Sun Jul 18 07:20:30 UTC 2021 I: starting to build libedlib/bullseye/armhf on jenkins on '2021-07-18 07:20' Sun Jul 18 07:20:30 UTC 2021 I: The jenkins build log is/was available at https://jenkins.debian.net/userContent/reproducible/debian/build_service/armhf_19/9064/console.log Sun Jul 18 07:20:30 UTC 2021 I: Downloading source for bullseye/libedlib=1.2.6-1 --2021-07-18 07:20:30-- http://cdn-fastly.deb.debian.org/debian/pool/main/libe/libedlib/libedlib_1.2.6-1.dsc Connecting to 78.137.99.97:3128... connected. Proxy request sent, awaiting response... 200 OK Length: 2221 (2.2K) Saving to: ‘libedlib_1.2.6-1.dsc’ 0K .. 100% 195M=0s 2021-07-18 07:20:30 (195 MB/s) - ‘libedlib_1.2.6-1.dsc’ saved [2221/2221] Sun Jul 18 07:20:30 UTC 2021 I: libedlib_1.2.6-1.dsc -----BEGIN PGP SIGNED MESSAGE----- Hash: SHA256 Format: 3.0 (quilt) Source: libedlib Binary: libedlib0, libedlib-dev, edlib-aligner, python3-edlib Architecture: any Version: 1.2.6-1 Maintainer: Debian Med Packaging Team Uploaders: Andreas Tille Homepage: https://github.com/Martinsos/edlib Standards-Version: 4.5.1 Vcs-Browser: https://salsa.debian.org/med-team/libedlib Vcs-Git: https://salsa.debian.org/med-team/libedlib.git Testsuite: autopkgtest Build-Depends: debhelper-compat (= 12), cmake, dh-python, d-shlibs, rename, cython3, python3-all-dev, python3-setuptools Package-List: edlib-aligner deb science optional arch=any libedlib-dev deb libdevel optional arch=any libedlib0 deb libs optional arch=any python3-edlib deb python optional arch=any Checksums-Sha1: a1e9aa839ff866647cfaacd9cfb729b4d5ef79ec 4311571 libedlib_1.2.6.orig.tar.gz 33c8b6069f9ee69e2fc020ebf778440d85a3e787 6596 libedlib_1.2.6-1.debian.tar.xz Checksums-Sha256: 0436f14b0339dabd2aab7faf3779ac1b4bbbdc46246c1bff49be997fe4b4e2c7 4311571 libedlib_1.2.6.orig.tar.gz 178cf652b5a617ee06b5ac46f02201844ffaf4d63a111c43b73ac681ee9ffaf6 6596 libedlib_1.2.6-1.debian.tar.xz Files: 86666eb3b10c30ea291289f753629d12 4311571 libedlib_1.2.6.orig.tar.gz 0c1503ba653517eb4c40e809b620e597 6596 libedlib_1.2.6-1.debian.tar.xz -----BEGIN PGP SIGNATURE----- iQJFBAEBCAAvFiEE8fAHMgoDVUHwpmPKV4oElNHGRtEFAl/90w8RHHRpbGxlQGRl Ymlhbi5vcmcACgkQV4oElNHGRtExEBAAkKo3XSTnyz0fzwu8AL0ts/Su0HkPRvNA oAywxAIEcuOPETwz6Kw3iIwPOy5aKTxpCu8EjaoypYXUl7uNf/zTySjyAqqac+zi mIl2TRo2hFHx9u/VmUxa1pPlvayjo8epmYAy9fOaokx5I9fpbbFPwEMCdRXloZHj xvs6JIUEwrMisJbvt3RogkqlSVmrs1MrJdMWTIgZlZ3dc6yFe0KmRkqXdd/bCP60 bbRUuIvpJ0YnBMjr0kQ5O+UHTGTfukt3X0KtBCZy1l/6gELIaCmIveIanff2pZAf h+/FPHVndR/7vyMFhkFrDfQFOzUBH4UP/xy4yyPYo5Sp25B7cQlN6roKg8BlaOPP clGAGD0IEIVLpyEI3ThpJARJaI2hm/naGGSTozR3GZUe6qgsDfxI+CwwDTo6W9z9 cCHkRQ8bMzjsGdQ/0yXQXUcF7LbB3/GNJCWoupnchjdThBTuPWsYf4HkR1Fkb8v1 9E7znynr/L9mEBhfXn7v6y9R8HEc8ysjqnuZw1te4d29a+JBzoejpTyajNEC5F5P boqXo2w3nPHd97gUrcD+CXC17fJS9+nRwLZihSPMJYsfWBedNSd7vFJ8LcJ8luOr NYje45zYtBlnR79IIA6adbNELg4IZmtmJRFGePerR04wj5uMzrUdk0c29QQg2BGq oGnDLHWpzjk= =pDZ2 -----END PGP SIGNATURE----- Sun Jul 18 07:20:30 UTC 2021 I: Checking whether the package is not for us Sun Jul 18 07:20:30 UTC 2021 I: Starting 1st build on remote node virt64c-armhf-rb.debian.net. Sun Jul 18 07:20:31 UTC 2021 I: Preparing to do remote build '1' on virt64c-armhf-rb.debian.net. Sun Jul 18 07:23:49 UTC 2021 I: Deleting $TMPDIR on virt64c-armhf-rb.debian.net. I: pbuilder: network access will be disabled during build I: Current time: Sat Jul 17 19:20:36 -12 2021 I: pbuilder-time-stamp: 1626592836 I: Building the build Environment I: extracting base tarball [/var/cache/pbuilder/bullseye-reproducible-base.tgz] I: copying local configuration I: mounting /proc filesystem I: mounting /sys filesystem I: creating /{dev,run}/shm I: mounting /dev/pts filesystem I: redirecting /dev/ptmx to /dev/pts/ptmx I: policy-rc.d already exists I: Copying source file I: copying [libedlib_1.2.6-1.dsc] I: copying [./libedlib_1.2.6.orig.tar.gz] I: copying [./libedlib_1.2.6-1.debian.tar.xz] I: Extracting source gpgv: unknown type of key resource 'trustedkeys.kbx' gpgv: keyblock resource '/tmp/dpkg-verify-sig.lUZr0FoP/trustedkeys.kbx': General error gpgv: Signature made Tue Jan 12 04:49:19 2021 -12 gpgv: using RSA key F1F007320A035541F0A663CA578A0494D1C646D1 gpgv: issuer "tille@debian.org" gpgv: Can't check signature: No public key dpkg-source: warning: failed to verify signature on ./libedlib_1.2.6-1.dsc dpkg-source: info: extracting libedlib in libedlib-1.2.6 dpkg-source: info: unpacking libedlib_1.2.6.orig.tar.gz dpkg-source: info: unpacking libedlib_1.2.6-1.debian.tar.xz dpkg-source: info: using patch list from debian/patches/series dpkg-source: info: applying soversion.patch dpkg-source: info: applying do_not_build_hello_example.patch dpkg-source: info: applying cython3.patch dpkg-source: info: applying enable_shared_and_static.patch I: using fakeroot in build. I: Installing the build-deps I: user script /srv/workspace/pbuilder/18695/tmp/hooks/D02_print_environment starting I: set BUILDDIR='/build' BUILDUSERGECOS='first user,first room,first work-phone,first home-phone,first other' BUILDUSERNAME='pbuilder1' BUILD_ARCH='armhf' DEBIAN_FRONTEND='noninteractive' DEB_BUILD_OPTIONS='buildinfo=+all reproducible=+all,-fixfilepath parallel=3' DISTRIBUTION='' HOME='/root' HOST_ARCH='armhf' IFS=' ' INVOCATION_ID='e50b3b1698f142429b00c3233e2dd7bd' LANG='C' LANGUAGE='en_US:en' LC_ALL='C' MAIL='/var/mail/root' OPTIND='1' PATH='/usr/sbin:/usr/bin:/sbin:/bin:/usr/games' PBCURRENTCOMMANDLINEOPERATION='build' PBUILDER_OPERATION='build' PBUILDER_PKGDATADIR='/usr/share/pbuilder' PBUILDER_PKGLIBDIR='/usr/lib/pbuilder' PBUILDER_SYSCONFDIR='/etc' PPID='18695' PS1='# ' PS2='> ' PS4='+ ' PWD='/' SHELL='/bin/bash' SHLVL='2' SUDO_COMMAND='/usr/bin/timeout -k 18.1h 18h /usr/bin/ionice -c 3 /usr/bin/nice /usr/sbin/pbuilder --build --configfile /srv/reproducible-results/rbuild-debian/tmp.Fs1QT5B6eF/pbuilderrc_djWV --hookdir /etc/pbuilder/first-build-hooks --debbuildopts -b --basetgz /var/cache/pbuilder/bullseye-reproducible-base.tgz --buildresult /srv/reproducible-results/rbuild-debian/tmp.Fs1QT5B6eF/b1 --logfile b1/build.log libedlib_1.2.6-1.dsc' SUDO_GID='113' SUDO_UID='107' SUDO_USER='jenkins' TERM='unknown' TZ='/usr/share/zoneinfo/Etc/GMT+12' USER='root' _='/usr/bin/systemd-run' http_proxy='http://10.0.0.15:8000/' I: uname -a Linux virt64c 5.10.0-8-arm64 #1 SMP Debian 5.10.46-1 (2021-06-24) aarch64 GNU/Linux I: ls -l /bin total 3580 -rwxr-xr-x 1 root root 816764 Jun 21 14:26 bash -rwxr-xr-x 3 root root 26052 Jul 20 2020 bunzip2 -rwxr-xr-x 3 root root 26052 Jul 20 2020 bzcat lrwxrwxrwx 1 root root 6 Jul 20 2020 bzcmp -> bzdiff -rwxr-xr-x 1 root root 2225 Jul 20 2020 bzdiff lrwxrwxrwx 1 root root 6 Jul 20 2020 bzegrep -> bzgrep -rwxr-xr-x 1 root root 4877 Sep 4 2019 bzexe lrwxrwxrwx 1 root root 6 Jul 20 2020 bzfgrep -> bzgrep -rwxr-xr-x 1 root root 3775 Jul 20 2020 bzgrep -rwxr-xr-x 3 root root 26052 Jul 20 2020 bzip2 -rwxr-xr-x 1 root root 9636 Jul 20 2020 bzip2recover lrwxrwxrwx 1 root root 6 Jul 20 2020 bzless -> bzmore -rwxr-xr-x 1 root root 1297 Jul 20 2020 bzmore -rwxr-xr-x 1 root root 26668 Sep 22 2020 cat -rwxr-xr-x 1 root root 43104 Sep 22 2020 chgrp -rwxr-xr-x 1 root root 38984 Sep 22 2020 chmod -rwxr-xr-x 1 root root 43112 Sep 22 2020 chown -rwxr-xr-x 1 root root 92616 Sep 22 2020 cp -rwxr-xr-x 1 root root 75524 Dec 10 2020 dash -rwxr-xr-x 1 root root 75880 Sep 22 2020 date -rwxr-xr-x 1 root root 55436 Sep 22 2020 dd -rwxr-xr-x 1 root root 59912 Sep 22 2020 df -rwxr-xr-x 1 root root 96764 Sep 22 2020 dir -rwxr-xr-x 1 root root 55012 Feb 7 02:38 dmesg lrwxrwxrwx 1 root root 8 Nov 6 2019 dnsdomainname -> hostname lrwxrwxrwx 1 root root 8 Nov 6 2019 domainname -> hostname -rwxr-xr-x 1 root root 22508 Sep 22 2020 echo -rwxr-xr-x 1 root root 28 Nov 9 2020 egrep -rwxr-xr-x 1 root root 22496 Sep 22 2020 false -rwxr-xr-x 1 root root 28 Nov 9 2020 fgrep -rwxr-xr-x 1 root root 47492 Feb 7 02:38 findmnt -rwsr-xr-x 1 root root 26076 Feb 26 04:12 fusermount -rwxr-xr-x 1 root root 124508 Nov 9 2020 grep -rwxr-xr-x 2 root root 2346 Mar 2 11:30 gunzip -rwxr-xr-x 1 root root 6376 Mar 2 11:30 gzexe -rwxr-xr-x 1 root root 64212 Mar 2 11:30 gzip -rwxr-xr-x 1 root root 13784 Nov 6 2019 hostname -rwxr-xr-x 1 root root 43180 Sep 22 2020 ln -rwxr-xr-x 1 root root 35068 Feb 7 2020 login -rwxr-xr-x 1 root root 96764 Sep 22 2020 ls -rwxr-xr-x 1 root root 99940 Feb 7 02:38 lsblk -rwxr-xr-x 1 root root 51408 Sep 22 2020 mkdir -rwxr-xr-x 1 root root 43184 Sep 22 2020 mknod -rwxr-xr-x 1 root root 30780 Sep 22 2020 mktemp -rwxr-xr-x 1 root root 34408 Feb 7 02:38 more -rwsr-xr-x 1 root root 34400 Feb 7 02:38 mount -rwxr-xr-x 1 root root 9824 Feb 7 02:38 mountpoint -rwxr-xr-x 1 root root 88524 Sep 22 2020 mv lrwxrwxrwx 1 root root 8 Nov 6 2019 nisdomainname -> hostname lrwxrwxrwx 1 root root 14 Apr 18 03:38 pidof -> /sbin/killall5 -rwxr-xr-x 1 root root 26652 Sep 22 2020 pwd lrwxrwxrwx 1 root root 4 Jun 21 14:26 rbash -> bash -rwxr-xr-x 1 root root 30740 Sep 22 2020 readlink -rwxr-xr-x 1 root root 43104 Sep 22 2020 rm -rwxr-xr-x 1 root root 30732 Sep 22 2020 rmdir -rwxr-xr-x 1 root root 14144 Sep 27 2020 run-parts -rwxr-xr-x 1 root root 76012 Dec 22 2018 sed lrwxrwxrwx 1 root root 4 Jul 13 21:26 sh -> dash -rwxr-xr-x 1 root root 22532 Sep 22 2020 sleep -rwxr-xr-x 1 root root 55360 Sep 22 2020 stty -rwsr-xr-x 1 root root 46704 Feb 7 02:38 su -rwxr-xr-x 1 root root 22532 Sep 22 2020 sync -rwxr-xr-x 1 root root 340872 Feb 16 21:55 tar -rwxr-xr-x 1 root root 9808 Sep 27 2020 tempfile -rwxr-xr-x 1 root root 67696 Sep 22 2020 touch -rwxr-xr-x 1 root root 22496 Sep 22 2020 true -rwxr-xr-x 1 root root 9636 Feb 26 04:12 ulockmgr_server -rwsr-xr-x 1 root root 22108 Feb 7 02:38 umount -rwxr-xr-x 1 root root 22520 Sep 22 2020 uname -rwxr-xr-x 2 root root 2346 Mar 2 11:30 uncompress -rwxr-xr-x 1 root root 96764 Sep 22 2020 vdir -rwxr-xr-x 1 root root 38512 Feb 7 02:38 wdctl lrwxrwxrwx 1 root root 8 Nov 6 2019 ypdomainname -> hostname -rwxr-xr-x 1 root root 1984 Mar 2 11:30 zcat -rwxr-xr-x 1 root root 1678 Mar 2 11:30 zcmp -rwxr-xr-x 1 root root 5880 Mar 2 11:30 zdiff -rwxr-xr-x 1 root root 29 Mar 2 11:30 zegrep -rwxr-xr-x 1 root root 29 Mar 2 11:30 zfgrep -rwxr-xr-x 1 root root 2081 Mar 2 11:30 zforce -rwxr-xr-x 1 root root 7585 Mar 2 11:30 zgrep -rwxr-xr-x 1 root root 2206 Mar 2 11:30 zless -rwxr-xr-x 1 root root 1842 Mar 2 11:30 zmore -rwxr-xr-x 1 root root 4553 Mar 2 11:30 znew I: user script /srv/workspace/pbuilder/18695/tmp/hooks/D02_print_environment finished -> Attempting to satisfy build-dependencies -> Creating pbuilder-satisfydepends-dummy package Package: pbuilder-satisfydepends-dummy Version: 0.invalid.0 Architecture: armhf Maintainer: Debian Pbuilder Team Description: Dummy package to satisfy dependencies with aptitude - created by pbuilder This package was created automatically by pbuilder to satisfy the build-dependencies of the package being currently built. Depends: debhelper-compat (= 12), cmake, dh-python, d-shlibs, rename, cython3, python3-all-dev, python3-setuptools dpkg-deb: building package 'pbuilder-satisfydepends-dummy' in '/tmp/satisfydepends-aptitude/pbuilder-satisfydepends-dummy.deb'. Selecting previously unselected package pbuilder-satisfydepends-dummy. (Reading database ... 