk-amd64/bin/java --add-opens java.base/java.lang=ALL-UNNAMED -Xbootclasspath/a:/usr/share/java/gradle-helper-hook.jar:/usr/share/java/maven-repo-helper.jar -Dfile.encoding=UTF-8 -Duser.country=US -Duser.language=en -Duser.variant -cp /usr/share/gradle/lib/gradle-launcher-4.4.1.jar org.gradle.launcher.daemon.bootstrap.GradleDaemon 4.4.1 Successfully started process 'Gradle build daemon' An attempt to start the daemon took 1.388 secs. The client will now receive all logging from the daemon (pid: 1822146). The daemon log file: /build/reproducible-path/milib-2.2.0+dfsg/.gradle/daemon/4.4.1/daemon-1822146.out.log Daemon will be stopped at the end of the build stopping after processing Closing daemon's stdin at end of input. The daemon will no longer process any standard input. Using 20 worker leases. Creating new cache for fileHashes, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/caches/4.4.1/fileHashes/fileHashes.bin, access org.gradle.cache.internal.DefaultCacheAccess@1e87e2e3 Creating new cache for resourceHashesCache, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/caches/4.4.1/fileHashes/resourceHashesCache.bin, access org.gradle.cache.internal.DefaultCacheAccess@1e87e2e3 Creating new cache for fileHashes, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/4.4.1/fileHashes/fileHashes.bin, access org.gradle.cache.internal.DefaultCacheAccess@6cd2d031 Starting Build Compiling initialization script '/build/reproducible-path/milib-2.2.0+dfsg/.gradle/init.d/init.gradle' using SubsetScriptTransformer. Creating new cache for metadata-1.1/results, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/caches/transforms-1/metadata-1.1/results.bin, access org.gradle.cache.internal.DefaultCacheAccess@1c0ef305 Compiling initialization script '/build/reproducible-path/milib-2.2.0+dfsg/.gradle/init.d/init.gradle' using BuildScriptTransformer. Settings evaluated using settings file '/build/reproducible-path/milib-2.2.0+dfsg/settings.gradle'. Settings file not found (/build/reproducible-path/milib-2.2.0+dfsg/settings.gradle) Root project name not defined in settings.gradle, defaulting to 'milib' instead of the name of the root directory 'milib-2.2.0+dfsg' Projects loaded. Root project using build file '/build/reproducible-path/milib-2.2.0+dfsg/build.gradle'. Included projects: [root project 'milib'] Keep-alive timer started Adding Debian repository to project 'milib' Parallel execution is an incubating feature. Evaluating root project 'milib' using build file '/build/reproducible-path/milib-2.2.0+dfsg/build.gradle'. Compiling build file '/build/reproducible-path/milib-2.2.0+dfsg/build.gradle' using SubsetScriptTransformer. Compiling build file '/build/reproducible-path/milib-2.2.0+dfsg/build.gradle' using BuildScriptTransformer. Adding Maven pom generation to project 'milib' Linking the generated javadoc to the system JDK API documentation All projects evaluated. Selected primary task 'jar' from project : Creating new cache for annotation-processors, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/4.4.1/fileContent/annotation-processors.bin, access org.gradle.cache.internal.DefaultCacheAccess@2e2e42ab Tasks to be executed: [task ':compileJava', task ':processResources', task ':classes', task ':debianMavenPom', task ':jar'] Creating new cache for resourceHashesCache, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/4.4.1/fileHashes/resourceHashesCache.bin, access org.gradle.cache.internal.DefaultCacheAccess@6cd2d031 Creating new cache for taskHistory, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/4.4.1/taskHistory/taskHistory.bin, access org.gradle.cache.internal.DefaultCacheAccess@70b3b516 Creating new cache for outputFiles, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/buildOutputCleanup/outputFiles.bin, access org.gradle.cache.internal.DefaultCacheAccess@5d26437e :compileJava (Thread[Task worker for ':' Thread 2,5,main]) started. :compileJava Putting task artifact state for task ':compileJava' into context took 0.009 secs. Creating new cache for metadata-2.36/module-metadata, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/caches/modules-2/metadata-2.36/module-metadata.bin, access org.gradle.cache.internal.DefaultCacheAccess@5b3d85ad Loading the Maven rules... Replacing org.apache.commons:commons-math3:jar:3.6.1 -> org.apache.commons:commons-math3:jar:debian Replacing cc.redberry:pipe:jar:1.3.0 -> cc.redberry:pipe:jar:1.0.0-alpha0 Replacing com.fasterxml.jackson:jackson-bom:jar:2.14.0 -> com.fasterxml.jackson:jackson-bom:jar:debian Passing through com.fasterxml.jackson:jackson-parent:jar:debian Passing through com.fasterxml:oss-parent:jar:debian Passing through com.fasterxml.jackson.core:jackson-databind:jar:2.x Passing through com.fasterxml.jackson:jackson-base:jar:debian Passing through com.fasterxml.jackson:jackson-bom:jar:debian Replacing org.apache.commons:commons-compress:jar:1.21 -> org.apache.commons:commons-compress:jar:debian Passing through org.apache.commons:commons-parent:jar:debian Passing through org.apache:apache:jar:debian Replacing commons-io:commons-io:jar:2.11.0 -> commons-io:commons-io:jar:debian Replacing org.lz4:lz4-java:jar:1.8.0 -> org.lz4:lz4-java:jar:debian Replacing com.beust:jcommander:jar:1.72 -> com.beust:jcommander:jar:debian Replacing net.sf.trove4j:trove4j:jar:3.0.3 -> net.sf.trove4j:trove4j:jar:debian Replacing com.google.guava:guava:jar:31.1-jre -> com.google.guava:guava:jar:debian Passing through com.google.guava:guava-parent:jar:debian Passing through com.fasterxml.jackson.core:jackson-annotations:jar:2.x Passing through com.fasterxml.jackson.core:jackson-core:jar:2.x Passing through org.jsr-305:jsr305:jar:0.x Passing through com.google.errorprone:error_prone_annotations:jar:debian Passing through com.google.errorprone:error_prone_parent:jar:debian Malformed jar [jackson-databind-2.x.jar] found on classpath. Gradle 5.0 will no longer allow malformed jars on a classpath. at org.gradle.api.internal.changedetection.state.AbstractClasspathSnapshotBuilder$JarHasher.hashMalformedZip(AbstractClasspathSnapshotBuilder.java:120) at org.gradle.api.internal.changedetection.state.AbstractClasspathSnapshotBuilder$JarHasher.hashJarContents(AbstractClasspathSnapshotBuilder.java:115) at org.gradle.api.internal.changedetection.state.AbstractClasspathSnapshotBuilder$JarHasher.hash(AbstractClasspathSnapshotBuilder.java:93) at org.gradle.api.internal.changedetection.state.ResourceSnapshotterCacheService.hashFile(ResourceSnapshotterCacheService.java:44) at org.gradle.api.internal.changedetection.state.AbstractClasspathSnapshotBuilder.visitJar(AbstractClasspathSnapshotBuilder.java:83) at org.gradle.api.internal.changedetection.state.AbstractClasspathSnapshotBuilder.visitFileSnapshot(AbstractClasspathSnapshotBuilder.java:76) at org.gradle.api.internal.changedetection.state.AbstractFileCollectionSnapshotter$FileCollectionVisitorImpl.visitCollection(AbstractFileCollectionSnapshotter.java:77) at org.gradle.api.internal.file.AbstractFileCollection.visitRootElements(AbstractFileCollection.java:234) at org.gradle.api.internal.file.CompositeFileCollection.visitRootElements(CompositeFileCollection.java:185) at org.gradle.api.internal.changedetection.state.AbstractFileCollectionSnapshotter.snapshot(AbstractFileCollectionSnapshotter.java:53) at org.gradle.api.internal.changedetection.state.DefaultCompileClasspathSnapshotter.snapshot(DefaultCompileClasspathSnapshotter.java:38) at org.gradle.api.internal.changedetection.state.CacheBackedTaskHistoryRepository.snapshotTaskFiles(CacheBackedTaskHistoryRepository.java:331) at org.gradle.api.internal.changedetection.state.CacheBackedTaskHistoryRepository.createExecution(CacheBackedTaskHistoryRepository.java:154) at org.gradle.api.internal.changedetection.state.CacheBackedTaskHistoryRepository.access$100(CacheBackedTaskHistoryRepository.java:61) at org.gradle.api.internal.changedetection.state.CacheBackedTaskHistoryRepository$1.getCurrentExecution(CacheBackedTaskHistoryRepository.java:114) at org.gradle.api.internal.changedetection.changes.DefaultTaskArtifactStateRepository$TaskArtifactStateImpl.getStates(DefaultTaskArtifactStateRepository.java:201) at org.gradle.api.internal.changedetection.changes.DefaultTaskArtifactStateRepository$TaskArtifactStateImpl.isUpToDate(DefaultTaskArtifactStateRepository.java:86) at org.gradle.api.internal.tasks.execution.SkipUpToDateTaskExecuter.execute(SkipUpToDateTaskExecuter.java:53) at org.gradle.api.internal.tasks.execution.ResolveTaskOutputCachingStateExecuter.execute(ResolveTaskOutputCachingStateExecuter.java:54) at org.gradle.api.internal.tasks.execution.ValidatingTaskExecuter.execute(ValidatingTaskExecuter.java:60) at org.gradle.api.internal.tasks.execution.SkipEmptySourceFilesTaskExecuter.execute(SkipEmptySourceFilesTaskExecuter.java:97) at org.gradle.api.internal.tasks.execution.CleanupStaleOutputsExecuter.execute(CleanupStaleOutputsExecuter.java:87) at org.gradle.api.internal.tasks.execution.ResolveTaskArtifactStateTaskExecuter.execute(ResolveTaskArtifactStateTaskExecuter.java:52) at org.gradle.api.internal.tasks.execution.SkipTaskWithNoActionsExecuter.execute(SkipTaskWithNoActionsExecuter.java:52) at org.gradle.api.internal.tasks.execution.SkipOnlyIfTaskExecuter.execute(SkipOnlyIfTaskExecuter.java:54) at org.gradle.api.internal.tasks.execution.ExecuteAtMostOnceTaskExecuter.execute(ExecuteAtMostOnceTaskExecuter.java:43) at org.gradle.api.internal.tasks.execution.CatchExceptionTaskExecuter.execute(CatchExceptionTaskExecuter.java:34) at org.gradle.execution.taskgraph.DefaultTaskGraphExecuter$EventFiringTaskWorker$1.run(DefaultTaskGraphExecuter.java:248) at org.gradle.internal.progress.DefaultBuildOperationExecutor$RunnableBuildOperationWorker.execute(DefaultBuildOperationExecutor.java:336) at org.gradle.internal.progress.DefaultBuildOperationExecutor$RunnableBuildOperationWorker.execute(DefaultBuildOperationExecutor.java:328) at org.gradle.internal.progress.DefaultBuildOperationExecutor.execute(DefaultBuildOperationExecutor.java:199) at org.gradle.internal.progress.DefaultBuildOperationExecutor.run(DefaultBuildOperationExecutor.java:110) at org.gradle.execution.taskgraph.DefaultTaskGraphExecuter$EventFiringTaskWorker.execute(DefaultTaskGraphExecuter.java:241) at org.gradle.execution.taskgraph.DefaultTaskGraphExecuter$EventFiringTaskWorker.execute(DefaultTaskGraphExecuter.java:230) at org.gradle.execution.taskgraph.DefaultTaskPlanExecutor$TaskExecutorWorker.processTask(DefaultTaskPlanExecutor.java:123) at org.gradle.execution.taskgraph.DefaultTaskPlanExecutor$TaskExecutorWorker.access$200(DefaultTaskPlanExecutor.java:79) at org.gradle.execution.taskgraph.DefaultTaskPlanExecutor$TaskExecutorWorker$1.execute(DefaultTaskPlanExecutor.java:104) at org.gradle.execution.taskgraph.DefaultTaskPlanExecutor$TaskExecutorWorker$1.execute(DefaultTaskPlanExecutor.java:98) at org.gradle.execution.taskgraph.DefaultTaskExecutionPlan.execute(DefaultTaskExecutionPlan.java:626) at org.gradle.execution.taskgraph.DefaultTaskExecutionPlan.executeWithTask(DefaultTaskExecutionPlan.java:581) at org.gradle.execution.taskgraph.DefaultTaskPlanExecutor$TaskExecutorWorker.run(DefaultTaskPlanExecutor.java:98) at org.gradle.internal.concurrent.ExecutorPolicy$CatchAndRecordFailures.onExecute(ExecutorPolicy.java:63) at org.gradle.internal.concurrent.ManagedExecutorImpl$1.run(ManagedExecutorImpl.java:46) at java.base/java.util.concurrent.ThreadPoolExecutor.runWorker(ThreadPoolExecutor.java:1136) at java.base/java.util.concurrent.ThreadPoolExecutor$Worker.run(ThreadPoolExecutor.java:635) at org.gradle.internal.concurrent.ThreadFactoryImpl$ManagedThreadRunnable.run(ThreadFactoryImpl.java:55) at java.base/java.lang.Thread.run(Thread.java:840) Up-to-date check for task ':compileJava' took 3.981 secs. It is not up-to-date because: No history is available. All input files are considered out-of-date for incremental task ':compileJava'. Compiling with JDK Java compiler API. Note: Some input files use or override a deprecated API. Note: Recompile with -Xlint:deprecation for details. Note: Some input files use unchecked or unsafe operations. Note: Recompile with -Xlint:unchecked for details. :compileJava (Thread[Task worker for ':' Thread 2,5,main]) completed. Took 15.201 secs. :processResources (Thread[Task worker for ':' Thread 2,5,main]) started. :processResources Putting task artifact state for task ':processResources' into context took 0.0 secs. Up-to-date check for task ':processResources' took 0.01 secs. It is not up-to-date because: No history is available. :processResources (Thread[Task worker for ':' Thread 2,5,main]) completed. Took 0.057 secs. :classes (Thread[Task worker for ':' Thread 2,5,main]) started. :classes Skipping task ':classes' as it has no actions. :classes (Thread[Task worker for ':' Thread 2,5,main]) completed. Took 0.001 secs. :debianMavenPom (Thread[Task worker for ':' Thread 2,5,main]) started. :debianMavenPom Putting task artifact state for task ':debianMavenPom' into context took 0.0 secs. Up-to-date check for task ':debianMavenPom' took 0.001 secs. It is not up-to-date because: No history is available. Generating pom file /build/reproducible-path/milib-2.2.0+dfsg/build/debian/milib.pom :debianMavenPom (Thread[Task worker for ':' Thread 2,5,main]) completed. Took 0.124 secs. :jar (Thread[Task worker for ':' Thread 2,5,main]) started. :jar Putting task artifact state for task ':jar' into context took 0.0 secs. Up-to-date check for task ':jar' took 0.034 secs. It is not up-to-date because: No history is available. :jar (Thread[Task worker for ':' Thread 2,5,main]) completed. Took 0.325 secs. BUILD SUCCESSFUL in 23s 4 actionable tasks: 4 executed dh_auto_test mkdir -p .gradle/init.d cp /usr/share/gradle-debian-helper/init.gradle .gradle/init.d/ gradle --info --console plain --offline --stacktrace --no-daemon --refresh-dependencies --gradle-user-home .gradle -Duser.home=. -Duser.name=debian -Ddebian.package=milib -Dfile.encoding=UTF-8 --parallel --max-workers=20 test openjdk version "17.0.11" 2024-04-16 OpenJDK Runtime Environment (build 17.0.11+9-Debian-1) OpenJDK 64-Bit Server VM (build 17.0.11+9-Debian-1, mixed mode, sharing) Initialized native services in: /build/reproducible-path/milib-2.2.0+dfsg/.gradle/native To honour the JVM settings for this build a new JVM will be forked. Please consider using the daemon: https://docs.gradle.org/4.4.1/userguide/gradle_daemon.html. Starting process 'Gradle build daemon'. Working directory: /build/reproducible-path/milib-2.2.0+dfsg/.gradle/daemon/4.4.1 Command: /usr/lib/jvm/java-17-openjdk-amd64/bin/java --add-opens java.base/java.lang=ALL-UNNAMED -Xbootclasspath/a:/usr/share/java/gradle-helper-hook.jar:/usr/share/java/maven-repo-helper.jar -Dfile.encoding=UTF-8 -Duser.country=US -Duser.language=en -Duser.variant -cp /usr/share/gradle/lib/gradle-launcher-4.4.1.jar org.gradle.launcher.daemon.bootstrap.GradleDaemon 4.4.1 Successfully started process 'Gradle build daemon' An attempt to start the daemon took 3.721 secs. The client will now receive all logging from the daemon (pid: 1828541). The daemon log file: /build/reproducible-path/milib-2.2.0+dfsg/.gradle/daemon/4.4.1/daemon-1828541.out.log Daemon will be stopped at the end of the build stopping after processing Closing daemon's stdin at end of input. The daemon will no longer process any standard input. Using 20 worker leases. Creating new cache for fileHashes, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/caches/4.4.1/fileHashes/fileHashes.bin, access org.gradle.cache.internal.DefaultCacheAccess@20518a1e Creating new cache for resourceHashesCache, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/caches/4.4.1/fileHashes/resourceHashesCache.bin, access org.gradle.cache.internal.DefaultCacheAccess@20518a1e Creating new cache for fileHashes, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/4.4.1/fileHashes/fileHashes.bin, access org.gradle.cache.internal.DefaultCacheAccess@5efb03be Starting Build Creating new cache for metadata-1.1/results, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/caches/transforms-1/metadata-1.1/results.bin, access org.gradle.cache.internal.DefaultCacheAccess@6206e9e9 Settings evaluated using settings file '/build/reproducible-path/milib-2.2.0+dfsg/settings.gradle'. Settings file not found (/build/reproducible-path/milib-2.2.0+dfsg/settings.gradle) Root project name not defined in settings.gradle, defaulting to 'milib' instead of the name of the root directory 'milib-2.2.0+dfsg' Projects loaded. Root project using build file '/build/reproducible-path/milib-2.2.0+dfsg/build.gradle'. Included projects: [root project 'milib'] Keep-alive timer started Adding Debian repository to project 'milib' Parallel execution is an incubating feature. Evaluating root project 'milib' using build file '/build/reproducible-path/milib-2.2.0+dfsg/build.gradle'. Adding Maven pom generation to project 'milib' Linking the generated javadoc to the system JDK API documentation All projects evaluated. Selected primary task 'test' from project : Creating new cache for annotation-processors, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/4.4.1/fileContent/annotation-processors.bin, access org.gradle.cache.internal.DefaultCacheAccess@a6c995b Tasks to be executed: [task ':compileJava', task ':processResources', task ':classes', task ':compileTestJava', task ':processTestResources', task ':testClasses', task ':test'] Creating new cache for resourceHashesCache, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/4.4.1/fileHashes/resourceHashesCache.bin, access org.gradle.cache.internal.DefaultCacheAccess@5efb03be Creating new cache for taskHistory, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/4.4.1/taskHistory/taskHistory.bin, access org.gradle.cache.internal.DefaultCacheAccess@3370f323 Creating new cache for outputFiles, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/buildOutputCleanup/outputFiles.bin, access org.gradle.cache.internal.DefaultCacheAccess@4e10aa96 :compileJava (Thread[Task worker for ':',5,main]) started. :compileJava Putting task artifact state for task ':compileJava' into context took 0.021 secs. Creating new cache for metadata-2.36/module-metadata, path /build/reproducible-path/milib-2.2.0+dfsg/.gradle/caches/modules-2/metadata-2.36/module-metadata.bin, access org.gradle.cache.internal.DefaultCacheAccess@61b86b68 Loading the Maven rules... Replacing org.apache.commons:commons-math3:jar:3.6.1 -> org.apache.commons:commons-math3:jar:debian Replacing cc.redberry:pipe:jar:1.3.0 -> cc.redberry:pipe:jar:1.0.0-alpha0 Replacing com.fasterxml.jackson:jackson-bom:jar:2.14.0 -> com.fasterxml.jackson:jackson-bom:jar:debian Passing through com.fasterxml.jackson:jackson-parent:jar:debian Passing through com.fasterxml:oss-parent:jar:debian Passing through com.fasterxml.jackson.core:jackson-databind:jar:2.x Passing through com.fasterxml.jackson:jackson-base:jar:debian Passing through com.fasterxml.jackson:jackson-bom:jar:debian Replacing org.apache.commons:commons-compress:jar:1.21 -> org.apache.commons:commons-compress:jar:debian Passing through org.apache.commons:commons-parent:jar:debian Passing through org.apache:apache:jar:debian Replacing commons-io:commons-io:jar:2.11.0 -> commons-io:commons-io:jar:debian Replacing org.lz4:lz4-java:jar:1.8.0 -> org.lz4:lz4-java:jar:debian Replacing com.beust:jcommander:jar:1.72 -> com.beust:jcommander:jar:debian Replacing net.sf.trove4j:trove4j:jar:3.0.3 -> net.sf.trove4j:trove4j:jar:debian Replacing com.google.guava:guava:jar:31.1-jre -> com.google.guava:guava:jar:debian Passing through com.google.guava:guava-parent:jar:debian Passing through com.fasterxml.jackson.core:jackson-annotations:jar:2.x Passing through com.fasterxml.jackson.core:jackson-core:jar:2.x Passing through org.jsr-305:jsr305:jar:0.x Passing through com.google.errorprone:error_prone_annotations:jar:debian Passing through com.google.errorprone:error_prone_parent:jar:debian Skipping task ':compileJava' as it is up-to-date (took 3.112 secs). :compileJava UP-TO-DATE :compileJava (Thread[Task worker for ':',5,main]) completed. Took 3.351 secs. :processResources (Thread[Task worker for ':',5,main]) started. :processResources Putting task artifact state for task ':processResources' into context took 0.0 secs. Skipping task ':processResources' as it is up-to-date (took 0.028 secs). :processResources UP-TO-DATE :processResources (Thread[Task worker for ':',5,main]) completed. Took 0.038 secs. :classes (Thread[Task worker for ':',5,main]) started. :classes Skipping task ':classes' as it has no actions. :classes UP-TO-DATE :classes (Thread[Task worker for ':',5,main]) completed. Took 0.009 secs. :compileTestJava (Thread[Task worker for ':',5,main]) started. :compileTestJava Putting task artifact state for task ':compileTestJava' into context took 0.0 secs. Replacing junit:junit:jar:4.13.2 -> junit:junit:jar:4.x Replacing org.mockito:mockito-all:jar:1.10.19 -> org.mockito:mockito-all:jar:debian org.mockito:mockito-all:debian is relocated to org.mockito:mockito-core:debian. Please update your dependencies. Passing through org.hamcrest:hamcrest:jar:debian Passing through org.mockito:mockito-core:jar:debian Passing through net.bytebuddy:byte-buddy:jar:debian Passing through net.bytebuddy:byte-buddy-parent:jar:debian Passing through net.bytebuddy:byte-buddy-agent:jar:debian Passing through org.objenesis:objenesis:jar:debian Passing through org.objenesis:objenesis-parent:jar:debian Passing through net.bytebuddy:byte-buddy-dep:jar:debian Passing through org.ow2.asm:asm:jar:debian Passing through org.ow2.asm:asm-commons:jar:debian Up-to-date check for task ':compileTestJava' took 6.933 secs. It is not up-to-date because: No history is available. All input files are considered out-of-date for incremental task ':compileTestJava'. Compiling with JDK Java compiler API. Note: Some input files use or override a deprecated API. Note: Recompile with -Xlint:deprecation for details. Note: Some input files use unchecked or unsafe operations. Note: Recompile with -Xlint:unchecked for details. :compileTestJava (Thread[Task worker for ':',5,main]) completed. Took 23.735 secs. :processTestResources (Thread[Task worker for ':',5,main]) started. :processTestResources Putting task artifact state for task ':processTestResources' into context took 0.0 secs. Up-to-date check for task ':processTestResources' took 0.087 secs. It is not up-to-date because: No history is available. :processTestResources (Thread[Task worker for ':',5,main]) completed. Took 0.295 secs. :testClasses (Thread[Task worker for ':',5,main]) started. :testClasses Skipping task ':testClasses' as it has no actions. :testClasses (Thread[Task worker for ':',5,main]) completed. Took 0.006 secs. :test (Thread[Task worker for ':',5,main]) started. :test Putting task artifact state for task ':test' into context took 0.0 secs. Up-to-date check for task ':test' took 1.613 secs. It is not up-to-date because: No history is available. Starting process 'Gradle Test Executor 1'. Working directory: /build/reproducible-path/milib-2.2.0+dfsg Command: /usr/lib/jvm/java-17-openjdk-amd64/bin/java -Dorg.gradle.native=false @/tmp/gradle-worker-classpath14556273590592567830txt -Xms1024m -Xmx2048m -Dfile.encoding=UTF-8 -Duser.country=US -Duser.language=en -Duser.variant -ea worker.org.gradle.process.internal.worker.GradleWorkerMain 'Gradle Test Executor 1' Successfully started process 'Gradle Test Executor 1' Gradle Test Executor 1 started executing tests. com.milaboratory.core.io.util.IOUtilTest > test111 STANDARD_OUT 3 3 -2147483648 -9223372036854775808 com.milaboratory.core.io.sequence.fasta.RandomAccessFastaReaderTest > test1nt STANDARD_ERROR Indexing milib_91201ed2d258bd3a61078bc485c418967058c4e013805262604770162710.fasta: 0% Indexing milib_91201ed2d258bd3a61078bc485c418967058c4e013805262604770162710.fasta: done com.milaboratory.core.io.sequence.fasta.RandomAccessFastaReaderTest > test1 STANDARD_ERROR Indexing milib_91201ed2d258bd3a61078bc485c418967058c4e013805262604770162710.fasta: 0% Indexing milib_91201ed2d258bd3a61078bc485c418967058c4e013805262604770162710.fasta: done com.milaboratory.core.io.sequence.fasta.RandomAccessFastaReaderTest > test2 STANDARD_ERROR Indexing milib_4f42440809bf94c31e1753182eb4e8dfc4e90dbd10097159566533091373.tmp: 0% Indexing milib_4f42440809bf94c31e1753182eb4e8dfc4e90dbd10097159566533091373.tmp: done com.milaboratory.core.tree.SequenceTreeMapTest > testCase9 STANDARD_OUT Hit 1 0 ac-gacTtgactg 11 0 acTgac-tgactg 11 Hit 2 0 ac-gactTgactg 11 0 acTgact-gactg 11 com.milaboratory.core.tree.SequenceTreeMapTest > optimalityAndScopeTest STANDARD_OUT --NW alignments-- CASSLAPGATN-KLFF CASS-APGATNEKLFF CASSLAPGATN-KLFF CASSLAPG-TNEKLFF CASSLAPGATN-KLfF CASSLAPG-TNEKLyF --STM alignments-- CASSLAPGATN-KLFF CASS-APGATNEKLFF CASSLAPGATN-KLFF CASSLAPG-TNEKLFF CASSlAPGATN-KLFF CASSa-PGATNEKLFF CASSLAPGaTN-KLFF CASSLAPGt-NEKLFF CASSlAPGATN-KLFF CA-SsAPGATNEKLFF CASSlAPGATN-KLFF CAS-sAPGATNEKLFF CASSLAPGATNk-LFF CASS-APGATNeKLFF CASSLAPGaTN-KLFF CASSLAP-gTNEKLFF CASSLAPGATNk-LFF CASSLAPG-TNeKLFF CASSLAPGATN-KLfF CASSLAPG-TNEKLyF ------------------ com.milaboratory.core.tree.PrimerGenerator > generate SKIPPED com.milaboratory.core.motif.BitapPatternTest > ttt STANDARD_OUT 0 ATTWCCGACA 9 ||| |||| 20 ATTT--GACA 27 [S3:W->T,D4:C,D5:C] 24 -26 com.milaboratory.core.alignment.BandedAffineAlignerTest > test11 STANDARD_OUT 0 --------------------- -1 0 ATAAAAAAAAAAACGAGCTAG 20 0 --------------------- -1 0 ATAAAAAAAAAAACGAGCTAG 20 com.milaboratory.core.alignment.BandedAffineAlignerTest > test23 STANDARD_OUT 0 atgcggggatgc 11 0 atgcggggatgc 11 com.milaboratory.core.alignment.BandedAffineAlignerTest > test1 STANDARD_OUT 0 at-----------cgagctagTTTTTTTTTTT 20 0 atAAAAAAAAAAAcgagctag----------- 20 0 at-----------cgagctagTTTTTTTTTTT 20 0 atAAAAAAAAAAAcgagctag----------- 20 com.milaboratory.core.alignment.BandedAffineAlignerTest > test2 STANDARD_OUT 0 atgcGGGGatgc 11 0 atgcTA--atgc 9 0 atgcGGGGatgc----------- 11 0 atgcTA--atgcTTTTTTTTTTT 20 com.milaboratory.core.alignment.BandedAffineAlignerTest > test3 STANDARD_OUT 0 cgtaGGGGcgta 11 11 cgta--ATcgta 20 0 -----------cgtaGGGGcgta 11 0 TTTTTTTTTTTcgtaAT--cgta 20 com.milaboratory.core.alignment.BandedAffineAlignerTest > test4 STANDARD_OUT 0 atgcggggat-gTTTTT 15 0 atgcggggatAg----- 11 0 atgcggggat-gTTTTTTT 17 0 atgcggggatAg------- 11 com.milaboratory.core.alignment.BandedAffineAlignerTest > test5 STANDARD_OUT 7 g-taggggcgta 17 0 gAtaggggcgta 11 0 TTTTTTTg-taggggcgta 17 0 -------gAtaggggcgta 11 com.milaboratory.core.alignment.BandedAffineAlignerTest > test6 STANDARD_OUT 0 0 0 0 com.milaboratory.core.alignment.BandedAffineAlignerTest > semiGlobalLeft1 STANDARD_OUT 0 gCccTtgtgatgacccagactccagcctccgtgGAGgCaGctgtgggaggcacagtcaccatcaagtgccaggccagtcagagcattagcaacctcttaGCCTGGTATCAGCAGAAACCAGGGCAGCCTCCCAAGCTCCTGATCTATTATGCATCCGATCTGGcatctggggtctcatcaaggttcaaaggcagtggatctgggacagagtAcactctcaccatcagTggcgtgcagtgtgccgatgctgccacttactac 260 1 gAccCtgtgatgacccagactccagcctccgtgTCTgAaCctgtgggaggcacagtcaccatcaagtgccaggccagtcagagcattagcaacctctta-------------------------------------------------------------NNNcatctggggtctcatcaaggttcaaaggcagtggatctgggacagagtTcactctcaccatcagCggcgtgcagtgtgccgatgctgccacttactac 200 com.milaboratory.core.alignment.AlignerTest > testCalculateScore1 STANDARD_OUT 6.52us 3.99us 3.99us com.milaboratory.core.alignment.AlignmentIteratorTest > test1 STANDARD_OUT 0 -ATT-AGACA-- 7 ||| || | 0 AATTGGGA-ATT 10 I0AI3GSA3GDC6I8TI8T com.milaboratory.core.alignment.batch.SimpleBatchAlignerTest > test1 STANDARD_OUT 4 hits. com.milaboratory.core.alignment.MultiAlignmentHelperTest > test1 STANDARD_OUT 8 AGACACAGATACA 20 ||||||| ||||| 0 AGACACATATACA 12 0 GATACATTAGACACAGATACA--- 20 ||||||| ||||| 0 --------AGACACATATACACAG 15 0 GATACATTAGA---CACAGATACA 20 ||||||||||| |||||||||| 5 GATACATTAGAGACCACAGATACA 28 0 GATAC-----ATTAGA---CACAGATACA 20 ||||| |||||| |||||||||| 0 GATACGATACATTAGAGACCACAGATACA 28 Quality 78778 878777 7778887878 Subject 0 GATAC-----ATTAGA---CACAGATACA--- 20 Query0 0 aga---cacaTataca 12 Query1 0 -------------aga---cacaTatacaCAG 15 Query2 5 gatac-----attagaGACcacagataca 28 Query3 0 gatacGATACattagaGACcacagataca 28 Quality 78778 Subject 0 GATAC 4 Query1 0 ----- 0 Query2 5 gatac 9 Query3 0 gatac 4 Quality Subject 5 ----- 5 Query1 0 ----- 0 Query2 10 ----- 10 Query3 5 GATAC 9 Quality 87877 Subject 5 ATTAG 9 Query0 0 ag 1 Query1 0 ---ag 1 Query2 10 attag 14 Query3 10 attag 14 Quality 7 7 Subject 10 A---C 11 Query0 2 a---c 3 Query1 2 a---c 3 Query2 15 aGACc 19 Query3 15 aGACc 19 Quality 77888 Subject 12 ACAGA 16 Query0 4 acaTa 8 Query1 4 acaTa 8 Query2 20 acaga 24 Query3 20 acaga 24 Quality 7878 Subject 17 TACA- 20 Query0 9 taca 12 Query1 9 tacaC 13 Query2 25 taca 28 Query3 25 taca 28 Quality Subject 21 -- 21 Query1 14 AG 15 0 GATAC-----ATTAGA---CACAGATACA--- 20 0 ...