19398 files and directories currently installed.) Preparing to unpack .../pbuilder-satisfydepends-dummy.deb ... Unpacking pbuilder-satisfydepends-dummy (0.invalid.0) ... dpkg: pbuilder-satisfydepends-dummy: dependency problems, but configuring anyway as you requested: pbuilder-satisfydepends-dummy depends on debhelper-compat (= 12); however: Package debhelper-compat is not installed. pbuilder-satisfydepends-dummy depends on cmake; however: Package cmake is not installed. pbuilder-satisfydepends-dummy depends on dh-python; however: Package dh-python is not installed. pbuilder-satisfydepends-dummy depends on d-shlibs; however: Package d-shlibs is not installed. pbuilder-satisfydepends-dummy depends on rename; however: Package rename is not installed. pbuilder-satisfydepends-dummy depends on cython3; however: Package cython3 is not installed. pbuilder-satisfydepends-dummy depends on python3-all-dev; however: Package python3-all-dev is not installed. pbuilder-satisfydepends-dummy depends on python3-setuptools; however: Package python3-setuptools is not installed. Setting up pbuilder-satisfydepends-dummy (0.invalid.0) ... Reading package lists... Building dependency tree... Reading state information... Initializing package states... Writing extended state information... Building tag database... pbuilder-satisfydepends-dummy is already installed at the requested version (0.invalid.0) pbuilder-satisfydepends-dummy is already installed at the requested version (0.invalid.0) The following NEW packages will be installed: autoconf{a} automake{a} autopoint{a} autotools-dev{a} bsdextrautils{a} cmake{a} cmake-data{a} cython3{a} d-shlibs{a} debhelper{a} dh-autoreconf{a} dh-python{a} dh-strip-nondeterminism{a} dwz{a} file{a} gettext{a} gettext-base{a} groff-base{a} intltool-debian{a} libarchive-zip-perl{a} libarchive13{a} libbrotli1{a} libcurl4{a} libdebhelper-perl{a} libelf1{a} libexpat1{a} libexpat1-dev{a} libfile-stripnondeterminism-perl{a} libicu67{a} libjs-jquery{a} libjs-sphinxdoc{a} libjs-underscore{a} libjsoncpp24{a} libldap-2.4-2{a} libmagic-mgc{a} libmagic1{a} libmpdec3{a} libncurses6{a} libnghttp2-14{a} libpipeline1{a} libprocps8{a} libpsl5{a} libpython3-all-dev{a} libpython3-dev{a} libpython3-stdlib{a} libpython3.9{a} libpython3.9-dev{a} libpython3.9-minimal{a} libpython3.9-stdlib{a} libreadline8{a} librhash0{a} librtmp1{a} libsasl2-2{a} libsasl2-modules-db{a} libsigsegv2{a} libssh2-1{a} libsub-override-perl{a} libtool{a} libuchardet0{a} libuv1{a} libxml2{a} m4{a} man-db{a} media-types{a} po-debconf{a} procps{a} python3{a} python3-all{a} python3-all-dev{a} python3-dev{a} python3-distutils{a} python3-lib2to3{a} python3-minimal{a} python3-pkg-resources{a} python3-setuptools{a} python3.9{a} python3.9-dev{a} python3.9-minimal{a} readline-common{a} rename{a} sensible-utils{a} zlib1g-dev{a} The following packages are RECOMMENDED but will NOT be installed: ca-certificates curl javascript-common libarchive-cpio-perl libgpm2 libio-stringy-perl libldap-common libltdl-dev libmail-sendmail-perl libpod-parser-perl libsasl2-modules lynx psmisc publicsuffix wget 0 packages upgraded, 82 newly installed, 0 to remove and 0 not upgraded. Need to get 38.7 MB of archives. After unpacking 138 MB will be used. Writing extended state information... Get: 1 http://deb.debian.org/debian bullseye/main armhf bsdextrautils armhf 2.36.1-7 [138 kB] Get: 2 http://deb.debian.org/debian bullseye/main armhf libuchardet0 armhf 0.0.7-1 [65.0 kB] Get: 3 http://deb.debian.org/debian bullseye/main armhf groff-base armhf 1.22.4-6 [847 kB] Get: 4 http://deb.debian.org/debian bullseye/main armhf libpipeline1 armhf 1.5.3-1 [30.1 kB] Get: 5 http://deb.debian.org/debian bullseye/main armhf man-db armhf 2.9.4-2 [1319 kB] Get: 6 http://deb.debian.org/debian bullseye/main armhf libpython3.9-minimal armhf 3.9.2-1 [790 kB] Get: 7 http://deb.debian.org/debian bullseye/main armhf libexpat1 armhf 2.2.10-2 [76.3 kB] Get: 8 http://deb.debian.org/debian bullseye/main armhf python3.9-minimal armhf 3.9.2-1 [1630 kB] Get: 9 http://deb.debian.org/debian bullseye/main armhf python3-minimal armhf 3.9.2-3 [38.2 kB] Get: 10 http://deb.debian.org/debian bullseye/main armhf media-types all 4.0.0 [30.3 kB] Get: 11 http://deb.debian.org/debian bullseye/main armhf libmpdec3 armhf 2.5.1-1 [74.9 kB] Get: 12 http://deb.debian.org/debian bullseye/main armhf readline-common all 8.1-1 [73.7 kB] Get: 13 http://deb.debian.org/debian bullseye/main armhf libreadline8 armhf 8.1-1 [147 kB] Get: 14 http://deb.debian.org/debian bullseye/main armhf libpython3.9-stdlib armhf 3.9.2-1 [1608 kB] Get: 15 http://deb.debian.org/debian bullseye/main armhf python3.9 armhf 3.9.2-1 [466 kB] Get: 16 http://deb.debian.org/debian bullseye/main armhf libpython3-stdlib armhf 3.9.2-3 [21.4 kB] Get: 17 http://deb.debian.org/debian bullseye/main armhf python3 armhf 3.9.2-3 [37.9 kB] Get: 18 http://deb.debian.org/debian bullseye/main armhf libncurses6 armhf 6.2+20201114-2 [80.5 kB] Get: 19 http://deb.debian.org/debian bullseye/main armhf libprocps8 armhf 2:3.3.17-5 [60.7 kB] Get: 20 http://deb.debian.org/debian bullseye/main armhf procps armhf 2:3.3.17-5 [492 kB] Get: 21 http://deb.debian.org/debian bullseye/main armhf sensible-utils all 0.0.14 [14.8 kB] Get: 22 http://deb.debian.org/debian bullseye/main armhf libmagic-mgc armhf 1:5.39-3 [273 kB] Get: 23 http://deb.debian.org/debian bullseye/main armhf libmagic1 armhf 1:5.39-3 [117 kB] Get: 24 http://deb.debian.org/debian bullseye/main armhf file armhf 1:5.39-3 [68.1 kB] Get: 25 http://deb.debian.org/debian bullseye/main armhf gettext-base armhf 0.21-4 [171 kB] Get: 26 http://deb.debian.org/debian bullseye/main armhf libsigsegv2 armhf 2.13-1 [34.0 kB] Get: 27 http://deb.debian.org/debian bullseye/main armhf m4 armhf 1.4.18-5 [192 kB] Get: 28 http://deb.debian.org/debian bullseye/main armhf autoconf all 2.69-14 [313 kB] Get: 29 http://deb.debian.org/debian bullseye/main armhf autotools-dev all 20180224.1+nmu1 [77.1 kB] Get: 30 http://deb.debian.org/debian bullseye/main armhf automake all 1:1.16.3-2 [814 kB] Get: 31 http://deb.debian.org/debian bullseye/main armhf autopoint all 0.21-4 [510 kB] Get: 32 http://deb.debian.org/debian bullseye/main armhf cmake-data all 3.18.4-2 [1725 kB] Get: 33 http://deb.debian.org/debian bullseye/main armhf libicu67 armhf 67.1-7 [8319 kB] Get: 34 http://deb.debian.org/debian bullseye/main armhf libxml2 armhf 2.9.10+dfsg-6.7 [602 kB] Get: 35 http://deb.debian.org/debian bullseye/main armhf libarchive13 armhf 3.4.3-2+b1 [304 kB] Get: 36 http://deb.debian.org/debian bullseye/main armhf libbrotli1 armhf 1.0.9-2+b2 [262 kB] Get: 37 http://deb.debian.org/debian bullseye/main armhf libsasl2-modules-db