---....T..... 12 0 -------------...---....T.....CAG 15 5 .....-----......GAC.......... 28 0 .....GATAC......GAC.......... 28 787788787777778887878 0 GATACATTAGACACAGATACA 20 com.milaboratory.core.alignment.MultiAlignmentHelperTest > test2 STANDARD_OUT 15 TATAGGGAGAACTCCGATCGACATCG 40 ||||||||| ||||||||||||||| 0 TATAGGGAG--CTCCGATCGACATCG 23 56 CGATCC--CGGTGACAAAGCGTTCGGACC 82 |||||| ||||||||||||||||||||| 0 CGATCCTTCGGTGACAAAGCGTTCGGACC 28 36 CATCGGGTATCGCCCTGGTACG 57 |||| ||||||||||||||||| 0 CATCAGGTATCGCCCTGGTACG 21 0 AACGATGGGCGCAAATATAGGGAGAACTCCGATCGACATCGGGTATCGCCCTGGTACGATCC--CGGTGACAAAGCGTTCGGACCTGTCTGGACGCTAGAACGC 101 0 tatagggag--ctccgatcgacatcg 23 0 cgatccTTcggtgacaaagcgttcggacc 28 0 catcAggtatcgccctggtacg 21 com.milaboratory.core.alignment.blast.BlastAlignerTest > test1 SKIPPED com.milaboratory.core.alignment.blast.BlastAlignerTest > simpleRandomTestT1 SKIPPED com.milaboratory.core.alignment.blast.BlastAlignerTest > simpleRandomTestT2 SKIPPED com.milaboratory.core.alignment.blast.BlastAlignerTest > simpleRandomTestT3 SKIPPED com.milaboratory.core.alignment.blast.BlastAlignerExtTest > test16SMicrobial1 SKIPPED com.milaboratory.core.alignment.blast.BlastAlignerExtTest > test1 SKIPPED com.milaboratory.core.alignment.blast.BlastDBBuilderTest > test1 SKIPPED com.milaboratory.core.alignment.AlignmentTrimmerTest > testRandom1 STANDARD_OUT lTrimmed = 1729 rTrimmed = 1673 lTrimmed = 2718 rTrimmed = 2812 com.milaboratory.core.alignment.kaligner2.KAligner2Test > testBoundaries STANDARD_OUT 4951 com.milaboratory.core.alignment.kaligner2.KAligner2Test > caseJ1 STANDARD_OUT 52 0 TGATGCTTTTGATATCTGGGGCCAAGGGACAATGGTCACCGTCTCTTCAGGA 51 ||||||||||||||||||||||||||||||||||||||||||||||||||| 55 TGATGCTTTTGATATCTGGGGCCAAGGGACAATGGTCACCGTCTCTTCAGGG 106 [S51:A->G] (0->52) (55->107) com.milaboratory.core.alignment.kaligner2.KAligner2Test > testCase0 SKIPPED com.milaboratory.core.alignment.kaligner2.KAligner2Test > testSimpleRandomTest STANDARD_OUT Time per query: 654.45us Processed queries: 63 Bad percent: 0.0 False positive percent: 0.5449953476006912 Scoring error percent: 1.5873015873015872 com.milaboratory.core.alignment.kaligner2.KMapper2Test > test11112 STANDARD_OUT ID: 0 Score: 1713 Cluster 0: Q 24 -> T 12 - -12 Q 27 -> T 15 - -12 Q 30 -> T 18 - -12 Q 39 -> T 28 - -11 Q 42 -> T 31 - -11 Q 45 -> T 34 - -11 Q 48 -> T 37 - -11 Q 51 -> T 40 - -11 Cluster 1: Q 84 -> T 50 - -34 Q 87 -> T 53 - -34 Q 90 -> T 56 - -34 Q 93 -> T 59 - -34 Q 96 -> T 62 - -34 Q 99 -> T 65 - -34 Q 111 -> T 79 - -32 Q 114 -> T 82 - -32 Cluster 2: Q 150 -> T 92 - -58 Q 153 -> T 95 - -58 Q 156 -> T 98 - -58 Q 159 -> T 101 - -58 Cluster 3: Q 198 -> T 120 - -78 Q 201 -> T 123 - -78 Q 204 -> T 126 - -78 Q 207 -> T 129 - -78 Q 216 -> T 139 - -77 Q 219 -> T 142 - -77 Q 231 -> T 153 - -78 Q 234 -> T 156 - -78 Q 237 -> T 159 - -78 Cluster 4: Q 246 -> T 178 - -68 Q 249 -> T 181 - -68 Q 252 -> T 184 - -68 Q 255 -> T 187 - -68 Q 258 -> T 190 - -68 Q 261 -> T 193 - -68 Q 262 -> T 194 - -68 com.milaboratory.core.alignment.kaligner2.KMapper2Test > test1111 STANDARD_OUT ID: 0 Score: 1407 Cluster 0: Q 9 -> T 15 - 6 Q 12 -> T 18 - 6 Q 15 -> T 21 - 6 Q 18 -> T 24 - 6 Q 21 -> T 27 - 6 Q 24 -> T 30 - 6 Q 27 -> T 33 - 6 Q 30 -> T 36 - 6 Q 33 -> T 39 - 6 Cluster 1: Q 57 -> T 48 - -9 Q 60 -> T 51 - -9 Q 69 -> T 61 - -8 Q 72 -> T 64 - -8 Q 78 -> T 69 - -9 Q 81 -> T 72 - -9 Q 84 -> T 75 - -9 Q 87 -> T 78 - -9 Cluster 2: Q 123 -> T 89 - -34 Q 126 -> T 92 - -34 Q 129 -> T 95 - -34 Q 132 -> T 98 - -34 Q 135 -> T 101 - -34 Q 150 -> T 116 - -34 Q 168 -> T 132 - -36 Q 171 -> T 135 - -36 Q 174 -> T 138 - -36 Q 177 -> T 141 - -36 Q 180 -> T 144 - -36 Q 183 -> T 147 - -36 Q 185 -> T 149 - -36 com.milaboratory.core.alignment.kaligner2.KMapper2Test > testRandom1 STANDARD_OUT noHits: 265 noHits2: 0 noHits3: 0 wrongTopHit: 41 wrongTopHitS: 32 noCorrectHitInList: 22 Timings: DescriptiveStatistics: n: 100000 min: 9134.0 max: 3.38268096E8 mean: 124193.17118998522 std dev: 2078285.4598909407 median: 97726.0 skewness: 115.46891657615426 kurtosis: 14825.438485841638 Clusters basicSize DescriptiveStatistics: n: 99694 min: 1.0 max: 6.0 mean: 2.8773547053985102 std dev: 1.0997213182673369 median: 3.0 skewness: 0.283977620401302 kurtosis: -0.6880637982362976 Top Delta DescriptiveStatistics: n: 99713 min: -26.0 max: 0.0 mean: -0.0016848354778213669 std dev: 0.18152705429823823 median: 0.0 skewness: -116.88690939017269 kurtosis: 14353.226954178921 com.milaboratory.core.alignment.kaligner2.OffsetPacksAccumulatorTest > testScoreCorrection2 SKIPPED com.milaboratory.core.alignment.AlignerCustomTest > testSemiLocal0 STANDARD_OUT 29.0 2 c----cccTTgaa---tgTtaGTa-----taacta--tct 27 0 cAGTTccc--gaaACCtgCta--aGCTCTtaactaCTtct 35 29.0 2 c----cccTTgaa---tgTtaGTa-----taacta--tct 27 0 cAGTTccc--gaaACCtgCta--aGCTCTtaactaCTtct 35 com.milaboratory.core.alignment.BandedLinearAlignerTest > testCase1 STANDARD_OUT GCGTGAAGACTGCAGGCATTGAGTACGTTACTAGTCCAGTGGGGCCCAACCGTAACATTGCGTGTGACTGGTTGCTTAGCGGGTGACGGCGTTTCAGGTTACGCCCTCTGTGCATCACCGATAGCGTTGTTTGAGCTTTCTAACGTCTCAAACCTGCTTGCGCCCTACGGTTTCTCTATATATACACGAAAGGGGCTGGTCGCAACCTCGCAATTCTATCCCTCCAACCTCCCTCGAATTTTT AAAGCGTGAAGACTTGCAGGCATTGGTACGTTATTAGTCCAGTGGGGCCACAACCGTAACATTGCGTGTGACTGGTGCTTAGCGGGTGACGGCGTTCAGGTTACGCCCTCTGTGCATCACCGATTAGCGTTGTCTGAGCTTTCTAACGTCTCAAACCTGCTTGCGCCCTACGGTTTCTCTATAGTATCACGAAAGGGTCTGGTCGCAACCTCGCAATTCTATCCCTCCAACCTCCCTTGAATTTTTCTA com.milaboratory.core.alignment.BandedLinearAlignerTest > testGlobal1 STANDARD_OUT 1 AATTGACA 8 |||||| 0 TATTGACT 7 com.milaboratory.core.alignment.BandedLinearAlignerTest > testGlobal2 STANDARD_OUT 1 AATTGACAG 9 |||||| | 0 TATTGAC-G 7 com.milaboratory.core.alignment.BandedLinearAlignerTest > testGlobal3 STANDARD_OUT 0 TATTGACT 7 |||||| 1 AATTGACA 8 com.milaboratory.core.alignment.BandedLinearAlignerTest > testGlobal4 STANDARD_OUT 0 TATTGAC-G 7 |||||| | 1 AATTGACAG 9 com.milaboratory.core.alignment.kaligner1.KAlignerTest > testRandomCorrectness STANDARD_OUT C=1182;I=0;M=0;ScE=0;R=0.0 AlignmentTime = 212.38us C=1642;I=1;M=0;ScE=0;R=0.0 AlignmentTime = 136.01us C=2048;I=0;M=0;ScE=0;R=0.0 AlignmentTime = 113.07us C=2142;I=0;M=0;ScE=0;R=8.333333333333333E-7 AlignmentTime = 120.13us com.milaboratory.core.alignment.kaligner1.KAlignerTest > testRandom1 STANDARD_OUT ##teamcity[buildStatisticValue key='kmFound' value='0.9449'] ##teamcity[buildStatisticValue key='kmWrong' value='1.0E-4'] ##teamcity[buildStatisticValue key='kmFalse' value='0.0058'] com.milaboratory.core.alignment.kaligner1.KAlignerTest > testRandomCorrectnessConcurrent STANDARD_OUT C=3000;I=0;M=0;ScE=0;R=0.0 AlignmentTime = 3.95ms C=2996;I=0;M=0;ScE=1;R=8.333333333333333E-7 AlignmentTime = 122.03us C=2995;I=0;M=0;ScE=0;R=0.0 AlignmentTime = 124.50us C=2996;I=0;M=3;ScE=0;R=0.0 AlignmentTime = 118.80us com.milaboratory.core.alignment.kaligner1.KMapperTest > testBestOffset2 STANDARD_OUT -205 com.milaboratory.core.alignment.AlignmentHelperTest > test1 STANDARD_OUT 0 GAGGTGCAGCTGGTGGAGTCTGGGGGAGGC 29 |||||||||||||||||||||||||||||| 0 GAGGTGCAGCTGGTGGAGTCTGGGGGAGGC 29 30 TTGGT-ACAGCCTGGGGGGTCCCTGAGACT 58 |||| | |||||||||||||| |||||| 30 CTGGTCA-AGCCTGGGGGGTCCATGAGACA 58 59 CTCCTGTGCAGCCTCTGGATTCACCTTCAG 88 |||||||||||||||||||||| ||||||| 59 CTCCTGTGCAGCCTCTGGATTCCCCTTCAG 88 89 TAGC-TATAGCATGAACTGGGTCCGCCAGG 117 || | ||||||||||||||||||||||||| 89 TA-CTTATAGCATGAACTGGGTCCGCCAGG 117 118 CTCCAGGGAAGGGGCTGGAGTGGGTTTCAT 147 ||||||||||||||||||||||||| |||| 118 CTCCAGGGAAGGGGCTGGAGTGGGTCTCAT 147 148 ACATTAGTAGTAGTAGTAG-TACCATATAC 176 |||||||||| ||||||| || |||||| 148 CCATTAGTAGTGGTAGTAGTTA-CATATAT 176 177 TACGCAGACTCTGTGAAGGGCCGATTCACC 206 ||||||||||| |||||||||||||||||| 177 TACGCAGACTCCGTGAAGGGCCGATTCACC 206 207 ATCTCCAGAGACAATGCCAAGAACTCACTG 236 |||||||||||||| ||||||||||||||| 207 ATCTCCAGAGACAACGCCAAGAACTCACTG 236 237 TATCTGCAAATGAACAGCCTGAGAGACGAG 266 ||||||||||||||||||||||||| |||| 237 TATCTGCAAATGAACAGCCTGAGAGCCGAG 266 267 GACACGGCTGTGTATTACTGTGC 289 ||||||||||||||||||||||| 267 GACACGGCTGTGTATTACTGTGC 289 com.milaboratory.core.alignment.AlignmentTest > testInvert STANDARD_OUT 8 AGACACAGATACA 20 ||||||| ||||| 0 AGACACATATACA 12 0 AGACACATATACA 12 ||||||| ||||| 8 AGACACAGATACA 20 0 GATACATTAGACACAGATACA--- 20 ||||||| ||||| 0 --------AGACACATATACACAG 15 0 --------AGACACATATACACAG 15 ||||||| ||||| 0 GATACATTAGACACAGATACA--- 20 0 GATACATTAGA---CACAGATACA 20 ||||||||||| |||||||||| 5 GATACATTAGAGACCACAGATACA 28 5 GATACATTAGAGACCACAGATACA 28 ||||||||||| |||||||||| 0 GATACATTAGA---CACAGATACA 20 0 GATAC-----ATTAGA---CACAGATACA 20 ||||| |||||| |||||||||| 0 GATACGATACATTAGAGACCACAGATACA 28 0 GATACGATACATTAGAGACCACAGATACA 28 ||||| |||||| |||||||||| 0 GATAC-----ATTAGA---CACAGATACA 20 com.milaboratory.core.RangeTest > test23e14 STANDARD_OUT 1000001 1010100 1000111 1000011 1000010 com.milaboratory.core.merger.MergerParametersTest > test2 STANDARD_OUT { "qualityMergingAlgorithm": "SumSubtraction", "partsLayout": "Collinear", "minimalOverlap": 15, "maxQuality": 50, "minimalIdentity": 0.8, "identityType": "Unweighted" } com.milaboratory.core.mutations.MutationsUtilTest > test1111 STANDARD_OUT S([\QAGCTNRYSWKMBDHV\E])(\d+)([\QAGCTNRYSWKMBDHV\E])|D([\QAGCTNRYSWKMBDHV\E])(\d+)|I(\d+)([\QAGCTNRYSWKMBDHV\E]) S([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E])(\d+)([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E])|D([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E])(\d+)|I(\d+)([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E]) com.milaboratory.core.mutations.MutationsUtilTest > nt2AAWithMappingManual1 STANDARD_OUT [I2C::SM0I, I2G::I1A, I2C::I1A, SG2C:SM0I:I1A] com.milaboratory.core.mutations.MutationsUtilTest > nt2AAWithMappingManual2 STANDARD_OUT [S0:T->N,D13:V,S14:S->Y,S15:P->R,S16:W->P,S17:Y->G,S18:D->T,S19:P->I,S20:G->P,S21:D->A,S22:K->T,S23:A->K,S24:F->R,S25:G->S,S26:P->D,I27:S] [-1, -1, 9, 15] com.milaboratory.core.mutations.MutationsUtilTest > nt2AAWithMappingManual3 STANDARD_OUT 0 CAGGTTCAGCTGGTGCAGTCTGGAGCTGAGGTGAAGAAGCCTGGGGCCTCAGTGAAGGTCTCCTGCAAGGCTTCTGGTTACACCTTTACCAGCTACGGTATCAGCTGGGTGCGACAGGCCCCTGGACAAGGGCTTGAGTGGATGGGATGGATCAGCGCTTACAATGGTAACACAAACTATGCACAGAAGCTCCAGGGCAGAGTCACCATGACCACAGACACATCCACGAGCACAGCCTACATGGAGCTGAGGAGCCTGAGATCTGACGACACGGCCGTGTATTACTGTGCGAGAGA 295 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||| ||||| ||||||||||||||||||||||||||||| ||||||||| ||||||||| ||||||||||||||||||| || ||||| ||| || |||||||||||||| 0 CAGGTTCAGCTGGTGCAGTCTGGAGCTGAGGTGAAGAAGCCTGGGGCCTCAGTGAAGGTCTCCTGCAAGGCTTCTGGTTACACCTTTACCAGCTACGGTATCAGCTGGGTGCGACAGGCCCCTGGACAAGGGCTTGAGTGGATGGGATGGATCAGCGCTTACAATGGTAACACATTCTATGCAGAGAAGTTCCAGGGCAGAGTCACCATGACCACAGACGCATCCACGACCACAGCCTATATGGAGCTGAGGAGCCTGACATTTGACG-----GCCACATACTACTGTGCGAGAGA 290 [S58:N->F,S61:Q->E,S63:L->F,S73:T->A,S76:S->T,S86:R->T,S87:S->F,S89:D->G,D90:T,D91:A,S92:V->H,S93:Y->I,S94:Y->L,S95:C->L,S96:A->C,S97:R->E,S98:_->R] QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYGISWVRQAPGQGLEWMGWISAYNGNTFYAEKFQGRVTMTTDASTTTAYMELRSLTFDGHILLCER QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYGISWVRQAPGQGLEWMGWISAYNGNTFYAEKFQGRVTMTTDASTTTAYMELRSLTFDGHILLCER [S58:N->F,S61:Q->E,S63:L->F,S73:T->A,S76:S->T,S86:R->T,S87:S->F,S89:D->G,D90:T,D91:A,S92:V->H,S93:Y->I,S94:Y->L,S95:C->L,S96:A->C,S97:R->E,S98:_->R] [0, 0, 1, 2, 3, 4, -1, 5, 6, 7, 7, 8, 8, 8, 10, 10, 11, 12] com.milaboratory.core.mutations.MutationsUtilTest > nt2AAWithMappingManual4 STANDARD_OUT [S3:S->M,D4:D,S5:_->I] com.milaboratory.core.mutations.MutationTest > exportRegexps STANDARD_OUT S([\QAGCTNRYSWKMBDHV\E])(\d+)([\QAGCTNRYSWKMBDHV\E])|D([\QAGCTNRYSWKMBDHV\E])(\d+)|I(\d+)([\QAGCTNRYSWKMBDHV\E]) S([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E])(\d+)([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E])|D([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E])(\d+)|I(\d+)([\Q*ACDEFGHIKLMNPQRSTVWY_XBJZ\E]) com.milaboratory.core.mutations.MutationsTest > testCanonical1 STANDARD_OUT ATCTCACACCACGAATGAGGGATGCAGGCACTGATTAGGCCATCCTAACTCTTCTAGGCTTAGACACCCTTTTTGGTAAAACTTCATGTGCCTAAGAGGAAAGAGGGCCGCTAACCGATCGTTGACTATCAGTGGTCCTCTATGTGTTCTTGCGGGCTTTCATCAATTGCAGCGTGGCATAGTTATCTGCAAAGTTCCTTTCTCTGCGCAGGGTAACATAGATAACCTAGACCGCCACGGGGGACGTTGTAGGCAGCCGCCAGCAGAGCGGGAGGTAGGCTGTAACCAATCACACCCTTAGATATAGGTGTCATGGCCTATGTAGTTCCGCTGCCTATGAGACAATCGCACCATCAGCACGGGAGTGTGAAAATATTCAATTGTACGAGGAGCAGGAGTGAGGTGGCGCAGGAATAGCTCCCTATTCCAGATATACCTGCCTCCTGACGCTGCTAGTTAGCGTAACCCGCCAGCTCGCACC ATCTTACACCACAATGAGGGATGCATGCACTGATTAGGCCATCCTAACTCTTCTAGGCTTAGACACCTTTTTGGTAAAACCTGTGCCTAAGAGGAAAAGGCCGCTAACGATCGTGACTATGCAGTGGTCCTCTATGTGTTCTTGCGGGCTGTTCAATCAATTTGCAGCGTGGCATAGTTATCTGCAATGTTCCTTCTCTGCGCATAGAGTAACATGATAACTAGACCGCCGCGGGGGACTTTGTATGGCATGCCGCCAGCAGACGGGAGGTAGGCTTGTAAACCATTCACACCTTAGATATAGGTTCATGGCCTATGTAGTTCCGCTGCCTATGAGACAATCGCACCATCAGCACGGGAGTGTGAAATTAATTCAATTGTACGAGGATCAGGGGCGAGGTGGCGCAGGAAGCTCCCTATTCAGATAATACTGCCTCCTGACTCTTCTAGTTACGTAACCCGCCAGCTCGCACC ATCTTACACACAATGAGGGGTGCATGCAACTGATTAGGCCATCCTAAACTCTTCTAGGCTTCAGAACCTTTTTGGTAAACCTGTCCTAAGGGAAAAGGCCGCTAACGATCTGACTATGCAGTGTCTCTATGTGTTTTGCGGGCTGGTTCAATCAATTTGCAGCTTGGCATAGTATCTGCTATGTTCCTTCTTTGCGCATAGAGTAACATGATAGTAGACGCCGGCGGCGGACTTTGTATGGCATGCCGCCAGCGGACGGGAGTAGTCATGTAAACCATTCACACCTTGGATATAGGTTCATGCCTATTTAGTTCCTGCCTGCTATGAGACAATCGTACCATCAGCACGGGAGTGTAAATTAATTCAATTGTACGAGGATCAGTGCGAGGTGGCGCAGGAGGCTCCCTATTCAGAATACTGCCTCCTGACTCTTCTAGTTACGTAACCCGCCAGCTCGCC 0 ATCTTACA-CAC-AATGAGGGGTGCATGCAACTGATTAGGCCATCCTAAACTCTTCTAGGCTTCAGA-A-CCTTTTTGGT-AAAC--C-TGT-CCTAAG-GGAAA-A-GGCCGCTAA-CGATC--TGACTATGCAGT-GT-CTCTATGTGTT-TTGCGGGCTGGTTCAATCAATTTGCAGCTTGGCATAG-TATCTGCTATGTTCC-TTCTTTGCGCATAGAGTAACAT-GAT-A-GTAGA-CGCCGGCGGCGGACTTTGTATGGCATGCCGCCAGCGGA-CGGGA-GTAGTCATGTAAACCATTCACA-CCTTGGATATAGGT-TCAT-GCCTATTTAGTTCCTGCCTG-CTATGAGACAATCGTACCATCAGCACGGGAGTGT-AAATTAATTCAATTGTACGAGGATCA-GTGCGAGGTGGCGCAGG-A-GGCTCCCTATT-CAGA-ATA-CTGCCTCCTGACTCTTCTAGTTA-CGTAACCCGCCAGCTCG--CC 458 |||| ||| ||| |||||||| |||| || ||||||||||||||||| ||||||||||||||| ||| | |||||||||| |||| | ||| |||||| ||||| | ||||||||| ||||| ||||||| |||| || ||||||||||| ||||||||| ||| ||||| ||||||| |||||||| ||||||| | ||||| |||| ||||| || ||||||| ||| | |||| |||| ||| |||| ||||| |||| ||||||||| || ||||| |||| | ||| ||||| ||||| |||| ||||||||| |||| |||||| ||||||| | ||| |||||||||||||| ||||||||||||||||||| ||| | ||||||||||||||||| || | | ||||||||||||| | |||||||||| |||| ||| |||||||||||| || ||||||| ||||||||||||||||| || 0 