armhf 2.1.27+dfsg-2.1 [67.6 kB] Get: 38 http://deb.debian.org/debian bullseye/main armhf libsasl2-2 armhf 2.1.27+dfsg-2.1 [99.1 kB] Get: 39 http://deb.debian.org/debian bullseye/main armhf libldap-2.4-2 armhf 2.4.57+dfsg-3 [210 kB] Get: 40 http://deb.debian.org/debian bullseye/main armhf libnghttp2-14 armhf 1.43.0-1 [65.6 kB] Get: 41 http://deb.debian.org/debian bullseye/main armhf libpsl5 armhf 0.21.0-1.2 [56.1 kB] Get: 42 http://deb.debian.org/debian bullseye/main armhf librtmp1 armhf 2.4+20151223.gitfa8646d.1-2+b2 [55.2 kB] Get: 43 http://deb.debian.org/debian bullseye/main armhf libssh2-1 armhf 1.9.0-2 [143 kB] Get: 44 http://deb.debian.org/debian bullseye/main armhf libcurl4 armhf 7.74.0-1.3+b1 [310 kB] Get: 45 http://deb.debian.org/debian bullseye/main armhf libjsoncpp24 armhf 1.9.4-4 [68.5 kB] Get: 46 http://deb.debian.org/debian bullseye/main armhf librhash0 armhf 1.4.1-2 [144 kB] Get: 47 http://deb.debian.org/debian bullseye/main armhf libuv1 armhf 1.40.0-2 [120 kB] Get: 48 http://deb.debian.org/debian bullseye/main armhf cmake armhf 3.18.4-2 [3534 kB] Get: 49 http://deb.debian.org/debian bullseye/main armhf cython3 armhf 0.29.21-3+b1 [1250 kB] Get: 50 http://deb.debian.org/debian bullseye/main armhf d-shlibs all 0.98 [17.9 kB] Get: 51 http://deb.debian.org/debian bullseye/main armhf libdebhelper-perl all 13.3.4 [189 kB] Get: 52 http://deb.debian.org/debian bullseye/main armhf libtool all 2.4.6-15 [513 kB] Get: 53 http://deb.debian.org/debian bullseye/main armhf dh-autoreconf all 20 [17.1 kB] Get: 54 http://deb.debian.org/debian bullseye/main armhf libarchive-zip-perl all 1.68-1 [104 kB] Get: 55 http://deb.debian.org/debian bullseye/main armhf libsub-override-perl all 0.09-2 [10.2 kB] Get: 56 http://deb.debian.org/debian bullseye/main armhf libfile-stripnondeterminism-perl all 1.11.0-1 [25.6 kB] Get: 57 http://deb.debian.org/debian bullseye/main armhf dh-strip-nondeterminism all 1.11.0-1 [15.3 kB] Get: 58 http://deb.debian.org/debian bullseye/main armhf libelf1 armhf 0.183-1 [161 kB] Get: 59 http://deb.debian.org/debian bullseye/main armhf dwz armhf 0.13+20210201-1 [179 kB] Get: 60 http://deb.debian.org/debian bullseye/main armhf gettext armhf 0.21-4 [1243 kB] Get: 61 http://deb.debian.org/debian bullseye/main armhf intltool-debian all 0.35.0+20060710.5 [26.8 kB] Get: 62 http://deb.debian.org/debian bullseye/main armhf po-debconf all 1.0.21+nmu1 [248 kB] Get: 63 http://deb.debian.org/debian bullseye/main armhf debhelper all 13.3.4 [1049 kB] Get: 64 http://deb.debian.org/debian bullseye/main armhf python3-lib2to3 all 3.9.2-1 [77.8 kB] Get: 65 http://deb.debian.org/debian bullseye/main armhf python3-distutils all 3.9.2-1 [143 kB] Get: 66 http://deb.debian.org/debian bullseye/main armhf dh-python all 4.20201102+nmu1 [99.4 kB] Get: 67 http://deb.debian.org/debian bullseye/main armhf libexpat1-dev armhf 2.2.10-2 [123 kB] Get: 68 http://deb.debian.org/debian bullseye/main armhf libjs-jquery all 3.5.1+dfsg+~3.5.5-7 [315 kB] Get: 69 http://deb.debian.org/debian bullseye/main armhf libjs-underscore all 1.9.1~dfsg-3 [100 kB] Get: 70 http://deb.debian.org/debian bullseye/main armhf libjs-sphinxdoc all 3.4.3-2 [127 kB] Get: 71 http://deb.debian.org/debian bullseye/main armhf libpython3.9 armhf 3.9.2-1 [1447 kB] Get: 72 http://deb.debian.org/debian bullseye/main armhf libpython3.9-dev armhf 3.9.2-1 [3160 kB] Get: 73 http://deb.debian.org/debian bullseye/main armhf libpython3-dev armhf 3.9.2-3 [21.7 kB] Get: 74 http://deb.debian.org/debian bullseye/main armhf libpython3-all-dev armhf 3.9.2-3 [1068 B] Get: 75 http://deb.debian.org/debian bullseye/main armhf python3-all armhf 3.9.2-3 [1056 B] Get: 76 http://deb.debian.org/debian bullseye/main armhf zlib1g-dev armhf 1:1.2.11.dfsg-2 [185 kB] Get: 77 http://deb.debian.org/debian bullseye/main armhf python3.9-dev armhf 3.9.2-1 [515 kB] Get: 78 http://deb.debian.org/debian bullseye/main armhf python3-dev armhf 3.9.2-3 [24.8 kB] Get: 79 http://deb.debian.org/debian bullseye/main armhf python3-all-dev armhf 3.9.2-3 [1064 B] Get: 80 http://deb.debian.org/debian bullseye/main armhf python3-pkg-resources all 52.0.0-4 [190 kB] Get: 81 http://deb.debian.org/debian bullseye/main armhf python3-setuptools all 52.0.0-4 [366 kB] Get: 82 http://deb.debian.org/debian bullseye/main armhf rename all 1.13-1 [18.0 kB] Fetched 38.7 MB in 3s (12.7 MB/s) debconf: delaying package configuration, since apt-utils is not installed Selecting previously unselected package bsdextrautils. (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 19398 files and directories currently installed.) Preparing to unpack .../0-bsdextrautils_2.36.1-7_armhf.deb ... Unpacking bsdextrautils (2.36.1-7) ... Selecting previously unselected package libuchardet0:armhf. Preparing to unpack .../1-libuchardet0_0.0.7-1_armhf.deb ... Unpacking libuchardet0:armhf (0.0.7-1) ... Selecting previously unselected package groff-base. Preparing to unpack .../2-groff-base_1.22.4-6_armhf.deb ... Unpacking groff-base (1.22.4-6) ... Selecting previously unselected package libpipeline1:armhf. Preparing to unpack .../3-libpipeline1_1.5.3-1_armhf.deb ... Unpacking libpipeline1:armhf (1.5.3-1) ... Selecting previously unselected package man-db. Preparing to unpack .../4-man-db_2.9.4-2_armhf.deb ... Unpacking man-db (2.9.4-2) ... Selecting previously unselected package libpython3.9-minimal:armhf. Preparing to unpack .../5-libpython3.9-minimal_3.9.2-1_armhf.deb ... Unpacking libpython3.9-minimal:armhf (3.9.2-1) ... Selecting previously unselected package libexpat1:armhf. Preparing to unpack .../6-libexpat1_2.2.10-2_armhf.deb ... Unpacking libexpat1:armhf (2.2.10-2) ... Selecting previously unselected package python3.9-minimal. Preparing to unpack .../7-python3.9-minimal_3.9.2-1_armhf.deb ... Unpacking python3.9-minimal (3.9.2-1) ... Setting up libpython3.9-minimal:armhf (3.9.2-1) ... Setting up libexpat1:armhf (2.2.10-2) ... Setting up python3.9-minimal (3.9.2-1) ... Selecting previously unselected package python3-minimal. (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 20265 files and directories currently installed.) Preparing to unpack .../0-python3-minimal_3.9.2-3_armhf.deb ... Unpacking python3-minimal (3.9.2-3) ... Selecting previously unselected package media-types. Preparing to unpack .../1-media-types_4.0.0_all.deb ... Unpacking media-types (4.0.0) ... Selecting previously unselected package libmpdec3:armhf. Preparing to unpack .../2-libmpdec3_2.5.1-1_armhf.deb ... Unpacking libmpdec3:armhf (2.5.1-1) ... Selecting previously unselected package readline-common. Preparing to unpack .../3-readline-common_8.1-1_all.deb ... Unpacking readline-common (8.1-1) ... Selecting previously unselected package libreadline8:armhf. Preparing to unpack .../4-libreadline8_8.1-1_armhf.deb ... Unpacking libreadline8:armhf (8.1-1) ... Selecting previously unselected package libpython3.9-stdlib:armhf. Preparing to unpack .../5-libpython3.9-stdlib_3.9.2-1_armhf.deb ... Unpacking libpython3.9-stdlib:armhf (3.9.2-1) ... Selecting previously unselected package python3.9. Preparing to unpack .../6-python3.9_3.9.2-1_armhf.deb ... Unpacking python3.9 (3.9.2-1) ... Selecting previously unselected package libpython3-stdlib:armhf. Preparing to unpack .../7-libpython3-stdlib_3.9.2-3_armhf.deb ... Unpacking libpython3-stdlib:armhf (3.9.2-3) ... Setting up python3-minimal (3.9.2-3) ... Selecting previously unselected package python3. (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 20686 files and directories currently installed.) Preparing to unpack .../00-python3_3.9.2-3_armhf.deb ... Unpacking python3 (3.9.2-3) ... Selecting previously unselected package libncurses6:armhf. Preparing to unpack .../01-libncurses6_6.2+20201114-2_armhf.deb ... Unpacking libncurses6:armhf (6.2+20201114-2) ... Selecting previously unselected package libprocps8:armhf. Preparing to unpack .../02-libprocps8_2%3a3.3.17-5_armhf.deb ... Unpacking libprocps8:armhf (2:3.3.17-5) ... Selecting previously unselected package procps. Preparing to unpack .../03-procps_2%3a3.3.17-5_armhf.deb ... Unpacking procps (2:3.3.17-5) ... Selecting previously unselected package sensible-utils. Preparing to unpack .../04-sensible-utils_0.0.14_all.deb ... Unpacking sensible-utils (0.0.14) ... Selecting previously unselected package libmagic-mgc. Preparing to unpack .../05-libmagic-mgc_1%3a5.39-3_armhf.deb ... Unpacking libmagic-mgc (1:5.39-3) ... Selecting previously unselected package libmagic1:armhf. Preparing to unpack .../06-libmagic1_1%3a5.39-3_armhf.deb ... Unpacking libmagic1:armhf (1:5.39-3) ... Selecting previously unselected package file. Preparing to unpack .../07-file_1%3a5.39-3_armhf.deb ... Unpacking file (1:5.39-3) ... Selecting previously unselected package gettext-base. Preparing to unpack .../08-gettext-base_0.21-4_armhf.deb ... Unpacking gettext-base (0.21-4) ... Selecting previously unselected package libsigsegv2:armhf. Preparing to unpack .../09-libsigsegv2_2.13-1_armhf.deb ... Unpacking libsigsegv2:armhf (2.13-1) ... Selecting previously unselected package m4. Preparing to unpack .../10-m4_1.4.18-5_armhf.deb ... Unpacking m4 (1.4.18-5) ... Selecting previously unselected package autoconf. Preparing to unpack .../11-autoconf_2.69-14_all.deb ... Unpacking autoconf (2.69-14) ... Selecting previously unselected package autotools-dev. Preparing to unpack .../12-autotools-dev_20180224.1+nmu1_all.deb ... Unpacking autotools-dev (20180224.1+nmu1) ... Selecting previously unselected package automake. Preparing to unpack .../13-automake_1%3a1.16.3-2_all.deb ... Unpacking automake (1:1.16.3-2) ... Selecting previously unselected package autopoint. Preparing to unpack .../14-autopoint_0.21-4_all.deb ... Unpacking autopoint (0.21-4) ... Selecting previously unselected package cmake-data. Preparing to unpack .../15-cmake-data_3.18.4-2_all.deb ... Unpacking cmake-data (3.18.4-2) ... Selecting previously unselected package libicu67:armhf. Preparing to unpack .../16-libicu67_67.1-7_armhf.deb ... Unpacking libicu67:armhf (67.1-7) ... Selecting previously unselected package libxml2:armhf. Preparing to unpack .../17-libxml2_2.9.10+dfsg-6.7_armhf.deb ... Unpacking libxml2:armhf (2.9.10+dfsg-6.7) ... Selecting previously unselected package libarchive13:armhf. Preparing to unpack .../18-libarchive13_3.4.3-2+b1_armhf.deb ... Unpacking libarchive13:armhf (3.4.3-2+b1) ... Selecting previously unselected package libbrotli1:armhf. Preparing to unpack .../19-libbrotli1_1.0.9-2+b2_armhf.deb ... Unpacking libbrotli1:armhf (1.0.9-2+b2) ... Selecting previously unselected package libsasl2-modules-db:armhf. Preparing to unpack .../20-libsasl2-modules-db_2.1.27+dfsg-2.1_armhf.deb ... Unpacking libsasl2-modules-db:armhf (2.1.27+dfsg-2.1) ... Selecting previously unselected package libsasl2-2:armhf. Preparing to unpack .../21-libsasl2-2_2.1.27+dfsg-2.1_armhf.deb ... Unpacking libsasl2-2:armhf (2.1.27+dfsg-2.1) ... Selecting previously unselected package libldap-2.4-2:armhf. Preparing to unpack .../22-libldap-2.4-2_2.4.57+dfsg-3_armhf.deb ... Unpacking libldap-2.4-2:armhf (2.4.57+dfsg-3) ... Selecting previously unselected package libnghttp2-14:armhf. Preparing to unpack .../23-libnghttp2-14_1.43.0-1_armhf.deb ... Unpacking libnghttp2-14:armhf (1.43.0-1) ... Selecting previously unselected package libpsl5:armhf. Preparing to unpack .../24-libpsl5_0.21.0-1.2_armhf.deb ... Unpacking libpsl5:armhf (0.21.0-1.2) ... Selecting previously unselected package librtmp1:armhf. Preparing to unpack .../25-librtmp1_2.4+20151223.gitfa8646d.1-2+b2_armhf.deb ... Unpacking librtmp1:armhf (2.4+20151223.gitfa8646d.1-2+b2) ... Selecting previously unselected package libssh2-1:armhf. Preparing to unpack .../26-libssh2-1_1.9.0-2_armhf.deb ... Unpacking libssh2-1:armhf (1.9.0-2) ... Selecting previously unselected package libcurl4:armhf. Preparing to unpack .../27-libcurl4_7.74.0-1.3+b1_armhf.deb ... Unpacking libcurl4:armhf (7.74.0-1.3+b1) ... Selecting previously unselected package libjsoncpp24:armhf. Preparing to unpack .../28-libjsoncpp24_1.9.4-4_armhf.deb ... Unpacking libjsoncpp24:armhf (1.9.4-4) ... Selecting previously unselected package librhash0:armhf. Preparing to unpack .../29-librhash0_1.4.1-2_armhf.deb ... Unpacking librhash0:armhf (1.4.1-2) ... Selecting previously unselected package libuv1:armhf. Preparing to unpack .../30-libuv1_1.40.0-2_armhf.deb ... Unpacking libuv1:armhf (1.40.0-2) ... Selecting previously unselected package cmake. Preparing to unpack .../31-cmake_3.18.4-2_armhf.deb ... Unpacking cmake (3.18.4-2) ... Selecting previously unselected package cython3. Preparing to unpack .../32-cython3_0.29.21-3+b1_armhf.deb ... Unpacking cython3 (0.29.21-3+b1) ... Selecting previously unselected package d-shlibs. Preparing to unpack .../33-d-shlibs_0.98_all.deb ... Unpacking d-shlibs (0.98) ... Selecting previously unselected package libdebhelper-perl. Preparing to unpack .../34-libdebhelper-perl_13.3.4_all.deb ... Unpacking libdebhelper-perl (13.3.4) ... Selecting previously unselected package libtool. Preparing to unpack .../35-libtool_2.4.6-15_all.deb ... Unpacking libtool (2.4.6-15) ... Selecting previously unselected package dh-autoreconf. Preparing to unpack .../36-dh-autoreconf_20_all.deb ... Unpacking dh-autoreconf (20) ... Selecting previously unselected package libarchive-zip-perl. Preparing to unpack .../37-libarchive-zip-perl_1.68-1_all.deb ... Unpacking libarchive-zip-perl (1.68-1) ... Selecting previously unselected package libsub-override-perl. Preparing to unpack .../38-libsub-override-perl_0.09-2_all.deb ... Unpacking libsub-override-perl (0.09-2) ... Selecting previously unselected package libfile-stripnondeterminism-perl. Preparing to unpack .../39-libfile-stripnondeterminism-perl_1.11.0-1_all.deb ... Unpacking libfile-stripnondeterminism-perl (1.11.0-1) ... Selecting previously unselected package dh-strip-nondeterminism. Preparing to unpack .../40-dh-strip-nondeterminism_1.11.0-1_all.deb ... Unpacking dh-strip-nondeterminism (1.11.0-1) ... Selecting previously unselected package libelf1:armhf. Preparing to unpack .../41-libelf1_0.183-1_armhf.deb ... Unpacking libelf1:armhf (0.183-1) ... Selecting previously unselected package dwz. Preparing to unpack .../42-dwz_0.13+20210201-1_armhf.deb ... Unpacking dwz (0.13+20210201-1) ... Selecting previously unselected package gettext. Preparing to unpack .../43-gettext_0.21-4_armhf.deb ... Unpacking gettext (0.21-4) ... Selecting previously unselected package intltool-debian. Preparing to unpack .../44-intltool-debian_0.35.0+20060710.5_all.deb ... Unpacking intltool-debian (0.35.0+20060710.5) ... Selecting previously unselected package po-debconf. Preparing to unpack .../45-po-debconf_1.0.21+nmu1_all.deb ... Unpacking po-debconf (1.0.21+nmu1) ... Selecting previously unselected package debhelper. Preparing to unpack .../46-debhelper_13.3.4_all.deb ... Unpacking debhelper (13.3.4) ... Selecting previously unselected package python3-lib2to3. Preparing to unpack .../47-python3-lib2to3_3.9.2-1_all.deb ... Unpacking python3-lib2to3 (3.9.2-1) ... Selecting previously unselected package python3-distutils. Preparing to unpack .../48-python3-distutils_3.9.2-1_all.deb ... Unpacking python3-distutils (3.9.2-1) ... Selecting previously unselected package dh-python. Preparing to unpack .../49-dh-python_4.20201102+nmu1_all.deb ... Unpacking dh-python (4.20201102+nmu1) ... Selecting previously unselected package libexpat1-dev:armhf. Preparing to unpack .../50-libexpat1-dev_2.2.10-2_armhf.deb ... Unpacking libexpat1-dev:armhf (2.2.10-2) ... Selecting previously unselected package libjs-jquery. Preparing to unpack .../51-libjs-jquery_3.5.1+dfsg+~3.5.5-7_all.deb ... Unpacking libjs-jquery (3.5.1+dfsg+~3.5.5-7) ... Selecting previously unselected package libjs-underscore. Preparing to unpack .../52-libjs-underscore_1.9.1~dfsg-3_all.deb ... Unpacking libjs-underscore (1.9.1~dfsg-3) ... Selecting previously unselected package libjs-sphinxdoc. Preparing to unpack .../53-libjs-sphinxdoc_3.4.3-2_all.deb ... Unpacking libjs-sphinxdoc (3.4.3-2) ... Selecting previously unselected package libpython3.9:armhf. Preparing to unpack .../54-libpython3.9_3.9.2-1_armhf.deb ... Unpacking libpython3.9:armhf (3.9.2-1) ... Selecting previously unselected package libpython3.9-dev:armhf. Preparing to unpack .../55-libpython3.9-dev_3.9.2-1_armhf.deb ... Unpacking libpython3.9-dev:armhf (3.9.2-1) ... Selecting previously unselected package libpython3-dev:armhf. Preparing to unpack .../56-libpython3-dev_3.9.2-3_armhf.deb ... Unpacking libpython3-dev:armhf (3.9.2-3) ... Selecting previously unselected package libpython3-all-dev:armhf. Preparing to unpack .../57-libpython3-all-dev_3.9.2-3_armhf.deb ... Unpacking libpython3-all-dev:armhf (3.9.2-3) ... Selecting previously unselected package python3-all. Preparing to unpack .../58-python3-all_3.9.2-3_armhf.deb ... Unpacking python3-all (3.9.2-3) ... Selecting previously unselected package zlib1g-dev:armhf. Preparing to unpack .../59-zlib1g-dev_1%3a1.2.11.dfsg-2_armhf.deb ... Unpacking zlib1g-dev:armhf (1:1.2.11.dfsg-2) ... Selecting previously unselected package python3.9-dev. Preparing to unpack .../60-python3.9-dev_3.9.2-1_armhf.deb ... Unpacking python3.9-dev (3.9.2-1) ... Selecting previously unselected package python3-dev. Preparing to unpack .../61-python3-dev_3.9.2-3_armhf.deb ... Unpacking python3-dev (3.9.2-3) ... Selecting previously unselected package python3-all-dev. Preparing to unpack .../62-python3-all-dev_3.9.2-3_armhf.deb ... Unpacking python3-all-dev (3.9.2-3) ... Selecting previously unselected package python3-pkg-resources. Preparing to unpack .../63-python3-pkg-resources_52.0.0-4_all.deb ... Unpacking python3-pkg-resources (52.0.0-4) ... Selecting previously unselected package python3-setuptools. Preparing to unpack .../64-python3-setuptools_52.0.0-4_all.deb ... Unpacking python3-setuptools (52.0.0-4) ... Selecting previously unselected package rename. Preparing to unpack .../65-rename_1.13-1_all.deb ... Unpacking rename (1.13-1) ... Setting up media-types (4.0.0) ... Setting up libpipeline1:armhf (1.5.3-1) ... Setting up libpsl5:armhf (0.21.0-1.2) ... Setting up bsdextrautils (2.36.1-7) ... update-alternatives: using /usr/bin/write.ul to provide /usr/bin/write (write) in auto mode Setting up libicu67:armhf (67.1-7) ... Setting up libmagic-mgc (1:5.39-3) ... Setting up libarchive-zip-perl (1.68-1) ... Setting up libdebhelper-perl (13.3.4) ... Setting up libbrotli1:armhf (1.0.9-2+b2) ... Setting up libnghttp2-14:armhf (1.43.0-1) ... Setting up libmagic1:armhf (1:5.39-3) ... Setting up gettext-base (0.21-4) ... Setting up rename (1.13-1) ... update-alternatives: using /usr/bin/file-rename to provide /usr/bin/rename (rename) in auto mode Setting up file (1:5.39-3) ... Setting up libsasl2-modules-db:armhf (2.1.27+dfsg-2.1) ... Setting up autotools-dev (20180224.1+nmu1) ... Setting up libuv1:armhf (1.40.0-2) ... Setting up libexpat1-dev:armhf (2.2.10-2) ... Setting up librtmp1:armhf (2.4+20151223.gitfa8646d.1-2+b2) ... Setting up libncurses6:armhf (6.2+20201114-2) ... Setting up libsigsegv2:armhf (2.13-1) ... Setting up autopoint (0.21-4) ... Setting up d-shlibs (0.98) ... Setting up libsasl2-2:armhf (2.1.27+dfsg-2.1) ... Setting up libjsoncpp24:armhf (1.9.4-4) ... Setting up zlib1g-dev:armhf (1:1.2.11.dfsg-2) ... Setting up sensible-utils (0.0.14) ... Setting up librhash0:armhf (1.4.1-2) ... Setting up libuchardet0:armhf (0.0.7-1) ... Setting up libmpdec3:armhf (2.5.1-1) ... Setting up libsub-override-perl (0.09-2) ... Setting up libssh2-1:armhf (1.9.0-2) ... Setting up cmake-data (3.18.4-2) ... Setting up libjs-jquery (3.5.1+dfsg+~3.5.5-7) ... Setting up libelf1:armhf (0.183-1) ... Setting up readline-common (8.1-1) ... Setting up libxml2:armhf (2.9.10+dfsg-6.7) ... Setting up libprocps8:armhf (2:3.3.17-5) ... Setting up libjs-underscore (1.9.1~dfsg-3) ... Setting up libfile-stripnondeterminism-perl (1.11.0-1) ... Setting up gettext (0.21-4) ... Setting up libtool (2.4.6-15) ... Setting up libarchive13:armhf (3.4.3-2+b1) ... Setting up libreadline8:armhf (8.1-1) ... Setting up libldap-2.4-2:armhf (2.4.57+dfsg-3) ... Setting up m4 (1.4.18-5) ... Setting up intltool-debian (0.35.0+20060710.5) ... Setting up libjs-sphinxdoc (3.4.3-2) ... Setting up autoconf (2.69-14) ... Setting up dh-strip-nondeterminism (1.11.0-1) ... Setting up dwz (0.13+20210201-1) ... Setting up groff-base (1.22.4-6) ... Setting up procps (2:3.3.17-5) ... Setting up libcurl4:armhf (7.74.0-1.3+b1) ... Setting up libpython3.9-stdlib:armhf (3.9.2-1) ... Setting up libpython3-stdlib:armhf (3.9.2-3) ... Setting up automake (1:1.16.3-2) ... update-alternatives: using /usr/bin/automake-1.16 to provide /usr/bin/automake (automake) in auto mode Setting up po-debconf (1.0.21+nmu1) ... Setting up man-db (2.9.4-2) ... Not building database; man-db/auto-update is not 'true'. Setting up dh-autoreconf (20) ... Setting up libpython3.9:armhf (3.9.2-1) ... Setting up cmake (3.18.4-2) ... Setting up python3.9 (3.9.2-1) ... Setting up libpython3.9-dev:armhf (3.9.2-1) ... Setting up debhelper (13.3.4) ... Setting up python3 (3.9.2-3) ... Setting up cython3 (0.29.21-3+b1) ... Setting up python3.9-dev (3.9.2-1) ... Setting up python3-lib2to3 (3.9.2-1) ... Setting up python3-pkg-resources (52.0.0-4) ... Setting up python3-distutils (3.9.2-1) ... Setting up dh-python (4.20201102+nmu1) ... Setting up libpython3-dev:armhf (3.9.2-3) ... Setting up python3-setuptools (52.0.0-4) ... Setting up python3-all (3.9.2-3) ... Setting up libpython3-all-dev:armhf (3.9.2-3) ... Setting up python3-dev (3.9.2-3) ... Setting up python3-all-dev (3.9.2-3) ... Processing triggers for libc-bin (2.31-12) ... Reading package lists... Building dependency tree... Reading state information... Reading extended state information... Initializing package states... Writing extended state information... Building tag database... -> Finished parsing the build-deps Reading package lists... Building dependency tree... Reading state information... fakeroot is already the newest version (1.25.3-1.1). 0 upgraded, 0 newly installed, 0 to remove and 0 not upgraded. I: Building the package I: Running cd /build/libedlib-1.2.6/ && env PATH="/usr/sbin:/usr/bin:/sbin:/bin:/usr/games" HOME="/nonexistent/first-build" dpkg-buildpackage -us -uc -b && env PATH="/usr/sbin:/usr/bin:/sbin:/bin:/usr/games" HOME="/nonexistent/first-build" dpkg-genchanges -S > ../libedlib_1.2.6-1_source.changes dpkg-buildpackage: info: source package libedlib dpkg-buildpackage: info: source version 1.2.6-1 dpkg-buildpackage: info: source distribution unstable dpkg-buildpackage: info: source changed by Andreas Tille dpkg-source --before-build . dpkg-buildpackage: info: host architecture armhf fakeroot debian/rules clean dh clean --with python3 dh_clean debian/rules build make: 'build' is up to date. fakeroot debian/rules binary dh binary --with python3 dh_update_autotools_config dh_autoreconf debian/rules override_dh_auto_configure make[1]: Entering directory '/build/libedlib-1.2.6' dh_auto_configure --buildsystem=cmake -- -DCMAKE_BUILD_TYPE=Release cd obj-arm-linux-gnueabihf && cmake -DCMAKE_INSTALL_PREFIX=/usr -DCMAKE_BUILD_TYPE=None -DCMAKE_INSTALL_SYSCONFDIR=/etc -DCMAKE_INSTALL_LOCALSTATEDIR=/var -DCMAKE_EXPORT_NO_PACKAGE_REGISTRY=ON -DCMAKE_FIND_PACKAGE_NO_PACKAGE_REGISTRY=ON -DCMAKE_INSTALL_RUNSTATEDIR=/run "-GUnix Makefiles" -DCMAKE_VERBOSE_MAKEFILE=ON -DCMAKE_INSTALL_LIBDIR=lib/arm-linux-gnueabihf -DCMAKE_BUILD_TYPE=Release .. -- The C compiler identification is GNU 10.2.1 -- The CXX compiler identification is GNU 10.2.1 -- Detecting C compiler ABI info -- Detecting C compiler ABI info - done -- Check for working C compiler: /usr/bin/cc - skipped -- Detecting C compile features -- Detecting C