ATCTCACACCACGAATGAGGGATGCAGGC-ACTGATTAGGCCATCCT-AACTCTTCTAGGCTT-AGACACCCTTTTTGGTAAAACTTCATGTGCCTAAGAGGAAAGAGGGCCGCTAACCGATCGTTGACTAT-CAGTGGTCCTCTATGTGTTCTTGCGGGCT--TTC-ATCAA-TTGCAGCGTGGCATAGTTATCTGCAAAGTTCCTTTCTCTGCGC--AGGGTAACATAGATAACCTAGACCGCC-ACGGGGGACGTTGTA-GGCA-GCCGCCAGCAGAGCGGGAGGTAGGC-TGT-AACCAATCACACCCTTAGATATAGGTGTCATGGCCTATGTAGTTCC-G-CTGCCTATGAGACAATCGCACCATCAGCACGGGAGTGTGAAAAT-ATTCAATTGTACGAGGAGCAGGAGTGAGGTGGCGCAGGAATAGCTCCCTATTCCAGATATACCTGCCTCCTGACGCTGCTAGTTAGCGTAACCCGCCAGCTCGCACC 480 [I66:C,D68:C,I82:T,D83:T,I104:G,D105:G,I114:C,D115:C,I120:G,S120:G->T,D122:T,I182:T,D183:T,I198:T,D200:T,D209:A,S210:G->A,I212:G,I223:A,I224:C,S224:A->C,D225:C,D226:C,I231:C,D232:C,D239:G,I241:G,D251:G,I253:G,D283:A,I285:A,I314:G,D315:G,D430:A,D431:T,I433:T,I433:A,I477:C,S477:C->A,D478:A] 0 ATCTCACACCACGAATGAGGGATGCAGGCACTGATTAGGCCATCCTAACTCTTCTAGGCTTAGACA-CCCTTTTTGGTAAAAC-TTCATGTGCCTAAGAGGAAAGA-GGGCCGCTAA-CCGATC-GTTGACTATCAGTGGTCCTCTATGTGTTCTTGCGGGCTTTCATCAATTGCAGCGTGGCATAG-TTATCTGCAAAGTTCC-TTTCTCTGCGCAGG-GTAACATAGAT-A-ACCTAGA-CCGCCACGGG-GGACGTTGTAGG-CAGCCGCCAGCAGAGCGGGAGGTAGGCTGTAA-CCAATCACACCCTTAGATATAGGTGTCAT-GGCCTATGTAGTTCCGCTGCCTATGAGACAATCGCACCATCAGCACGGGAGTGTGAAAATATTCAATTGTACGAGGAGCAGGAGTGAGGTGGCGCAGGAATAGCTCCCTATTCCAGATA--TACCTGCCTCCTGACGCTGCTAGTTAGCGTAACCCGCCAGCTCG-CACC 480 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| || ||||||||||||| | |||||||||||||||||||| | |||||||| | |||| | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| | |||||||||||||| || |||||||| | ||||||||||| | |||| | |||||| | |||||||||| | |||||||||||||||||||||||||||||| | ||||||||||||||||||||||||||||| | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| | |||||||||||||||||||||||||||||||||||||||||||| || 0 ATCTCACACCACGAATGAGGGATGCAGGCACTGATTAGGCCATCCTAACTCTTCTAGGCTTAGACACCC-TTTTTGGTAAAACTT-CATGTGCCTAAGAGGAAAGAGG-GCCGCTAACC-GATCGTT-GACTATCAGTGGTCCTCTATGTGTTCTTGCGGGCTTTCATCAATTGCAGCGTGGCATAGTT-ATCTGCAAAGTTCCTTT-CTCTGCGC-AGGGTAACATAGATAACC--TAGACC-GCCACG-GGGGACGTTGTA-GGCAGCCGCCAGCAGAGCGGGAGGTAGGCTGT-AACCAATCACACCCTTAGATATAGGTGTCATGG-CCTATGTAGTTCCGCTGCCTATGAGACAATCGCACCATCAGCACGGGAGTGTGAAAATATTCAATTGTACGAGGAGCAGGAGTGAGGTGGCGCAGGAATAGCTCCCTATTCCAG--ATATACCTGCCTCCTGACGCTGCTAGTTAGCGTAACCCGCCAGCTCGCA-CC 480 com.milaboratory.core.sequence.AminoAcidSequenceTest > testName STANDARD_OUT 3 com.milaboratory.core.sequence.AminoAcidSequenceTest > testConvertPositionSync1 STANDARD_OUT FromCenter 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 FromLeftWithoutIncompleteCodon 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 FromLeftWithIncompleteCodon 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 FromRightWithoutIncompleteCodon 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 FromRightWithIncompleteCodon 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 com.milaboratory.core.sequence.NucleotideAlphabetTest > testCalculateIntersections SKIPPED com.milaboratory.core.sequence.AminoAcidAlphabetTest > testCalculateMatches SKIPPED com.milaboratory.core.sequence.quality.QualityTrimmerTest > testParametersSerialization0 STANDARD_OUT { "averageQualityThreshold": 7.0, "windowSize": 6 } com.milaboratory.core.sequence.quality.QualityAggregatorTest > test1 STANDARD_OUT 37 com.milaboratory.core.sequence.quality.QualityAggregatorTest > test2 STANDARD_OUT 619 com.milaboratory.core.sequence.quality.QualityAggregatorTest > test3 STANDARD_OUT 2494 com.milaboratory.core.sequence.ShortSequenceSetTest > test1 STANDARD_OUT 99941 elements with 365.98KiB in raw nucleotide entropy serialized into 272.97KiB com.milaboratory.core.sequence.GeneticCodeTest > generateExtendedGeneticCode SKIPPED com.milaboratory.util.VersionInfoTest > test3 SKIPPED com.milaboratory.util.sorting.SortingUtilTest > test1 STANDARD_OUT Collation: 97.77ms Sorting: 84.33ms 1 217 41458 99506 99994 com.milaboratory.util.sorting.HashSorterTest > testSingleton STANDARD_OUT /tmp/milib_b3a724f6ac5e2f5ad325edd56d58a5abd92cedc85361017041842233304 timeInCollate: 8.18s timeInCollatorInit: 4.95s timeAwaitingO: 3.8ms timeAwaitingI: 1.73s timeInFinalSorting1: 0ns timeInFinalSorting2: 68.26ms timeInFinalSorting3: 70.96ms /5S (5|27|32): objs=50000 size=3.65MiB com.milaboratory.util.sorting.HashSorterTest > test1 STANDARD_OUT /tmp/milib_ff3e8efe66b48b6872436979683c5b4852b2046d9828952671894189219 timeInCollate: 34.37s timeInCollatorInit: 5.49s timeAwaitingO: 2.31s timeAwaitingI: 12.03s timeInFinalSorting1: 4.48s timeInFinalSorting2: 1.28s timeInFinalSorting3: 912.78ms /0N (5|27|32): objs=153654 size=7.38MiB /1N (5|27|32): objs=158236 size=7.7MiB /2N (5|27|32): objs=152362 size=7.36MiB /3N (5|27|32): objs=151152 size=7.39MiB /4N (5|27|32): objs=154201 size=7.34MiB /5N (5|27|32): objs=163599 size=8.12MiB /6N (5|27|32): objs=156086 size=7.51MiB /7N (5|27|32): objs=159424 size=7.64MiB /8N (5|27|32): objs=152671 size=7.2MiB /9N (5|27|32): objs=166168 size=8.09MiB /10N (5|27|32): objs=156219 size=7.64MiB /11N (5|27|32): objs=155613 size=7.62MiB /12N (5|27|32): objs=153793 size=7.32MiB /13N (5|27|32): objs=153512 size=7.28MiB /14N (5|27|32): objs=153337 size=7.4MiB /15N (5|27|32): objs=156459 size=7.82MiB /16N (5|27|32): objs=157377 size=7.8MiB /17N (5|27|32): objs=148540 size=7.1MiB /18N (5|27|32): objs=159541 size=7.5MiB /19N (5|27|32): objs=157737 size=7.5MiB /20N (5|27|32): objs=154232 size=7.36MiB /21N (5|27|32): objs=160796 size=7.96MiB /22N (5|27|32): objs=162353 size=7.97MiB /23N (5|27|32): objs=153873 size=7.38MiB /24N (5|27|32): objs=160145 size=7.31MiB /25N (5|27|32): objs=155720 size=7.44MiB /26N (5|27|32): objs=160806 size=7.81MiB /27N (5|27|32): objs=158082 size=7.59MiB /28N (5|27|32): objs=153124 size=7.23MiB /29N (5|27|32): objs=156042 size=7.38MiB /30N (5|27|32): objs=147487 size=6.99MiB /31N (5|27|32): objs=157659 size=7.44MiB /0/0N (2|25|36): objs=36523 size=669.27KiB /0/1N (2|25|36): objs=41898 size=964.73KiB /0/2N (2|25|36): objs=38634 size=764.56KiB /0/3N (2|25|36): objs=6686 size=30.54KiB /0/4S (2|25|36): objs=144 size=309B /0/5N (2|25|36): objs=1689 size=6.99KiB /0/6S (2|25|36): objs=164 size=207B /0/7N (2|25|36): objs=484 size=1.75KiB /0/8S (2|25|36): objs=158 size=186B /0/9N (2|25|36): objs=303 size=898B /0/10S (2|25|36): objs=146 size=197B /0/11N (2|25|36): objs=768 size=2.81KiB /0/12S (2|25|36): objs=164 size=267B /0/13N (2|25|36): objs=4190 size=20.41KiB /0/14S (2|25|36): objs=170 size=306B /0/15N (2|25|36): objs=5045 size=23.39KiB /0/16S (2|25|36): objs=156 size=245B /0/17N (2|25|36): objs=596 size=2.14KiB /0/18S (2|25|36): objs=141 size=131B /0/19N (2|25|36): objs=5283 size=25.59KiB /0/20S (2|25|36): objs=145 size=326B /0/21N (2|25|36): objs=2094 size=8.97KiB /0/22S (2|25|36): objs=167 size=302B /0/23N (2|25|36): objs=454 size=1.57KiB /0/24S (2|25|36): objs=172 size=312B /0/26S (2|25|36): objs=159 size=217B /0/27N (2|25|36): objs=623 size=2.33KiB /0/28S (2|25|36): objs=152 size=99B /0/29N (2|25|36): objs=604 size=2.05KiB /0/30S (2|25|36): objs=140 size=139B /0/31N (2|25|36): objs=2788 size=11.68KiB /0/32S (2|25|36): objs=159 size=326B /0/33N (2|25|36): objs=602 size=2.38KiB /0/34S (2|25|36): objs=156 size=323B /0/35N (2|25|36): objs=1897 size=8.11KiB /1/0N (2|25|36): objs=36280 size=809.81KiB /1/1N (2|25|36): objs=41242 size=852.57KiB /1/2N (2|25|36): objs=40567 size=811.75KiB /1/3N (2|25|36): objs=421 size=1.55KiB /1/4S (2|25|36): objs=154 size=120B /1/5N (2|25|36): objs=1695 size=7.13KiB /1/6S (2|25|36): objs=133 size=139B /1/7N (2|25|36): objs=1026 size=4.22KiB /1/8S (2|25|36): objs=147 size=248B /1/9N (2|25|36): objs=1220 size=4.79KiB /1/10S (2|25|36): objs=126 size=154B /1/11N (2|25|36): objs=1509 size=6.21KiB /1/12S (2|25|36): objs=149 size=225B /1/13N (2|25|36): objs=1264 size=5KiB /1/14S (2|25|36): objs=153 size=114B /1/15N (2|25|36): objs=1405 size=5.8KiB /1/16S (2|25|36): objs=176 size=288B /1/17N (2|25|36): objs=2814 size=13.44KiB /1/18S (2|25|36): objs=164 size=146B /1/19S (2|25|36): objs=179 size=146B /1/20S (2|25|36): objs=153 size=318B /1/21N (2|25|36): objs=6533 size=35.96KiB /1/22S (2|25|36): objs=167 size=203B /1/23N (2|25|36): objs=297 size=984B /1/24S (2|25|36): objs=149 size=292B /1/25N (2|25|36): objs=4916 size=24.51KiB /1/26S (2|25|36): objs=158 size=159B /1/27N (2|25|36): objs=1348 size=5.46KiB /1/28S (2|25|36): objs=154 size=154B /1/29N (2|25|36): objs=4533 size=20.38KiB /1/30S (2|25|36): objs=126 size=212B /1/31N (2|25|36): objs=7610 size=37.19KiB /1/32S (2|25|36): objs=160 size=197B /1/33N (2|25|36): objs=312 size=656B /1/34S (2|25|36): objs=170 size=314B /1/35N (2|25|36): objs=626 size=2.34KiB /2/0N (2|25|36): objs=33499 size=644.36KiB /2/1S (2|25|36): objs=151 size=278B /2/2N (2|25|36): objs=6875 size=31.47KiB /2/3N (2|25|36): objs=34138 size=606.3KiB /2/4N (2|25|36): objs=22170 size=199.13KiB /2/5S (2|25|36): objs=142 size=106B /2/6N (2|25|36): objs=15554 size=106.57KiB /2/7N (2|25|36): objs=6208 size=27.49KiB /2/8S (2|25|36): objs=126 size=296B /2/9N (2|25|36): objs=1096 size=4.39KiB /2/10S (2|25|36): objs=168 size=133B /2/11S (2|25|36): objs=154 size=251B /2/12S (2|25|36): objs=156 size=216B /2/13N (2|25|36): objs=886 size=3.64KiB /2/14S (2|25|36): objs=146 size=250B /2/15S (2|25|36): objs=136 size=298B /2/16S (2|25|36): objs=142 size=218B /2/17N (2|25|36): objs=1846 size=7.68KiB /2/18S (2|25|36): objs=147 size=318B /2/19N (2|25|36): objs=1058 size=4.36KiB /2/20S (2|25|36): objs=153 size=240B /2/21N (2|25|36): objs=1238 size=5.22KiB /2/22S (2|25|36): objs=174 size=112B /2/23N (2|25|36): objs=437 size=1.65KiB /2/24S (2|25|36): objs=154 size=207B /2/25N (2|25|36): objs=3281 size=16.12KiB /2/26S (2|25|36): objs=153 size=279B /2/27N (2|25|36): objs=2594 size=11.18KiB /2/28S (2|25|36): objs=147 size=269B /2/29N (2|25|36): objs=1051 size=4.15KiB /2/30S (2|25|36): objs=178 size=257B /2/31N (2|25|36): objs=14967 size=97.98KiB /2/32S (2|25|36): objs=160 size=269B /2/33N (2|25|36): objs=299 size=876B /2/34S (2|25|36): objs=148 size=309B /2/35N (2|25|36): objs=2430 size=11.04KiB /3/0N (2|25|36): objs=39914 size=735.58KiB /3/1N (2|25|36): objs=33778 size=560.38KiB /3/2N (2|25|36): objs=25669 size=316.75KiB /3/3S (2|25|36): objs=176 size=271B /3/4N (2|25|36): objs=12632 size=79.5KiB /3/5S (2|25|36): objs=148 size=207B /3/6N (2|25|36): objs=1766 size=7.24KiB /3/7N (2|25|36): objs=5202 size=24.84KiB /3/8S (2|25|36): objs=161 size=283B /3/9N (2|25|36): objs=2352 size=10.05KiB /3/10S (2|25|36): objs=128 size=166B /3/11N (2|25|36): objs=781 size=2.97KiB /3/12S (2|25|36): objs=168 size=110B /3/13N (2|25|36): objs=2447 size=10.18KiB /3/14S (2|25|36): objs=146 size=229B /3/15N (2|25|36): objs=723 size=2.63KiB /3/16S (2|25|36): objs=147 size=266B /3/17N (2|25|36): objs=286 size=1.04KiB /3/18S (2|25|36): objs=165 size=179B /3/19N (2|25|36): objs=4743 size=22.64KiB /3/20S (2|25|36): objs=149 size=121B /3/21N (2|25|36): objs=1018 size=3.97KiB /3/22S (2|25|36): objs=141 size=300B /3/23N (2|25|36): objs=1669 size=6.85KiB /3/24S (2|25|36): objs=171 size=151B /3/25N (2|25|36): objs=1084 size=4.32KiB /3/26S (2|25|36): objs=147 size=166B /3/27N (2|25|36): objs=3909 size=18.08KiB /3/28S (2|25|36): objs=146 size=130B /3/29N (2|25|36): objs=4457 size=21.59KiB /3/30S (2|25|36): objs=171 size=332B /3/31N (2|25|36): objs=1209 size=5.03KiB /3/32S (2|25|36): objs=143 size=276B /3/33N (2|25|36): objs=1337 size=5.58KiB /3/34S (2|25|36): objs=153 size=323B /3/35N (2|25|36): objs=3716 size=17.57KiB /4/0N (2|25|36): objs=40868 size=899.45KiB /4/1N (2|25|36): objs=37043 size=639.36KiB /4/2N (2|25|36): objs=38594 size=783.52KiB /4/3N (2|25|36): objs=9204 size=43.08KiB /4/4S (2|25|36): objs=154 size=232B /4/5N (2|25|36): objs=7179 size=39.09KiB /4/6S (2|25|36): objs=143 size=323B /4/7N (2|25|36): objs=308 size=1.05KiB /4/8S (2|25|36): objs=167 size=319B /4/9N (2|25|36): objs=3368 size=14.76KiB /4/10S (2|25|36): objs=158 size=340B /4/12S (2|25|36): objs=186 size=341B /4/13S (2|25|36): objs=167 size=229B /4/14S (2|25|36): objs=157 size=160B /4/15N (2|25|36): objs=428 size=1.37KiB /4/16S (2|25|36): objs=142 size=208B /4/17N (2|25|36): objs=3730 size=18.37KiB /4/18S (2|25|36): objs=159 size=289B /4/19N (2|25|36): objs=1813 size=7.55KiB /4/20S (2|25|36): objs=142 size=307B /4/21N (2|25|36): objs=3940 size=17.39KiB /4/22S (2|25|36): objs=136 size=95B /4/23N (2|25|36): objs=603 size=2.12KiB /4/24S (2|25|36): objs=149 size=213B /4/25N (2|25|36): objs=569 size=1.93KiB /4/26S (2|25|36): objs=136 size=279B /4/27N (2|25|36): objs=627 size=2.45KiB /4/28S (2|25|36): objs=136 size=188B /4/29N (2|25|36): objs=1217 size=4.98KiB /4/30S (2|25|36): objs=159 size=214B /4/31N (2|25|36): objs=560 size=2.22KiB /4/32S (2|25|36): objs=157 size=153B /4/33N (2|25|36): objs=772 size=2.96KiB /4/34S (2|25|36): objs=163 size=265B /4/35N (2|25|36): objs=767 size=3.02KiB /5/0N (2|25|36): objs=40849 size=950.12KiB /5/1N (2|25|36): objs=37439 size=759.87KiB /5/2N (2|25|36): objs=41766 size=931.72KiB /5/3N (2|25|36): objs=16290 size=129.95KiB /5/4S (2|25|36): objs=154 size=341B /5/5N (2|25|36): objs=341 size=1.03KiB /5/6S (2|25|36): objs=139 size=321B /5/7N (2|25|36): objs=622 size=2.27KiB /5/8S (2|25|36): objs=154 size=300B /5/9N (2|25|36): objs=11051 size=62.1KiB /5/10S (2|25|36): objs=149 size=106B /5/11N (2|25|36): objs=321 size=829B /5/12S (2|25|36): objs=173 size=236B /5/13N (2|25|36): objs=1307 size=5.26KiB /5/14S (2|25|36): objs=143 size=121B /5/15N (2|25|36): objs=1722 size=7.02KiB /5/16S (2|25|36): objs=119 size=97B /5/17N (2|25|36): objs=642 size=2.29KiB /5/18S (2|25|36): objs=160 size=155B /5/19N (2|25|36): objs=947 size=3.72KiB /5/20S (2|25|36): objs=122 size=116B /5/21N (2|25|36): objs=944 size=3.79KiB /5/22S (2|25|36): objs=142 size=129B /5/23S (2|25|36): objs=144 size=326B /5/24S (2|25|36): objs=154 size=197B /5/26S (2|25|36): objs=139 size=172B /5/27N (2|25|36): objs=3377 size=14.69KiB /5/28S (2|25|36): objs=153 size=289B /5/30S (2|25|36): objs=171 size=209B /5/31N (2|25|36): objs=896 size=3.39KiB /5/32S (2|25|36): objs=156 size=337B /5/33N (2|25|36): objs=486 size=1.61KiB /5/34S (2|25|36): objs=158 size=291B /5/35N (2|25|36): objs=2069 size=8.71KiB /6/0N (2|25|36): objs=39217 size=857.44KiB /6/1N (2|25|36): objs=38006 size=849.92KiB /6/2N (2|25|36): objs=35627 size=664.85KiB /6/3S (2|25|36): objs=147 size=308B /6/4N (2|25|36): objs=2715 size=11.23KiB /6/6S (2|25|36): objs=151 size=90B /6/7N (2|25|36): objs=3103 size=14.54KiB /6/8S (2|25|36): objs=154 size=133B /6/9N (2|25|36): objs=1531 size=6.24KiB /6/10S (2|25|36): objs=140 size=89B /6/11N (2|25|36): objs=733 size=2.88KiB /6/12S (2|25|36): objs=145 size=312B /6/13N (2|25|36): objs=7689 size=41.5KiB /6/14S (2|25|36): objs=154 size=210B /6/15N (2|25|36): objs=3370 size=14.05KiB /6/16S (2|25|36): objs=179 size=169B /6/17N (2|25|36): objs=7652 size=36.04KiB /6/18S (2|25|36): objs=170 size=279B /6/19N (2|25|36): objs=3657 size=16.19KiB /6/20S (2|25|36): objs=149 size=260B /6/21N (2|25|36): objs=1315 size=5.57KiB /6/22S (2|25|36): objs=159 size=268B /6/23N (2|25|36): objs=916 size=3.37KiB /6/24S (2|25|36): objs=143 size=133B /6/25N (2|25|36): objs=651 size=2.33KiB /6/26S (2|25|36): objs=143 size=185B /6/28S (2|25|36): objs=151 size=253B /6/29N (2|25|36): objs=1962 size=7.97KiB /6/30S (2|25|36): objs=149 size=276B /6/31N (2|25|36): objs=1946 size=8.05KiB /6/32S (2|25|36): objs=168 size=354B /6/34S (2|25|36): objs=147 size=127B /6/35N (2|25|36): objs=3547 size=14.88KiB /7/0N (2|25|36): objs=39881 size=862.78KiB /7/1N (2|25|36): objs=39703 size=746.71KiB /7/2N (2|25|36): objs=40314 size=901.42KiB /7/4S (2|25|36): objs=135 size=135B /7/5N (2|25|36): objs=2215 size=8.92KiB /7/6S (2|25|36): objs=180 size=115B /7/8S (2|25|36): objs=177 size=96B /7/9N (2|25|36): objs=3051 size=12.98KiB /7/10S (2|25|36): objs=144 size=203B /7/11N (2|25|36): objs=2707 size=11.19KiB /7/12S (2|25|36): objs=163 size=216B /7/13N (2|25|36): objs=6285 size=32.52KiB /7/14S (2|25|36): objs=139 size=282B /7/15N (2|25|36): objs=303 size=762B /7/16S (2|25|36): objs=165 size=90B /7/17N (2|25|36): objs=4458 size=20.54KiB /7/18S (2|25|36): objs=149 size=332B /7/19N (2|25|36): objs=3725 size=16.9KiB /7/20S (2|25|36): objs=170 size=99B /7/21N (2|25|36): objs=277 size=976B /7/22S (2|25|36): objs=164 size=257B /7/23N (2|25|36): objs=2348 size=9.86KiB /7/24S (2|25|36): objs=129 size=263B /7/25N (2|25|36): objs=3289 size=15.01KiB /7/26S (2|25|36): objs=135 size=251B /7/28S (2|25|36): objs=153 size=275B /7/29N (2|25|36): objs=1651 size=6.85KiB /7/30S (2|25|36): objs=166 size=334B /7/31N (2|25|36): objs=613 size=2.36KiB /7/32S (2|25|36): objs=186 size=287B /7/33N (2|25|36): objs=2910 size=12.24KiB /7/34S (2|25|36): objs=137 size=292B /7/35N (2|25|36): objs=3202 size=14KiB /8/0N (2|25|36): objs=37092 size=732.99KiB /8/1N (2|25|36): objs=35433 size=829.45KiB /8/2N (2|25|36): objs=38679 size=808.2KiB /8/3S (2|25|36): objs=167 size=128B /8/4N (2|25|36): objs=305 size=902B /8/5S (2|25|36): objs=146 size=214B /8/6S (2|25|36): objs=172 size=291B /8/7S (2|25|36): objs=174 size=204B /8/8N (2|25|36): objs=3159 size=15.2KiB /8/9S (2|25|36): objs=146 size=297B /8/11N (2|25|36): objs=932 size=3.62KiB /8/12S (2|25|36): objs=164 size=261B /8/13N (2|25|36): objs=308 size=797B /8/14S (2|25|36): objs=135 size=313B /8/15N (2|25|36): objs=2204 size=9.14KiB /8/16S (2|25|36): objs=138 size=193B /8/17N (2|25|36): objs=3620 size=15.41KiB /8/18S (2|25|36): objs=146 size=150B /8/19N (2|25|36): objs=467 size=1.7KiB /8/20S (2|25|36): objs=151 size=182B /8/21N (2|25|36): objs=9953 size=55.55KiB /8/22S (2|25|36): objs=159 size=247B /8/23N (2|25|36): objs=1607 size=6.63KiB /8/24S (2|25|36): objs=142 size=214B /8/25N (2|25|36): objs=1239 size=4.8KiB /8/26S (2|25|36): objs=145 size=276B /8/27N (2|25|36): objs=3079 size=12.68KiB /8/28S (2|25|36): objs=157 size=128B /8/29N (2|25|36): objs=4330 size=19KiB /8/30S (2|25|36): objs=165 size=154B /8/31N (2|25|36): objs=3067 size=13.06KiB /8/32S (2|25|36): objs=169 size=233B /8/33N (2|25|36): objs=446 size=1.5KiB /8/34S (2|25|36): objs=162 size=95B /8/35N (2|25|36): objs=4113 size=18.9KiB /9/0N (2|25|36): objs=40845 size=899.53KiB /9/1N (2|25|36): objs=41230 size=887.33KiB /9/2N (2|25|36): objs=4742 size=20.39KiB /9/3S (2|25|36): objs=156 size=139B /9/4N (2|25|36): objs=38956 size=866.84KiB /9/5N (2|25|36): objs=12848 size=73.75KiB /9/6S (2|25|36): objs=167 size=127B /9/7N (2|25|36): objs=1159 size=4.79KiB /9/8S (2|25|36): objs=145 size=333B /9/9S (2|25|36): objs=128 size=128B /9/10S (2|25|36): objs=160 size=134B /9/11N (2|25|36): objs=3402 size=15.8KiB /9/12S (2|25|36): objs=150 size=233B /9/13S (2|25|36): objs=152 size=288B /9/14S (2|25|36): objs=152 size=177B /9/15N (2|25|36): objs=5696 size=28.34KiB /9/16S (2|25|36): objs=144 size=274B /9/17N (2|25|36): objs=2734 size=12.06KiB /9/18S (2|25|36): objs=155 size=155B /9/19N (2|25|36): objs=2176 size=8.98KiB /9/20S (2|25|36): objs=132 size=208B /9/21N (2|25|36): objs=1792 size=7.7KiB /9/22S (2|25|36): objs=146 size=89B /9/23N (2|25|36): objs=2233 size=9.24KiB /9/24S (2|25|36): objs=131 size=214B /9/25N (2|25|36): objs=1362 size=5.47KiB /9/26S (2|25|36): objs=156 size=251B /9/27N (2|25|36): objs=615 size=2.14KiB /9/28S (2|25|36): objs=160 size=301B /9/29N (2|25|36): objs=1207 size=4.88KiB /9/30S (2|25|36): objs=166 size=239B /9/31N (2|25|36): objs=1426 size=5.59KiB /9/32S (2|25|36): objs=132 size=281B /9/33N (2|25|36): objs=765 size=2.9KiB /9/34S (2|25|36): objs=159 size=210B /9/35N (2|25|36): objs=289 size=789B /10/0N (2|25|36): objs=36807 size=794.53KiB /10/1N (2|25|36): objs=43175 size=965.79KiB /10/2N (2|25|36): objs=31039 size=524.94KiB /10/3S (2|25|36): objs=134 size=304B /10/4N (2|25|36): objs=1571 size=6.34KiB /10/5S (2|25|36): objs=138 size=212B /10/6N (2|25|36): objs=566 size=2.04KiB /10/7S (2|25|36): objs=152 size=186B /10/8N (2|25|36): objs=906 size=3.36KiB /10/9S (2|25|36): objs=151 size=189B /10/10N (2|25|36): objs=4993 size=22.56KiB /10/11N (2|25|36): objs=1599 size=6.58KiB /10/12S (2|25|36): objs=167 size=282B /10/13N (2|25|36): objs=3061 size=13.72KiB /10/14S (2|25|36): objs=137 size=329B /10/15N (2|25|36): objs=740 size=2.73KiB /10/16S (2|25|36): objs=159 size=300B /10/18S (2|25|36): objs=132 size=89B /10/19N (2|25|36): objs=1063 size=4.14KiB /10/20S (2|25|36): objs=161 size=275B /10/21N (2|25|36): objs=1243 size=5.19KiB /10/22S (2|25|36): objs=145 size=88B /10/23N (2|25|36): objs=7205 size=36.66KiB /10/24S (2|25|36): objs=153 size=116B /10/25N (2|25|36): objs=1957 size=8.28KiB /10/26S (2|25|36): objs=146 size=200B /10/27N (2|25|36): objs=4245 size=21.76KiB /10/28S (2|25|36): objs=149 size=104B /10/29N (2|25|36): objs=2019 size=8.62KiB /10/30S (2|25|36): objs=163 size=228B /10/31N (2|25|36): objs=5779 size=26.55KiB /10/32S (2|25|36): objs=139 size=111B /10/33N (2|25|36): objs=1407 size=5.65KiB /10/34S (2|25|36): objs=164 size=166B /10/35N (2|25|36): objs=4454 size=22.13KiB /11/0N (2|25|36): objs=39712 size=873.72KiB /11/1N (2|25|36): objs=34499 size=627.06KiB /11/2N (2|25|36): objs=26146 size=252.77KiB /11/3S (2|25|36): objs=153 size=157B /11/4N (2|25|36): objs=13889 size=91.16KiB /11/5N (2|25|36): objs=5159 size=27.07KiB /11/6S (2|25|36): objs=143 size=154B /11/7N (2|25|36): objs=1839 size=7.61KiB /11/8S (2|25|36): objs=148 size=144B /11/9N (2|25|36): objs=3248 size=14.36KiB /11/10S (2|25|36): objs=138 size=323B /11/11N (2|25|36): objs=4435 size=20.54KiB /11/12S (2|25|36): objs=158 size=158B /11/13N (2|25|36): objs=4818 size=22.31KiB /11/14S (2|25|36): objs=156 size=284B /11/15N (2|25|36): objs=438 size=1.63KiB /11/16S (2|25|36): objs=139 size=137B /11/17N (2|25|36): objs=3092 size=14.08KiB /11/18S (2|25|36): objs=164 size=113B /11/19N (2|25|36): objs=608 size=2.25KiB /11/20S (2|25|36): objs=147 size=143B /11/21N (2|25|36): objs=1491 size=5.94KiB /11/22S (2|25|36): objs=138 size=291B /11/23N (2|25|36): objs=2978 size=12.49KiB /11/24S (2|25|36): objs=148 size=203B /11/25N (2|25|36): objs=1049 size=4.25KiB /11/26S (2|25|36): objs=146 size=329B /11/27N (2|25|36): objs=4002 size=18.09KiB /11/28S (2|25|36): objs=159 size=294B /11/29N (2|25|36): objs=3060 size=12.98KiB /11/30S (2|25|36): objs=141 size=182B /11/31N (2|25|36): objs=2281 size=9.84KiB /11/32S (2|25|36): objs=170 size=122B /11/33S (2|25|36): objs=157 size=323B /11/34S (2|25|36): objs=163 size=279B /11/35N (2|25|36): objs=301 size=774B /12/0N (2|25|36): objs=39874 size=761.24KiB /12/1N (2|25|36): objs=36920 size=745.11KiB /12/2N (2|25|36): objs=40700 size=902.82KiB /12/3S (2|25|36): objs=193 size=233B /12/4N (2|25|36): objs=927 size=3.62KiB /12/6S (2|25|36): objs=145 size=224B /12/7N (2|25|36): objs=2718 size=11.36KiB /12/8S (2|25|36): objs=159 size=286B /12/9N (2|25|36): objs=1387 size=5.38KiB /12/10S (2|25|36): objs=134 size=296B /12/11N (2|25|36): objs=1473 size=6.21KiB /12/12S (2|25|36): objs=149 size=283B /12/13N (2|25|36): objs=5384 size=24.62KiB /12/14S (2|25|36): objs=140 size=114B /12/15N (2|25|36): objs=468 size=1.42KiB /12/16S (2|25|36): objs=159 size=239B /12/17N (2|25|36): objs=2424 size=10.09KiB /12/18S (2|25|36): objs=159 size=110B /12/19N (2|25|36): objs=3072 size=12.85KiB /12/20S (2|25|36): objs=132 size=102B /12/21N (2|25|36): objs=1901 size=8.32KiB /12/22S (2|25|36): objs=164 size=344B /12/23N (2|25|36): objs=318 size=837B /12/24S (2|25|36): objs=171 size=359B /12/25N (2|25|36): objs=478 size=1.71KiB /12/26S (2|25|36): objs=141 size=206B /12/27S (2|25|36): objs=162 size=148B /12/28S (2|25|36): objs=135 size=193B /12/29N (2|25|36): objs=804 size=2.97KiB /12/30S (2|25|36): objs=155 size=319B /12/31N (2|25|36): objs=646 size=2.28KiB /12/32S (2|25|36): objs=142 size=312B /12/33N (2|25|36): objs=8601 size=41.18KiB /12/34S (2|25|36): objs=172 size=357B /12/35N (2|25|36): objs=3086 size=13.66KiB /13/0N (2|25|36): objs=36149 size=705.9KiB /13/1N (2|25|36): objs=40943 size=825.2KiB /13/2N (2|25|36): objs=40951 size=911.59KiB /13/3S (2|25|36): objs=142 size=109B /13/4S (2|25|36): objs=163 size=309B /13/5N (2|25|36): objs=452 size=1.46KiB /13/6S (2|25|36): objs=142 size=149B /13/8S (2|25|36): objs=162 size=180B /13/9N (2|25|36): objs=4346 size=20.53KiB /13/10S (2|25|36): objs=171 size=93B /13/11N (2|25|36): objs=1966 size=8.58KiB /13/12S (2|25|36): objs=156 size=227B /13/13N (2|25|36): objs=4881 size=21.54KiB /13/14S (2|25|36): objs=137 size=194B /13/15N (2|25|36): objs=5447 size=25.89KiB /13/16S (2|25|36): objs=167 size=272B /13/17N (2|25|36): objs=601 size=2.19KiB /13/18S (2|25|36): objs=149 size=130B /13/20S (2|25|36): objs=137 size=257B /13/22S (2|25|36): objs=164 size=112B /13/23N (2|25|36): objs=2783 size=11.84KiB /13/24S (2|25|36): objs=150 size=292B /13/25N (2|25|36): objs=1667 size=6.85KiB /13/26S (2|25|36): objs=162 size=113B /13/27N (2|25|36): objs=2090 size=8.72KiB /13/28S (2|25|36): objs=149 size=157B /13/29N (2|25|36): objs=4532 size=20.48KiB /13/30S (2|25|36): objs=159 size=218B /13/31N (2|25|36): objs=937 size=3.74KiB /13/32S (2|25|36): objs=170 size=268B /13/33N (2|25|36): objs=2982 size=12.22KiB /13/34S (2|25|36): objs=148 size=140B /13/35S (2|25|36): objs=157 size=86B /14/0N (2|25|36): objs=38810 size=822.46KiB /14/1N (2|25|36): objs=38298 size=806.54KiB /14/2N (2|25|36): objs=38928 size=831.4KiB /14/3N (2|25|36): objs=6610 size=31.35KiB /14/4S (2|25|36): objs=158 size=174B /14/5N (2|25|36): objs=770 size=2.87KiB /14/6S (2|25|36): objs=162 size=196B /14/7N (2|25|36): objs=322 size=1.08KiB /14/8S (2|25|36): objs=161 size=110B /14/9N (2|25|36): objs=2415 size=10.84KiB /14/10S (2|25|36): objs=159 size=298B /14/11N (2|25|36): objs=4750 size=21.71KiB /14/12S (2|25|36): objs=146 size=108B /14/13N (2|25|36): objs=611 size=2.01KiB /14/14S (2|25|36): objs=163 size=244B /14/15N (2|25|36): objs=3083 size=13.35KiB /14/16S (2|25|36): objs=139 size=272B /14/17N (2|25|36): objs=1391 size=5.47KiB /14/18S (2|25|36): objs=147 size=215B /14/19N (2|25|36): objs=6631 size=31.86KiB /14/20S (2|25|36): objs=153 size=131B /14/21N (2|25|36): objs=1543 size=6.23KiB /14/22S (2|25|36): objs=145 size=99B /14/23N (2|25|36): objs=896 size=3.44KiB /14/24S (2|25|36): objs=147 size=139B /14/25N (2|25|36): objs=756 size=2.89KiB /14/26S (2|25|36): objs=137 size=270B /14/27N (2|25|36): objs=777 size=2.98KiB /14/28S (2|25|36): objs=134 size=257B /14/29S (2|25|36): objs=160 size=286B /14/30S (2|25|36): objs=136 size=211B /14/31N (2|25|36): objs=1559 size=6.41KiB /14/32S (2|25|36): objs=147 size=174B /14/33N (2|25|36): objs=599 size=2.41KiB /14/34S (2|25|36): objs=147 size=299B /14/35N (2|25|36): objs=2047 size=8.62KiB /15/0N (2|25|36): objs=40150 size=958.58KiB /15/1N (2|25|36): objs=34803 size=614.27KiB /15/2N (2|25|36): objs=28277 size=389.5KiB /15/3S (2|25|36): objs=164 size=240B /15/4N (2|25|36): objs=10006 size=57.66KiB /15/5S (2|25|36): objs=160 size=249B /15/6N (2|25|36): objs=1655 size=6.92KiB /15/7S (2|25|36): objs=156 size=116B /15/8N (2|25|36): objs=715 size=2.77KiB /15/9N (2|25|36): objs=3061 size=12.8KiB /15/10S (2|25|36): objs=155 size=148B /15/11N (2|25|36): objs=613 size=2.2KiB /15/12S (2|25|36): objs=141 size=139B /15/13N (2|25|36): objs=641 size=2.31KiB /15/14S (2|25|36): objs=145 size=101B /15/15N (2|25|36): objs=7292 size=35.11KiB /15/16S (2|25|36): objs=141 size=210B /15/17N (2|25|36): objs=2367 size=9.63KiB /15/18S (2|25|36): objs=152 size=325B /15/19N (2|25|36): objs=880 size=3.46KiB /15/20S (2|25|36): objs=148 size=306B /15/21N (2|25|36): objs=3227 size=13.64KiB /15/22S (2|25|36): objs=160 size=171B /15/23N (2|25|36): objs=950 size=3.76KiB /15/24S (2|25|36): objs=142 size=301B /15/25N (2|25|36): objs=5529 size=27.44KiB /15/26S (2|25|36): objs=125 size=164B /15/27N (2|25|36): objs=2188 size=10.11KiB /15/28S (2|25|36): objs=152 size=274B /15/29N (2|25|36): objs=3547 size=16.34KiB /15/30S (2|25|36): objs=136 size=191B /15/31N (2|25|36): objs=451 size=1.73KiB /15/32S (2|25|36): objs=159 size=307B /15/33N (2|25|36): objs=4783 size=23.51KiB /15/34S (2|25|36): objs=167 size=286B /15/35N (2|25|36): objs=2921 size=13.26KiB /16/0N (2|25|36): objs=36624 size=783.75KiB /16/1N (2|25|36): objs=42085 size=1.01MiB /16/2N (2|25|36): objs=36263 size=686.32KiB /16/3S (2|25|36): objs=150 size=152B /16/4N (2|25|36): objs=1697 size=6.98KiB /16/5N (2|25|36): objs=5135 size=24.33KiB /16/6S (2|25|36): objs=129 size=116B /16/7N (2|25|36): objs=2911 size=13.51KiB /16/8S (2|25|36): objs=150 size=222B /16/9N (2|25|36): objs=4183 size=20.1KiB /16/10S (2|25|36): objs=147 size=314B /16/11N (2|25|36): objs=4912 size=22.96KiB /16/12S (2|25|36): objs=150 size=187B /16/13N (2|25|36): objs=2291 size=9.52KiB /16/14S (2|25|36): objs=154 size=110B /16/15N (2|25|36): objs=1815 size=7.58KiB /16/16S (2|25|36): objs=167 size=114B /16/17N (2|25|36): objs=315 size=1.05KiB /16/18S (2|25|36): objs=163 size=248B /16/19N (2|25|36): objs=876 size=3.25KiB /16/20S (2|25|36): objs=162 size=144B /16/21N (2|25|36): objs=1235 size=4.88KiB /16/22S (2|25|36): objs=140 size=155B /16/23N (2|25|36): objs=2480 size=10.13KiB /16/24S (2|25|36): objs=158 size=121B /16/25N (2|25|36): objs=4962 size=24.39KiB /16/26S (2|25|36): objs=162 size=172B /16/27N (2|25|36): objs=1086 size=4.26KiB /16/28S (2|25|36): objs=155 size=179B /16/30S (2|25|36): objs=150 size=144B /16/31N (2|25|36): objs=771 size=2.72KiB /16/32S (2|25|36): objs=147 size=208B /16/33S (2|25|36): objs=157 size=292B /16/34S (2|25|36): objs=168 size=300B /16/35N (2|25|36): objs=5127 size=24.47KiB /17/0N (2|25|36): objs=17321 size=144.53KiB /17/1S (2|25|36): objs=133 size=250B /17/2N (2|25|36): objs=20722 size=189.41KiB /17/3N (2|25|36): objs=38116 size=710.84KiB /17/4N (2|25|36): objs=22888 size=219.04KiB /17/5S (2|25|36): objs=145 size=287B /17/6N (2|25|36): objs=1543 size=6.24KiB /17/7S (2|25|36): objs=120 size=92B /17/8N (2|25|36): objs=3340 size=14.35KiB /17/9S (2|25|36): objs=163 size=229B /17/10N (2|25|36): objs=1847 size=7.89KiB /17/11S (2|25|36): objs=170 size=230B /17/12N (2|25|36): objs=4837 size=20.77KiB /17/13S (2|25|36): objs=151 size=321B /17/14N (2|25|36): objs=288 size=977B /17/15S (2|25|36): objs=154 size=127B /17/16S (2|25|36): objs=154 size=207B /17/17N (2|25|36): objs=9222 size=49.8KiB /17/18S (2|25|36): objs=151 size=196B /17/19N (2|25|36): objs=2436 size=10.29KiB /17/20S (2|25|36): objs=152 size=183B /17/21N (2|25|36): objs=903 size=3.56KiB /17/22S (2|25|36): objs=159 size=198B /17/23N (2|25|36): objs=4671 size=21.53KiB /17/24S (2|25|36): objs=143 size=286B /17/25N (2|25|36): objs=2121 size=8.99KiB /17/26S (2|25|36): objs=138 size=171B /17/27N (2|25|36): objs=2272 size=9.58KiB /17/28S (2|25|36): objs=163 size=330B /17/29N (2|25|36): objs=7542 size=40.53KiB /17/30S (2|25|36): objs=135 size=232B /17/31N (2|25|36): objs=4237 size=19.71KiB /17/32S (2|25|36): objs=150 size=244B /17/34S (2|25|36): objs=158 size=314B /17/35N (2|25|36): objs=1695 size=7.06KiB /18/0N (2|25|36): objs=38439 size=640.71KiB /18/1N (2|25|36): objs=38184 size=630.28KiB /18/2N (2|25|36): objs=43033 size=918.58KiB /18/3N (2|25|36): objs=5166 size=23.64KiB /18/4S (2|25|36): objs=144 size=166B /18/5N (2|25|36): objs=2859 size=12.08KiB /18/6S (2|25|36): objs=145 size=146B /18/7N (2|25|36): objs=7987 size=38.74KiB /18/8S (2|25|36): objs=165 size=133B /18/9N (2|25|36): objs=3093 size=13.29KiB /18/10S (2|25|36): objs=176 size=131B /18/11N (2|25|36): objs=466 size=1.58KiB /18/12S (2|25|36): objs=170 size=343B /18/14S (2|25|36): objs=149 size=116B /18/15N (2|25|36): objs=1091 size=4.33KiB /18/16S (2|25|36): objs=160 size=294B /18/17N (2|25|36): objs=1647 size=6.68KiB /18/18S (2|25|36): objs=160 size=255B /18/19N (2|25|36): objs=3029 size=12.69KiB /18/20S (2|25|36): objs=155 size=112B /18/21N (2|25|36): objs=6310 size=30.62KiB /18/22S (2|25|36): objs=169 size=247B /18/24S (2|25|36): objs=162 size=162B /18/25S (2|25|36): objs=147 size=233B /18/26S (2|25|36): objs=152 size=312B /18/27S (2|25|36): objs=180 size=125B /18/28S (2|25|36): objs=156 size=279B /18/29N (2|25|36): objs=1644 size=6.73KiB /18/30S (2|25|36): objs=146 size=116B /18/32S (2|25|36): objs=164 size=251B /18/33S (2|25|36): objs=156 size=239B /18/34S (2|25|36): objs=158 size=315B /18/35N (2|25|36): objs=3579 size=15.6KiB /19/0N (2|25|36): objs=42771 size=958.04KiB /19/1N (2|25|36): objs=43082 size=944.44KiB /19/2N (2|25|36): objs=24796 size=269.33KiB /19/3S (2|25|36): objs=146 size=328B /19/4N (2|25|36): objs=6082 size=28.97KiB /19/5S (2|25|36): objs=146 size=229B /19/6N (2|25|36): objs=2218 size=8.9KiB /19/7S (2|25|36): objs=160 size=187B /19/8S (2|25|36): objs=193 size=236B /19/9N (2|25|36): objs=408 size=1.35KiB /19/10S (2|25|36): objs=163 size=202B /19/11N (2|25|36): objs=1358 size=5.54KiB /19/12S (2|25|36): objs=176 size=356B /19/13N (2|25|36): objs=4105 size=18.46KiB /19/14S (2|25|36): objs=164 size=143B /19/15N (2|25|36): objs=595 size=2.43KiB /19/16S (2|25|36): objs=155 size=285B /19/17N (2|25|36): objs=5918 size=28.61KiB /19/18S (2|25|36): objs=144 size=151B /19/19N (2|25|36): objs=1217 size=4.87KiB /19/20S (2|25|36): objs=151 size=338B /19/21N (2|25|36): objs=709 size=2.63KiB /19/22S (2|25|36): objs=144 size=277B /19/23N (2|25|36): objs=751 size=3.01KiB /19/24S (2|25|36): objs=149 size=198B /19/25N (2|25|36): objs=323 size=845B /19/26S (2|25|36): objs=172 size=335B /19/27N (2|25|36): objs=9886 size=53.03KiB /19/28S (2|25|36): objs=139 size=127B /19/29N (2|25|36): objs=2568 size=10.57KiB /19/30S (2|25|36): objs=138 size=249B /19/31N (2|25|36): objs=1081 size=4.25KiB /19/32S (2|25|36): objs=145 size=133B /19/33N (2|25|36): objs=896 size=3.58KiB /19/34S (2|25|36): objs=147 size=196B /19/35N (2|25|36): objs=6341 size=31.08KiB /20/0N (2|25|36): objs=37123 size=672.27KiB /20/1N (2|25|36): objs=37644 size=737.31KiB /20/2N (2|25|36): objs=28532 size=385.03KiB /20/3S (2|25|36): objs=133 size=88B /20/4N (2|25|36): objs=303 size=968B /20/5S (2|25|36): objs=141 size=171B /20/6N (2|25|36): objs=8767 size=44.13KiB /20/7N (2|25|36): objs=16601 size=118.85KiB /20/8S (2|25|36): objs=163 size=173B /20/9N (2|25|36): objs=648 size=2.48KiB /20/10S (2|25|36): objs=172 size=301B /20/12S (2|25|36): objs=163 size=305B /20/13N (2|25|36): objs=1248 size=4.71KiB /20/14S (2|25|36): objs=175 size=119B /20/15N (2|25|36): objs=1525 size=6.18KiB /20/16S (2|25|36): objs=157 size=177B /20/17N (2|25|36): objs=3651 size=15.72KiB /20/18S (2|25|36): objs=154 size=125B /20/19N (2|25|36): objs=471 size=1.66KiB /20/20S (2|25|36): objs=162 size=345B /20/21N (2|25|36): objs=4474 size=21.29KiB /20/22S (2|25|36): objs=157 size=314B /20/24S (2|25|36): objs=152 size=133B /20/25N (2|25|36): objs=1880 size=7.89KiB /20/26S (2|25|36): objs=142 size=251B /20/27N (2|25|36): objs=606 size=2.13KiB /20/28S (2|25|36): objs=161 size=256B /20/29N (2|25|36): objs=439 size=1.7KiB /20/30S (2|25|36): objs=149 size=138B /20/31N (2|25|36): objs=1445 size=6.2KiB /20/32S (2|25|36): objs=136 size=99B /20/33N (2|25|36): objs=3318 size=14.16KiB /20/34S (2|25|36): objs=163 size=91B /20/35N (2|25|36): objs=3077 size=13.41KiB /21/0N (2|25|36): objs=40634 size=868.99KiB /21/1N (2|25|36): objs=37085 size=773.78KiB /21/2N (2|25|36): objs=39537 size=830.08KiB /21/3N (2|25|36): objs=11151 size=63.66KiB /21/4S (2|25|36): objs=151 size=241B /21/5N (2|25|36): objs=788 size=3.17KiB /21/6S (2|25|36): objs=154 size=302B /21/7N (2|25|36): objs=2458 size=10.2KiB /21/8S (2|25|36): objs=155 size=279B /21/9N (2|25|36): objs=2953 size=12.46KiB /21/10S (2|25|36): objs=150 size=295B /21/12S (2|25|36): objs=177 size=177B /21/13N (2|25|36): objs=776 size=3.14KiB /21/14S (2|25|36): objs=148 size=280B /21/15S (2|25|36): objs=143 size=170B /21/16S (2|25|36): objs=154 size=192B /21/17N (2|25|36): objs=604 size=2.32KiB /21/18S (2|25|36): objs=138 size=198B /21/19N (2|25|36): objs=5104 size=25.09KiB /21/20S (2|25|36): objs=152 size=103B /21/21N (2|25|36): objs=2565 size=11.21KiB /21/22S (2|25|36): objs=145 size=156B /21/23N (2|25|36): objs=1754 size=7.17KiB /21/24S (2|25|36): objs=139 size=193B /21/25N (2|25|36): objs=628 size=2.35KiB /21/26S (2|25|36): objs=150 size=341B /21/27S (2|25|36): objs=140 size=168B /21/28S (2|25|36): objs=153 size=147B /21/29N (2|25|36): objs=931 size=3.47KiB /21/30S (2|25|36): objs=142 size=193B /21/31N (2|25|36): objs=2610 size=10.91KiB /21/32S (2|25|36): objs=150 size=89B /21/33N (2|25|36): objs=905 size=3.91KiB /21/34S (2|25|36): objs=146 size=178B /21/35N (2|25|36): objs=7626 size=42.56KiB /22/0N (2|25|36): objs=41670 size=1MiB /22/1N (2|25|36): objs=39330 size=766.93KiB /22/2N (2|25|36): objs=34353 size=624.73KiB /22/3S (2|25|36): objs=145 size=203B /22/4N (2|25|36): objs=6395 size=31.8KiB /22/5N (2|25|36): objs=21174 size=186.56KiB /22/6S (2|25|36): objs=148 size=126B /22/7N (2|25|36): objs=1810 size=7.3KiB /22/8S (2|25|36): objs=162 size=250B /22/9N (2|25|36): objs=2463 size=11.32KiB /22/10S (2|25|36): objs=158 size=279B /22/11N (2|25|36): objs=1411 size=5.77KiB /22/12S (2|25|36): objs=170 size=330B /22/13N (2|25|36): objs=1961 size=7.92KiB /22/14S (2|25|36): objs=152 size=335B /22/15N (2|25|36): objs=1373 size=5.53KiB /22/16S (2|25|36): objs=178 size=287B /22/17N (2|25|36): objs=581 size=2.17KiB /22/18S (2|25|36): objs=155 size=140B /22/19N (2|25|36): objs=285 size=758B /22/20S (2|25|36): objs=144 size=227B /22/22S (2|25|36): objs=145 size=265B /22/23N (2|25|36): objs=924 size=3.51KiB /22/24S (2|25|36): objs=144 size=299B /22/25N (2|25|36): objs=3604 size=17.23KiB /22/26S (2|25|36): objs=152 size=247B /22/28S (2|25|36): objs=161 size=266B /22/29N (2|25|36): objs=912 size=3.43KiB /22/30S (2|25|36): objs=167 size=170B /22/31N (2|25|36): objs=306 size=1.06KiB /22/32S (2|25|36): objs=161 size=118B /22/33N (2|25|36): objs=713 size=2.83KiB /22/34S (2|25|36): objs=157 size=238B /22/35N (2|25|36): objs=589 size=2.22KiB /23/0N (2|25|36): objs=40815 size=989.62KiB /23/1N (2|25|36): objs=35714 size=670.98KiB /23/2N (2|25|36): objs=37624 size=670.53KiB /23/3N (2|25|36): objs=1030 size=4.18KiB /23/4S (2|25|36): objs=148 size=196B /23/5N (2|25|36): objs=1515 size=6.27KiB /23/6S (2|25|36): objs=153 size=268B /23/7N (2|25|36): objs=1982 size=8.01KiB /23/8S (2|25|36): objs=149 size=236B /23/9N (2|25|36): objs=625 size=2.24KiB /23/10S (2|25|36): objs=167 size=98B /23/11N (2|25|36): objs=2268 size=9.3KiB /23/12S (2|25|36): objs=140 size=131B /23/13N (2|25|36): objs=2931 size=13.07KiB /23/14S (2|25|36): objs=154 size=244B /23/15N (2|25|36): objs=2659 size=11.45KiB /23/16S (2|25|36): objs=148 size=303B /23/17N (2|25|36): objs=897 size=3.72KiB /23/18S (2|25|36): objs=148 size=222B /23/19N (2|25|36): objs=1201 size=4.91KiB /23/20S (2|25|36): objs=156 size=294B /23/22S (2|25|36): objs=155 size=266B /23/23N (2|25|36): objs=432 size=1.48KiB /23/24S (2|25|36): objs=165 size=204B /23/25N (2|25|36): objs=2453 size=11.07KiB /23/26S (2|25|36): objs=158 size=229B /23/27N (2|25|36): objs=2913 size=12.25KiB /23/28S (2|25|36): objs=145 size=240B /23/29N (2|25|36): objs=3848 size=18.21KiB /23/30S (2|25|36): objs=146 size=295B /23/32S (2|25|36): objs=159 size=121B /23/33N (2|25|36): objs=9598 size=48.79KiB /23/34S (2|25|36): objs=144 size=85B /23/35N (2|25|36): objs=2933 size=12.66KiB /24/0N (2|25|36): objs=28866 size=339.44KiB /24/1S (2|25|36): objs=168 size=117B /24/2N (2|25|36): objs=12371 size=68.25KiB /24/3N (2|25|36): objs=42098 size=863.24KiB /24/4N (2|25|36): objs=38320 size=785.59KiB /24/5N (2|25|36): objs=2568 size=10.73KiB /24/6S (2|25|36): objs=156 size=190B /24/7N (2|25|36): objs=1219 size=4.69KiB /24/8S (2|25|36): objs=166 size=334B /24/9N (2|25|36): objs=2693 size=11.36KiB /24/10S (2|25|36): objs=177 size=360B /24/11N (2|25|36): objs=1182 size=4.75KiB /24/12S (2|25|36): objs=152 size=104B /24/13S (2|25|36): objs=142 size=196B /24/14S (2|25|36): objs=140 size=316B /24/15N (2|25|36): objs=328 size=1.04KiB /24/16S (2|25|36): objs=129 size=211B /24/17S (2|25|36): objs=154 size=100B /24/18S (2|25|36): objs=157 size=190B /24/19N (2|25|36): objs=1209 size=5.03KiB /24/20S (2|25|36): objs=162 size=161B /24/21N (2|25|36): objs=1139 size=4.73KiB /24/22S (2|25|36): objs=176 size=121B /24/23N (2|25|36): objs=1148 size=4.7KiB /24/24S (2|25|36): objs=174 size=231B /24/26S (2|25|36): objs=153 size=93B /24/27N (2|25|36): objs=4982 size=23.82KiB /24/28S (2|25|36): objs=157 size=320B /24/29N (2|25|36): objs=9211 size=43.3KiB /24/30S (2|25|36): objs=159 size=342B /24/31N (2|25|36): objs=4296 size=18.94KiB /24/32S (2|25|36): objs=145 size=295B /24/33N (2|25|36): objs=2270 size=9.3KiB /24/34S (2|25|36): objs=154 size=318B /24/35N (2|25|36): objs=3424 size=14.24KiB /25/0N (2|25|36): objs=39376 size=746.86KiB /25/1N (2|25|36): objs=38990 size=861.21KiB /25/2N (2|25|36): objs=37962 size=769.13KiB /25/3S (2|25|36): objs=169 size=217B /25/4N (2|25|36): objs=489 size=1.78KiB /25/5N (2|25|36): objs=1069 size=4.25KiB /25/6S (2|25|36): objs=144 size=307B /25/7N (2|25|36): objs=452 size=1.51KiB /25/8S (2|25|36): objs=155 size=259B /25/9N (2|25|36): objs=403 size=1.35KiB /25/10S (2|25|36): objs=155 size=216B /25/11N (2|25|36): objs=928 size=3.6KiB /25/12S (2|25|36): objs=141 size=211B /25/13N (2|25|36): objs=3470 size=15.63KiB /25/14S (2|25|36): objs=134 size=143B /25/15N (2|25|36): objs=1442 size=5.85KiB /25/16S (2|25|36): objs=156 size=101B /25/17N (2|25|36): objs=6970 size=31.13KiB /25/18S (2|25|36): objs=155 size=276B /25/19N (2|25|36): objs=3495 size=15.11KiB /25/20S (2|25|36): objs=172 size=220B /25/21N (2|25|36): objs=1692 size=7.1KiB /25/22S (2|25|36): objs=144 size=246B /25/23N (2|25|36): objs=3787 size=17.34KiB /25/24S (2|25|36): objs=148 size=233B /25/25N (2|25|36): objs=890 size=3.43KiB /25/26S (2|25|36): objs=160 size=180B /25/27S (2|25|36): objs=159 size=264B /25/28S (2|25|36): objs=166 size=122B /25/29N (2|25|36): objs=4349 size=18.56KiB /25/30S (2|25|36): objs=176 size=90B /25/31N (2|25|36): objs=3561 size=16.58KiB /25/32S (2|25|36): objs=174 size=99B /25/33N (2|25|36): objs=889 size=3.63KiB /25/34S (2|25|36): objs=154 size=100B /25/35N (2|25|36): objs=2844 size=11.93KiB /26/0N (2|25|36): objs=40498 size=820.92KiB /26/1N (2|25|36): objs=42482 size=920.32KiB /26/2N (2|25|36): objs=38964 size=790.44KiB /26/3S (2|25|36): objs=157 size=297B /26/4N (2|25|36): objs=866 size=3.5KiB /26/5N (2|25|36): objs=997 size=3.98KiB /26/6S (2|25|36): objs=135 size=297B /26/7N (2|25|36): objs=2041 size=8.42KiB /26/8S (2|25|36): objs=162 size=351B /26/9N (2|25|36): objs=4142 size=17.38KiB /26/10S (2|25|36): objs=163 size=351B /26/11N (2|25|36): objs=4434 size=19.65KiB /26/12S (2|25|36): objs=152 size=210B /26/13N (2|25|36): objs=595 size=2.12KiB /26/14S (2|25|36): objs=163 size=234B /26/15N (2|25|36): objs=2933 size=12.3KiB /26/16S (2|25|36): objs=163 size=327B /26/17N (2|25|36): objs=5481 size=28.48KiB /26/18S (2|25|36): objs=150 size=191B /26/19N (2|25|36): objs=1683 size=6.99KiB /26/20S (2|25|36): objs=133 size=117B /26/21N (2|25|36): objs=331 size=1.07KiB /26/22S (2|25|36): objs=171 size=227B /26/23N (2|25|36): objs=586 size=2.16KiB /26/24S (2|25|36): objs=134 size=312B /26/25N (2|25|36): objs=1454 size=6.02KiB /26/26S (2|25|36): objs=155 size=346B /26/28S (2|25|36): objs=177 size=355B /26/29N (2|25|36): objs=1702 size=7.19KiB /26/30S (2|25|36): objs=179 size=315B /26/31N (2|25|36): objs=2037 size=8.44KiB /26/32S (2|25|36): objs=163 size=294B /26/33N (2|25|36): objs=6788 size=33.95KiB /26/34S (2|25|36): objs=146 size=155B /26/35N (2|25|36): objs=289 size=729B /27/0N (2|25|36): objs=40874 size=904.7KiB /27/1N (2|25|36): objs=39632 size=810.55KiB /27/2N (2|25|36): objs=37534 size=722.85KiB /27/3N (2|25|36): objs=9700 size=47.87KiB /27/4S (2|25|36): objs=158 size=207B /27/5N (2|25|36): objs=2541 size=10.51KiB /27/6S (2|25|36): objs=152 size=226B /27/7N (2|25|36): objs=631 size=2.28KiB /27/8S (2|25|36): objs=150 size=296B /27/10S (2|25|36): objs=165 size=152B /27/12S (2|25|36): objs=158 size=191B /27/13S (2|25|36): objs=140 size=329B /27/14S (2|25|36): objs=146 size=188B /27/15N (2|25|36): objs=10757 size=63.62KiB /27/16S (2|25|36): objs=160 size=174B /27/17N (2|25|36): objs=603 size=2.18KiB /27/18S (2|25|36): objs=153 size=130B /27/19N (2|25|36): objs=327 size=780B /27/20S (2|25|36): objs=153 size=88B /27/21N (2|25|36): objs=1101 size=4.52KiB /27/22S (2|25|36): objs=150 size=92B /27/23N (2|25|36): objs=988 size=3.8KiB /27/24S (2|25|36): objs=126 size=229B /27/26S (2|25|36): objs=196 size=344B /27/27N (2|25|36): objs=2754 size=12.12KiB /27/28S (2|25|36): objs=159 size=196B /27/29N (2|25|36): objs=341 size=957B /27/30S (2|25|36): objs=143 size=291B /27/31N (2|25|36): objs=1095 size=4.44KiB /27/32S (2|25|36): objs=141 size=205B /27/33N (2|25|36): objs=764 size=2.92KiB /27/34S (2|25|36): objs=152 size=114B /27/35N (2|25|36): objs=5838 size=27.52KiB /28/0N (2|25|36): objs=36936 size=679.27KiB /28/1N (2|25|36): objs=39340 size=809.27KiB /28/2N (2|25|36): objs=35886 size=629.11KiB /28/3N (2|25|36): objs=10715 size=62.38KiB /28/4S (2|25|36): objs=167 size=200B /28/5N (2|25|36): objs=3700 size=17.22KiB /28/6S (2|25|36): objs=164 size=250B /28/7N (2|25|36): objs=1819 size=7.28KiB /28/8S (2|25|36): objs=166 size=227B /28/9S (2|25|36): objs=151 size=337B /28/10S (2|25|36): objs=145 size=192B /28/11N (2|25|36): objs=640 size=2.45KiB /28/12S (2|25|36): objs=136 size=217B /28/13N (2|25|36): objs=5298 size=24.49KiB /28/14S (2|25|36): objs=152 size=333B /28/15N (2|25|36): objs=313 size=946B /28/16S (2|25|36): objs=135 size=215B /28/17N (2|25|36): objs=471 size=1.59KiB /28/18S (2|25|36): objs=171 size=334B /28/19N (2|25|36): objs=1885 size=7.71KiB /28/20S (2|25|36): objs=159 size=193B /28/21N (2|25|36): objs=4458 size=21.41KiB /28/22S (2|25|36): objs=150 size=100B /28/23N (2|25|36): objs=1088 size=4.18KiB /28/24S (2|25|36): objs=157 size=340B /28/25N (2|25|36): objs=2948 size=12.15KiB /28/26S (2|25|36): objs=173 size=206B /28/27N (2|25|36): objs=283 size=795B /28/28S (2|25|36): objs=131 size=164B /28/29N (2|25|36): objs=613 size=2.15KiB /28/30S (2|25|36): objs=158 size=309B /28/31N (2|25|36): objs=2364 size=10KiB /28/32S (2|25|36): objs=143 size=166B /28/33N (2|25|36): objs=468 size=1.63KiB /28/34S (2|25|36): objs=156 size=167B /28/35N (2|25|36): objs=1285 size=5.03KiB /29/0N (2|25|36): objs=39387 size=801.71KiB /29/1N (2|25|36): objs=38621 size=770.15KiB /29/2N (2|25|36): objs=36912 size=647.88KiB /29/3N (2|25|36): objs=15357 size=109.43KiB /29/4S (2|25|36): objs=153 size=106B /29/5N (2|25|36): objs=461 size=1.61KiB /29/6S (2|25|36): objs=154 size=326B /29/7N (2|25|36): objs=4640 size=21.35KiB /29/8S (2|25|36): objs=166 size=236B /29/9N (2|25|36): objs=1520 size=6.26KiB /29/10S (2|25|36): objs=156 size=194B /29/12S (2|25|36): objs=164 size=198B /29/13N (2|25|36): objs=1019 size=4.04KiB /29/14S (2|25|36): objs=149 size=113B /29/16S (2|25|36): objs=155 size=189B /29/17N (2|25|36): objs=469 size=1.52KiB /29/18S (2|25|36): objs=159 size=105B /29/19S (2|25|36): objs=139 size=87B /29/20S (2|25|36): objs=168 size=260B /29/21N (2|25|36): objs=3440 size=15.66KiB /29/22S (2|25|36): objs=164 size=271B /29/23N (2|25|36): objs=291 size=944B /29/24S (2|25|36): objs=151 size=207B /29/25N (2|25|36): objs=4138 size=18.05KiB /29/26S (2|25|36): objs=158 size=92B /29/27N (2|25|36): objs=1169 size=4.69KiB /29/28S (2|25|36): objs=158 size=282B /29/29N (2|25|36): objs=2002 size=8.34KiB /29/30S (2|25|36): objs=177 size=153B /29/31N (2|25|36): objs=1040 size=4.03KiB /29/32S (2|25|36): objs=162 size=288B /29/33N (2|25|36): objs=607 size=2.19KiB /29/34S (2|25|36): objs=167 size=184B /29/35N (2|25|36): objs=2269 size=9.32KiB /30/0N (2|25|36): objs=37627 size=766.61KiB /30/1N (2|25|36): objs=34910 size=566.02KiB /30/2N (2|25|36): objs=35917 size=645.36KiB /30/3N (2|25|36): objs=15782 size=107.18KiB /30/4S (2|25|36): objs=167 size=350B /30/5N (2|25|36): objs=3081 size=14.13KiB /30/6S (2|25|36): objs=152 size=140B /30/7S (2|25|36): objs=169 size=346B /30/8S (2|25|36): objs=154 size=179B /30/9N (2|25|36): objs=2853 size=12.66KiB /30/10S (2|25|36): objs=159 size=154B /30/12S (2|25|36): objs=147 size=199B /30/13N (2|25|36): objs=2315 size=9.69KiB /30/14S (2|25|36): objs=168 size=298B /30/15N (2|25|36): objs=3417 size=14.55KiB /30/16S (2|25|36): objs=167 size=149B /30/17N (2|25|36): objs=3895 size=17.1KiB /30/18S (2|25|36): objs=166 size=260B /30/19N (2|25|36): objs=412 size=1.67KiB /30/20S (2|25|36): objs=154 size=149B /30/21N (2|25|36): objs=930 size=3.71KiB /30/22S (2|25|36): objs=161 size=345B /30/23S (2|25|36): objs=139 size=211B /30/24S (2|25|36): objs=170 size=285B /30/25N (2|25|36): objs=433 size=1.59KiB /30/26S (2|25|36): objs=167 size=174B /30/27N (2|25|36): objs=1370 size=5.38KiB /30/28S (2|25|36): objs=146 size=287B /30/29N (2|25|36): objs=314 size=1010B /30/30S (2|25|36): objs=158 size=247B /30/31N (2|25|36): objs=788 size=3.19KiB /30/32S (2|25|36): objs=145 size=196B /30/33N (2|25|36): objs=307 size=1.04KiB /30/34S (2|25|36): objs=137 size=281B /30/35N (2|25|36): objs=310 size=873B /31/0N (2|25|36): objs=41475 size=905.7KiB /31/1N (2|25|36): objs=40484 size=870.08KiB /31/2N (2|25|36): objs=37573 size=814.82KiB /31/3S (2|25|36): objs=174 size=234B /31/4N (2|25|36): objs=298 size=744B /31/5N (2|25|36): objs=3267 size=14.64KiB /31/6S (2|25|36): objs=139 size=117B /31/7N (2|25|36): objs=5510 size=26.32KiB /31/8S (2|25|36): objs=150 size=110B /31/9N (2|25|36): objs=1027 size=4.07KiB /31/10S (2|25|36): objs=152 size=86B /31/11N (2|25|36): objs=321 size=959B /31/12S (2|25|36): objs=133 size=227B /31/13N (2|25|36): objs=934 size=3.42KiB /31/14S (2|25|36): objs=162 size=154B /31/15N (2|25|36): objs=4841 size=21.22KiB /31/16S (2|25|36): objs=145 size=104B /31/17N (2|25|36): objs=3691 size=15.45KiB /31/18S (2|25|36): objs=160 size=289B /31/19N (2|25|36): objs=3088 size=13.27KiB /31/20S (2|25|36): objs=149 size=203B /31/21N (2|25|36): objs=3380 size=14.23KiB /31/22S (2|25|36): objs=167 size=186B /31/23N (2|25|36): objs=1103 size=4.24KiB /31/24S (2|25|36): objs=155 size=260B /31/25N (2|25|36): objs=1393 size=5.74KiB /31/26S (2|25|36): objs=139 size=141B /31/27N (2|25|36): objs=276 size=979B /31/28S (2|25|36): objs=151 size=141B /31/29N (2|25|36): objs=2871 size=12.06KiB /31/30S (2|25|36): objs=134 size=236B /31/31N (2|25|36): objs=478 size=1.44KiB /31/32S (2|25|36): objs=160 size=301B /31/33N (2|25|36): objs=3227 size=14.4KiB /31/34S (2|25|36): objs=152 size=109B com.milaboratory.util.sorting.HashSorterTest > test2 SKIPPED com.milaboratory.util.NSequenceWithQualityPrintHelperTest > test1 SKIPPED com.milaboratory.util.AtomicEnumHistogramTest > test1 STANDARD_OUT {"labels":["A","B","C","null"],"hist":[1,2,0,1]} com.milaboratory.util.JsonOverriderTest > test1 STANDARD_OUT WARNING: unnecessary override -Ob= with the same value. com.milaboratory.util.CacheTest > test1 STANDARD_OUT Cache misses:400 Cache hits:800 com.milaboratory.util.ByteStringTest > testSpeed1 STANDARD_OUT Time per hash: 192ns Addition to hash set (per operation): 550ns Hash set removal (per operation): 339ns a com.milaboratory.util.RemoveActionTest > test1 STANDARD_OUT /tmp/milib_9f6e163e832334ca7f02fb882d70b1ca008aea1b3760961286532861168 com.milaboratory.util.RemoveActionTest > test2 STANDARD_OUT /tmp/milib_cddc8b6c3fa020095bc50ffe250cc3cfeae4c04513595718661672620072.tmp com.milaboratory.util.IntCombinationsTest > test1 STANDARD_OUT [0, 1] [0, 2] [1, 2] com.milaboratory.primitivio.blocks.PrimitivOBlocksTest > benchmark1 SKIPPED com.milaboratory.primitivio.blocks.PrimitivOBlocksTest > test1 STANDARD_OUT ================== High compression: false Concurrency: 4 File size: 5608636 Write time: 179.43ms O. Stats: Wall clock time: 180.18ms Total CPU time: 326.14ms User wait time: 118.72ms Serialization time: 254.97ms (78.18%) Checksum calculation time: 9.04ms (2.77%) Compression time: 54.6ms (16.74%) Total IO delay: 32.03ms Concurrency overhead: 7.44ms Uncompressed size: 18.44MiB (~2.08KiB per object) Output size: 5.35MiB (~617B per object; compression = 29.01%) IO speed: 167.15MiB/s Concurrency adjusted uncompressed speed: 192.05MiB/s Actual uncompressed speed: 102.43MiB/s Actual speed: 29.72MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 617B Blocks: 62 (~88.34KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 1: Wall clock time: 105.11ms Total CPU time: 168ms Serialization time: 98.02ms (58.35%) Checksum calculation time: 8.88ms (5.28%) Compression time: 57.79ms (34.4%) Total IO delay: 19.59ms Input size: 5.35MiB Decompressed size: 18.44MiB (compression = 29.01%) IO speed: 281.52MiB/s Concurrency adjusted uncompressed speed: 400.8MiB/s Actual uncompressed speed: 175.59MiB/s Actual speed: 50.94MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 617B Blocks: 62 (~88.34KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 2: Wall clock time: 243.67ms Total CPU time: 312.95ms Serialization time: 165.51ms (52.89%) Checksum calculation time: 17.67ms (5.65%) Compression time: 123.38ms (39.42%) Total IO delay: 62.72ms Input size: 10.7MiB Decompressed size: 36.87MiB (compression = 29.01%) IO speed: 172.54MiB/s Concurrency adjusted uncompressed speed: 396.49MiB/s Actual uncompressed speed: 151.74MiB/s Actual speed: 44.02MiB/s Objects: 18158 Average object size uncompressed: 2.08KiB Average object size compressed: 617B Blocks: 124 (~88.34KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 ================== High compression: false Concurrency: 4 File size: 5588298 Write time: 186.82ms O. Stats: Wall clock time: 187.33ms Total CPU time: 138.58ms User wait time: 81.92ms Serialization time: 67.41ms (48.64%) Checksum calculation time: 8.98ms (6.48%) Compression time: 57.39ms (41.41%) Total IO delay: 28.51ms Concurrency overhead: 1.9ms Uncompressed size: 18.44MiB (~2.08KiB per object) Output size: 5.33MiB (~615B per object; compression = 28.91%) IO speed: 190.34MiB/s Concurrency adjusted uncompressed speed: 428.77MiB/s Actual uncompressed speed: 98.59MiB/s Actual speed: 28.5MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 615B Blocks: 20 (~272.87KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 1: Wall clock time: 89.32ms Total CPU time: 115.08ms Serialization time: 39.72ms (34.51%) Checksum calculation time: 9.2ms (8%) Compression time: 65.69ms (57.08%) Total IO delay: 12.47ms Input size: 5.33MiB Decompressed size: 18.44MiB (compression = 28.91%) IO speed: 444.12MiB/s Concurrency adjusted uncompressed speed: 594.74MiB/s Actual uncompressed speed: 207.16MiB/s Actual speed: 59.88MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 615B Blocks: 20 (~272.87KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 2: Wall clock time: 171.04ms Total CPU time: 199.96ms Serialization time: 66.06ms (33.04%) Checksum calculation time: 17.38ms (8.69%) Compression time: 115.74ms (57.89%) Total IO delay: 24.27ms Input size: 10.66MiB Decompressed size: 36.87MiB (compression = 28.91%) IO speed: 444.12MiB/s Concurrency adjusted uncompressed speed: 658.46MiB/s Actual uncompressed speed: 215.64MiB/s Actual speed: 62.33MiB/s Objects: 18158 Average object size uncompressed: 2.08KiB Average object size compressed: 615B Blocks: 40 (~272.87KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 ================== High compression: false Concurrency: 1 File size: 5608636 Write time: 332.31ms O. Stats: Wall clock time: 333.2ms Total CPU time: 99.83ms User wait time: 253.42ms Serialization time: 39.86ms (39.93%) Checksum calculation time: 8.16ms (8.18%) Compression time: 46.56ms (46.64%) Total IO delay: 151.12ms Concurrency overhead: 3.36ms Uncompressed size: 18.44MiB (~2.08KiB per object) Output size: 5.35MiB (~617B per object; compression = 29.01%) IO speed: 35.42MiB/s Concurrency adjusted uncompressed speed: 72.59MiB/s Actual uncompressed speed: 55.37MiB/s Actual speed: 16.06MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 617B Blocks: 62 (~88.34KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Checksum ok! I. Stats 1: Wall clock time: 63.07ms Total CPU time: 84.43ms Serialization time: 26.33ms (31.19%) Checksum calculation time: 8.19ms (9.71%) Compression time: 48.75ms (57.74%) Total IO delay: 16.46ms Input size: 5.35MiB Decompressed size: 18.44MiB (compression = 29.01%) IO speed: 334.3MiB/s Concurrency adjusted uncompressed speed: 184.37MiB/s Actual uncompressed speed: 292.65MiB/s Actual speed: 84.9MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 617B Blocks: 62 (~88.34KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 2: Wall clock time: 130.92ms Total CPU time: 171.25ms Serialization time: 53.67ms (31.34%) Checksum calculation time: 16.28ms (9.51%) Compression time: 98.39ms (57.46%) Total IO delay: 30.48ms Input size: 10.7MiB Decompressed size: 36.87MiB (compression = 29.01%) IO speed: 356.59MiB/s Concurrency adjusted uncompressed speed: 183.45MiB/s Actual uncompressed speed: 283.64MiB/s Actual speed: 82.29MiB/s Objects: 18158 Average object size uncompressed: 2.08KiB Average object size compressed: 617B Blocks: 124 (~88.34KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 ================== High compression: false Concurrency: 1 File size: 5588298 Write time: 192.45ms O. Stats: Wall clock time: 193.31ms Total CPU time: 105.93ms User wait time: 125.09ms Serialization time: 46.56ms (43.96%) Checksum calculation time: 8.33ms (7.86%) Compression time: 46.8ms (44.18%) Total IO delay: 18.35ms Concurrency overhead: 1.16ms Uncompressed size: 18.44MiB (~2.08KiB per object) Output size: 5.33MiB (~615B per object; compression = 28.91%) IO speed: 296.08MiB/s Concurrency adjusted uncompressed speed: 147.5MiB/s Actual uncompressed speed: 95.53MiB/s Actual speed: 27.61MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 615B Blocks: 20 (~272.87KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Checksum ok! I. Stats 1: Wall clock time: 80.48ms Total CPU time: 99.98ms Serialization time: 42.06ms (42.07%) Checksum calculation time: 8.05ms (8.05%) Compression time: 49.43ms (49.44%) Total IO delay: 10.12ms Input size: 5.33MiB Decompressed size: 18.44MiB (compression = 28.91%) IO speed: 532.94MiB/s Concurrency adjusted uncompressed speed: 167.61MiB/s Actual uncompressed speed: 230.46MiB/s Actual speed: 66.62MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 615B Blocks: 20 (~272.87KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 2: Wall clock time: 196.14ms Total CPU time: 217.09ms Serialization time: 92.29ms (42.51%) Checksum calculation time: 16.36ms (7.53%) Compression time: 107.5ms (49.52%) Total IO delay: 29.24ms Input size: 10.66MiB Decompressed size: 36.87MiB (compression = 28.91%) IO speed: 367.55MiB/s Concurrency adjusted uncompressed speed: 149.89MiB/s Actual uncompressed speed: 188.13MiB/s Actual speed: 54.38MiB/s Objects: 18158 Average object size uncompressed: 2.08KiB Average object size compressed: 615B Blocks: 40 (~272.87KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Pending / IO / Serde: 1 / 0 / 3 ================== High compression: true Concurrency: 4 File size: 4156299 Write time: 2.45s O. Stats: Wall clock time: 2.45s Total CPU time: 5.14s User wait time: 2.33s Serialization time: 51.7ms (1.01%) Checksum calculation time: 8.52ms (0.17%) Compression time: 5.07s (98.68%) Total IO delay: 593.69ms Concurrency overhead: 6.59ms Uncompressed size: 18.44MiB (~2.08KiB per object) Output size: 3.96MiB (~457B per object; compression = 21.5%) IO speed: 6.68MiB/s Concurrency adjusted uncompressed speed: 12.8MiB/s Actual uncompressed speed: 7.54MiB/s Actual speed: 1.62MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 457B Blocks: 62 (~65.47KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 1: Wall clock time: 59.36ms Total CPU time: 89.65ms Serialization time: 27.48ms (30.65%) Checksum calculation time: 8.37ms (9.34%) Compression time: 52.11ms (58.13%) Total IO delay: 10.89ms Input size: 3.96MiB Decompressed size: 18.44MiB (compression = 21.5%) IO speed: 396.38MiB/s Concurrency adjusted uncompressed speed: 737.48MiB/s Actual uncompressed speed: 312.49MiB/s Actual speed: 67.18MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 457B Blocks: 62 (~65.47KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 2: Wall clock time: 131.47ms Total CPU time: 180.09ms Serialization time: 56.14ms (31.18%) Checksum calculation time: 16.94ms (9.41%) Compression time: 103.67ms (57.56%) Total IO delay: 20.67ms Input size: 7.93MiB Decompressed size: 36.87MiB (compression = 21.5%) IO speed: 396.38MiB/s Concurrency adjusted uncompressed speed: 737.48MiB/s Actual uncompressed speed: 281.48MiB/s Actual speed: 60.52MiB/s Objects: 18158 Average object size uncompressed: 2.08KiB Average object size compressed: 457B Blocks: 124 (~65.47KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Pending / IO / Serde: 2 / 0 / 2 ================== High compression: true Concurrency: 4 File size: 4098671 Write time: 3.5s O. Stats: Wall clock time: 3.5s Total CPU time: 5.76s User wait time: 3.12s Serialization time: 51.97ms (0.9%) Checksum calculation time: 8.59ms (0.15%) Compression time: 5.7s (98.85%) Total IO delay: 21.74ms Concurrency overhead: 2.64ms Uncompressed size: 18.44MiB (~2.08KiB per object) Output size: 3.91MiB (~451B per object; compression = 21.2%) IO speed: 186.13MiB/s Concurrency adjusted uncompressed speed: 12.73MiB/s Actual uncompressed speed: 5.27MiB/s Actual speed: 1.12MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 451B Blocks: 20 (~200.13KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 1: Wall clock time: 73.65ms Total CPU time: 84.07ms Serialization time: 24.94ms (29.66%) Checksum calculation time: 8.82ms (10.49%) Compression time: 49.94ms (59.41%) Total IO delay: 15.22ms Input size: 3.91MiB Decompressed size: 18.44MiB (compression = 21.2%) IO speed: 260.59MiB/s Concurrency adjusted uncompressed speed: 768.2MiB/s Actual uncompressed speed: 252.56MiB/s Actual speed: 53.55MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 451B Blocks: 20 (~200.13KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 2: Wall clock time: 162.19ms Total CPU time: 175.36ms Serialization time: 52.9ms (30.17%) Checksum calculation time: 17.99ms (10.26%) Compression time: 103.75ms (59.16%) Total IO delay: 24.23ms Input size: 7.82MiB Decompressed size: 36.87MiB (compression = 21.2%) IO speed: 325.73MiB/s Concurrency adjusted uncompressed speed: 752.53MiB/s Actual uncompressed speed: 227.62MiB/s Actual speed: 48.26MiB/s Objects: 18158 Average object size uncompressed: 2.08KiB Average object size compressed: 451B Blocks: 40 (~200.13KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 ================== High compression: true Concurrency: 1 File size: 4156299 Write time: 5.54s O. Stats: Wall clock time: 5.54s Total CPU time: 5.18s User wait time: 5.52s Serialization time: 44.34ms (0.86%) Checksum calculation time: 8.17ms (0.16%) Compression time: 5.12s (98.86%) Total IO delay: 334.08ms Concurrency overhead: 4.98ms Uncompressed size: 18.44MiB (~2.08KiB per object) Output size: 3.96MiB (~457B per object; compression = 21.5%) IO speed: 11.87MiB/s Concurrency adjusted uncompressed speed: 3.34MiB/s Actual uncompressed speed: 3.33MiB/s Actual speed: 732.52KiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 457B Blocks: 62 (~65.47KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Checksum ok! I. Stats 1: Wall clock time: 69.78ms Total CPU time: 88.08ms Serialization time: 26.89ms (30.53%) Checksum calculation time: 8.33ms (9.46%) Compression time: 51.78ms (58.79%) Total IO delay: 18.29ms Input size: 3.96MiB Decompressed size: 18.44MiB (compression = 21.5%) IO speed: 220.21MiB/s Concurrency adjusted uncompressed speed: 173.93MiB/s Actual uncompressed speed: 267.2MiB/s Actual speed: 57.45MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 457B Blocks: 62 (~65.47KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 2: Wall clock time: 153.81ms Total CPU time: 185.02ms Serialization time: 59.92ms (32.38%) Checksum calculation time: 16.59ms (8.97%) Compression time: 104.7ms (56.59%) Total IO delay: 41.6ms Input size: 7.93MiB Decompressed size: 36.87MiB (compression = 21.5%) IO speed: 193.35MiB/s Concurrency adjusted uncompressed speed: 163.16MiB/s Actual uncompressed speed: 241.01MiB/s Actual speed: 51.81MiB/s Objects: 18158 Average object size uncompressed: 2.08KiB Average object size compressed: 457B Blocks: 124 (~65.47KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Pending / IO / Serde: 0 / 0 / 1 Pending / IO / Serde: 0 / 0 / 1 ================== High compression: true Concurrency: 1 File size: 4098671 Write time: 5.65s O. Stats: Wall clock time: 5.65s Total CPU time: 5.61s User wait time: 5.64s Serialization time: 51.92ms (0.93%) Checksum calculation time: 8.4ms (0.15%) Compression time: 5.54s (98.82%) Total IO delay: 25.73ms Concurrency overhead: 5.24ms Uncompressed size: 18.44MiB (~2.08KiB per object) Output size: 3.91MiB (~451B per object; compression = 21.2%) IO speed: 156.35MiB/s Concurrency adjusted uncompressed speed: 3.27MiB/s Actual uncompressed speed: 3.26MiB/s Actual speed: 708.05KiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 451B Blocks: 20 (~200.13KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 Checksum ok! I. Stats 1: Wall clock time: 104.53ms Total CPU time: 104.65ms Serialization time: 34.02ms (32.51%) Checksum calculation time: 13.49ms (12.89%) Compression time: 56.54ms (54.03%) Total IO delay: 38.62ms Input size: 3.91MiB Decompressed size: 18.44MiB (compression = 21.2%) IO speed: 102.86MiB/s Concurrency adjusted uncompressed speed: 128.93MiB/s Actual uncompressed speed: 177.28MiB/s Actual speed: 37.58MiB/s Objects: 9079 Average object size uncompressed: 2.08KiB Average object size compressed: 451B Blocks: 20 (~200.13KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 I. Stats 2: Wall clock time: 208.8ms Total CPU time: 198.38ms Serialization time: 62.15ms (31.33%) Checksum calculation time: 26.12ms (13.17%) Compression time: 109.15ms (55.02%) Total IO delay: 86.77ms Input size: 7.82MiB Decompressed size: 36.87MiB (compression = 21.2%) IO speed: 90.9MiB/s Concurrency adjusted uncompressed speed: 129.38MiB/s Actual uncompressed speed: 177.28MiB/s Actual speed: 37.58MiB/s Objects: 18158 Average object size uncompressed: 2.08KiB Average object size compressed: 451B Blocks: 40 (~200.13KiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 com.milaboratory.primitivio.blocks.PrimitivOBlocksTest > bigBlocks STANDARD_OUT Pending / IO / Serde / Objs: 0 / 1 / 2 / 1000 Pending / IO / Serde / Objs: 2 / 1 / 1 / 7000 Pending / IO / Serde / Objs: 1 / 1 / 1 / 12000 Pending / IO / Serde / Objs: 1 / 1 / 1 / 17000 O. Stats: Wall clock time: 9.29s Total CPU time: 11.5s User wait time: 127us Serialization time: 4.82s (41.94%) Checksum calculation time: 1.36s (11.87%) Compression time: 2.48s (21.53%) Total IO delay: 7.28s Concurrency overhead: 4.48ms Uncompressed size: 1.86GiB (~97.66KiB per object) Output size: 1.86GiB (~97.66KiB per object; compression = 100%) IO speed: 262.19MiB/s Concurrency adjusted uncompressed speed: 811.33MiB/s Actual uncompressed speed: 205.39MiB/s Actual speed: 205.39MiB/s Objects: 20000 Average object size uncompressed: 97.66KiB Average object size compressed: 97.66KiB Blocks: 20 (~95.37MiB each) Ongoing and pending ops (Serde / IO / Pending): 0 / 0 / 0 com.milaboratory.test.TestUtil > testLT STANDARD_OUT Short tests. No system env properties. WARNING: A terminally deprecated method in java.lang.System has been called WARNING: System::setSecurityManager has been called by org.gradle.api.internal.tasks.testing.worker.TestWorker (file:/usr/share/gradle/lib/plugins/gradle-testing-base-4.4.1.jar) WARNING: Please consider reporting this to the maintainers of org.gradle.api.internal.tasks.testing.worker.TestWorker WARNING: System::setSecurityManager will be removed in a future release Gradle Test Executor 1 finished executing tests. Finished generating test XML results (0.077 secs) into: /build/reproducible-path/milib-2.2.0+dfsg/build/test-results/test Generating HTML test report... Finished generating test html results (0.128 secs) into: /build/reproducible-path/milib-2.2.0+dfsg/build/reports/tests/test :test (Thread[Task worker for ':',5,main]) completed. Took 5 mins 39.398 secs. BUILD SUCCESSFUL in 6m 23s 5 actionable tasks: 3 executed, 2 up-to-date create-stamp debian/debhelper-build-stamp dh_prep dh_auto_install --destdir=debian/libmilib-java/ mh_install jh_installjavadoc dh_installdocs dh_installchangelogs dh_perl dh_link jh_installlibs jh_classpath jh_manifest jh_depends dh_strip_nondeterminism dh_compress dh_fixperms dh_missing dh_installdeb dh_gencontrol dh_md5sums dh_builddeb dpkg-deb: building package 'libmilib-java' in '../libmilib-java_2.2.0+dfsg-1_all.deb'. dpkg-genbuildinfo --build=binary -O../milib_2.2.0+dfsg-1_amd64.buildinfo dpkg-genchanges --build=binary -O../milib_2.2.0+dfsg-1_amd64.changes dpkg-genchanges: info: binary-only upload (no source code included) dpkg-source --after-build . dpkg-buildpackage: info: binary-only upload (no source included) dpkg-genchanges: info: including full source code in upload I: copying local configuration I: unmounting dev/ptmx filesystem I: unmounting dev/pts filesystem I: unmounting dev/shm filesystem I: unmounting proc filesystem I: unmounting sys filesystem I: cleaning the build env I: removing directory /srv/workspace/pbuilder/1771205 and its subdirectories I: Current time: Thu May 23 01:03:55 -12 2024 I: pbuilder-time-stamp: 1716469436 Thu May 23 13:03:57 UTC 2024 I: 1st build successful. Starting 2nd build on remote node ionos15-amd64.debian.net. Thu May 23 13:03:57 UTC 2024 I: Preparing to do remote build '2' on ionos15-amd64.debian.net. Thu May 23 13:09:14 UTC 2024 I: Deleting $TMPDIR on ionos15-amd64.debian.net. Thu May 23 13:09:15 UTC 2024 I: milib_2.2.0+dfsg-1_amd64.changes: Format: 1.8 Date: Fri, 30 Dec 2022 14:38:35 +0100 Source: milib Binary: libmilib-java Architecture: all Version: 2.2.0+dfsg-1 Distribution: unstable Urgency: medium Maintainer: Debian Med Packaging Team Changed-By: Pierre Gruet Description: libmilib-java - library for Next Generation Sequencing (NGS) data processing Changes: milib (2.2.0+dfsg-1) unstable; urgency=medium . * New upstream version 2.2.0+dfsg * Refreshing patches * Raising Standards version to 4.6.2 (no change) Checksums-Sha1: 8751ab750ded5a1e80da958bf1f6ba5121a4050f 776412 libmilib-java_2.2.0+dfsg-1_all.deb fb568c134444e58baa207d3541307b4a8baf2815 15484 milib_2.2.0+dfsg-1_amd64.buildinfo Checksums-Sha256: 9d263103a291a0df5e0be2923c16eb848bfcb61a35f98a56b0647d804db1c5d7 776412 libmilib-java_2.2.0+dfsg-1_all.deb 823f25836e8dcbea940afcc70e1739a5eb920f78e029f7747d61178ecfa95475 15484 milib_2.2.0+dfsg-1_amd64.buildinfo Files: 3e12dbbef8c0dc2929397086181e17b8 776412 java optional libmilib-java_2.2.0+dfsg-1_all.deb 565780b48734d6d4397456e236c72b05 15484 java optional milib_2.2.0+dfsg-1_amd64.buildinfo Thu May 23 13:09:16 UTC 2024 I: diffoscope 266 will be used to compare the two builds: Running as unit: rb-diffoscope-amd64_3-20745.service # Profiling output for: /usr/bin/diffoscope --timeout 7200 --html /srv/reproducible-results/rbuild-debian/r-b-build.n3PaST7J/milib_2.2.0+dfsg-1.diffoscope.html --text /srv/reproducible-results/rbuild-debian/r-b-build.n3PaST7J/milib_2.2.0+dfsg-1.diffoscope.txt --json /srv/reproducible-results/rbuild-debian/r-b-build.n3PaST7J/milib_2.2.0+dfsg-1.diffoscope.json --profile=- /srv/reproducible-results/rbuild-debian/r-b-build.n3PaST7J/b1/milib_2.2.0+dfsg-1_amd64.changes /srv/reproducible-results/rbuild-debian/r-b-build.n3PaST7J/b2/milib_2.2.0+dfsg-1_amd64.changes ## command (total time: 0.000s) 0.000s 1 call cmp (internal) ## has_same_content_as (total time: 0.000s) 0.000s 1 call abc.DotChangesFile ## main (total time: 0.363s) 0.363s 2 calls outputs 0.000s 1 call cleanup ## recognizes (total time: 0.023s) 0.023s 12 calls diffoscope.comparators.binary.FilesystemFile ## specialize (total time: 0.000s) 0.000s 1 call specialize Finished with result: success Main processes terminated with: code=exited/status=0 Service runtime: 763ms CPU time consumed: 763ms Thu May 23 13:09:17 UTC 2024 I: diffoscope 266 found no differences in the changes files, and a .buildinfo file also exists. Thu May 23 13:09:17 UTC 2024 I: milib from unstable built successfully and reproducibly on amd64. Thu May 23 13:09:18 UTC 2024 I: Submitting .buildinfo files to external archives: Thu May 23 13:09:18 UTC 2024 I: Submitting 16K b1/milib_2.2.0+dfsg-1_amd64.buildinfo.asc Thu May 23 13:09:19 UTC 2024 I: Submitting 16K b2/milib_2.2.0+dfsg-1_amd64.buildinfo.asc Thu May 23 13:09:20 UTC 2024 I: Done submitting .buildinfo files to http://buildinfo.debian.net/api/submit. Thu May 23 13:09:20 UTC 2024 I: Done submitting .buildinfo files. Thu May 23 13:09:20 UTC 2024 I: Removing signed milib_2.2.0+dfsg-1_amd64.buildinfo.asc files: removed './b1/milib_2.2.0+dfsg-1_amd64.buildinfo.asc' removed './b2/milib_2.2.0+dfsg-1_amd64.buildinfo.asc'