compile features - done -- Detecting CXX compiler ABI info -- Detecting CXX compiler ABI info - done -- Check for working CXX compiler: /usr/bin/c++ - skipped -- Detecting CXX compile features -- Detecting CXX compile features - done Setting warning flags -- Performing Test WOLD_STYLE_CAST -- Performing Test WOLD_STYLE_CAST - Success -- Performing Test WSHADOW -- Performing Test WSHADOW - Success -- Configuring done -- Generating done CMake Warning: Manually-specified variables were not used by the project: CMAKE_EXPORT_NO_PACKAGE_REGISTRY CMAKE_FIND_PACKAGE_NO_PACKAGE_REGISTRY -- Build files have been written to: /build/libedlib-1.2.6/obj-arm-linux-gnueabihf make[1]: Leaving directory '/build/libedlib-1.2.6' debian/rules override_dh_auto_build make[1]: Entering directory '/build/libedlib-1.2.6' dh_auto_build --buildsystem=cmake cd obj-arm-linux-gnueabihf && make -j3 "INSTALL=install --strip-program=true" VERBOSE=1 make[2]: Entering directory '/build/libedlib-1.2.6/obj-arm-linux-gnueabihf' /usr/bin/cmake -S/build/libedlib-1.2.6 -B/build/libedlib-1.2.6/obj-arm-linux-gnueabihf --check-build-system CMakeFiles/Makefile.cmake 0 /usr/bin/cmake -E cmake_progress_start /build/libedlib-1.2.6/obj-arm-linux-gnueabihf/CMakeFiles /build/libedlib-1.2.6/obj-arm-linux-gnueabihf//CMakeFiles/progress.marks make -f CMakeFiles/Makefile2 all make[3]: Entering directory '/build/libedlib-1.2.6/obj-arm-linux-gnueabihf' make -f CMakeFiles/edlib_static.dir/build.make CMakeFiles/edlib_static.dir/depend make[4]: Entering directory '/build/libedlib-1.2.6/obj-arm-linux-gnueabihf' cd /build/libedlib-1.2.6/obj-arm-linux-gnueabihf && /usr/bin/cmake -E cmake_depends "Unix Makefiles" /build/libedlib-1.2.6 /build/libedlib-1.2.6 /build/libedlib-1.2.6/obj-arm-linux-gnueabihf /build/libedlib-1.2.6/obj-arm-linux-gnueabihf /build/libedlib-1.2.6/obj-arm-linux-gnueabihf/CMakeFiles/edlib_static.dir/DependInfo.cmake --color= make -f CMakeFiles/edlib.dir/build.make CMakeFiles/edlib.dir/depend make[4]: Entering directory '/build/libedlib-1.2.6/obj-arm-linux-gnueabihf' cd /build/libedlib-1.2.6/obj-arm-linux-gnueabihf && /usr/bin/cmake -E cmake_depends "Unix Makefiles" /build/libedlib-1.2.6 /build/libedlib-1.2.6 /build/libedlib-1.2.6/obj-arm-linux-gnueabihf /build/libedlib-1.2.6/obj-arm-linux-gnueabihf /build/libedlib-1.2.6/obj-arm-linux-gnueabihf/CMakeFiles/edlib.dir/DependInfo.cmake --color= Dependee "/build/libedlib-1.2.6/obj-arm-linux-gnueabihf/CMakeFiles/edlib_static.dir/DependInfo.cmake" is newer than depender "/build/libedlib-1.2.6/obj-arm-linux-gnueabihf/CMakeFiles/edlib_static.dir/depend.internal". Dependee "/build/libedlib-1.2.6/obj-arm-linux-gnueabihf/CMakeFiles/CMakeDirectoryInformation.cmake" is newer than depender "/build/libedlib-1.2.6/obj-arm-linux-gnueabihf/CMakeFiles/edlib_static.dir/depend.internal". Dependee "/build/libedlib-1.2.6/obj-arm-linux-gnueabihf/CMakeFiles/edlib.dir/DependInfo.cmake" is newer than depender "/build/libedlib-1.2.6/obj-arm-linux-gnueabihf/CMakeFiles/edlib.dir/depend.internal". Dependee "/build/libedlib-1.2.6/obj-arm-linux-gnueabihf/CMakeFiles/CMakeDirectoryInformation.cmake" is newer than depender "/build/libedlib-1.2.6/obj-arm-linux-gnueabihf/CMakeFiles/edlib.dir/depend.internal". Scanning dependencies of target edlib_static make[4]: Leaving directory '/build/libedlib-1.2.6/obj-arm-linux-gnueabihf' make -f CMakeFiles/edlib_static.dir/build.make CMakeFiles/edlib_static.dir/build make[4]: Entering directory '/build/libedlib-1.2.6/obj-arm-linux-gnueabihf' Scanning dependencies of target edlib make[4]: Leaving directory '/build/libedlib-1.2.6/obj-arm-linux-gnueabihf' make -f CMakeFiles/edlib.dir/build.make CMakeFiles/edlib.dir/build make[4]: Entering directory '/build/libedlib-1.2.6/obj-arm-linux-gnueabihf' [ 12%] Building CXX object CMakeFiles/edlib_static.dir/edlib/src/edlib.cpp.o /usr/bin/c++ -I/build/libedlib-1.2.6/edlib/include -g -O2 -fdebug-prefix-map=/build/libedlib-1.2.6=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -Wold-style-cast -Wshadow -Wall -Wextra -pedantic -O3 -DNDEBUG -std=c++11 -o CMakeFiles/edlib_static.dir/edlib/src/edlib.cpp.o -c /build/libedlib-1.2.6/edlib/src/edlib.cpp [ 25%] Building CXX object CMakeFiles/edlib.dir/edlib/src/edlib.cpp.o /usr/bin/c++ -Dedlib_EXPORTS -I/build/libedlib-1.2.6/edlib/include -g -O2 -fdebug-prefix-map=/build/libedlib-1.2.6=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -Wold-style-cast -Wshadow -Wall -Wextra -pedantic -O3 -DNDEBUG -fPIC -std=c++11 -o CMakeFiles/edlib.dir/edlib/src/edlib.cpp.o -c /build/libedlib-1.2.6/edlib/src/edlib.cpp [ 37%] Linking CXX shared library lib/libedlib.so /usr/bin/cmake -E cmake_link_script CMakeFiles/edlib.dir/link.txt --verbose=1 /usr/bin/c++ -fPIC -g -O2 -fdebug-prefix-map=/build/libedlib-1.2.6=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -Wold-style-cast -Wshadow -Wall -Wextra -pedantic -O3 -DNDEBUG -Wl,-z,relro -Wl,-z,now -shared -Wl,-soname,libedlib.so.0 -o lib/libedlib.so.1.2.5 CMakeFiles/edlib.dir/edlib/src/edlib.cpp.o [ 50%] Linking CXX static library lib/libedlib_static.a /usr/bin/cmake -P CMakeFiles/edlib_static.dir/cmake_clean_target.cmake /usr/bin/cmake -E cmake_link_script CMakeFiles/edlib_static.dir/link.txt --verbose=1 /usr/bin/ar qc lib/libedlib_static.a CMakeFiles/edlib_static.dir/edlib/src/edlib.cpp.o /usr/bin/ranlib lib/libedlib_static.a /usr/bin/cmake -E cmake_symlink_library lib/libedlib.so.1.2.5 lib/libedlib.so.0 lib/libedlib.so make[4]: Leaving directory '/build/libedlib-1.2.6/obj-arm-linux-gnueabihf' make[4]: Leaving directory '/build/libedlib-1.2.6/obj-arm-linux-gnueabihf' [ 50%] Built target edlib_static make -f CMakeFiles/edlib-aligner.dir/build.make CMakeFiles/edlib-aligner.dir/depend make[4]: Entering directory '/build/libedlib-1.2.6/obj-arm-linux-gnueabihf' cd /build/libedlib-1.2.6/obj-arm-linux-gnueabihf && /usr/bin/cmake -E cmake_depends "Unix Makefiles" /build/libedlib-1.2.6 /build/libedlib-1.2.6 /build/libedlib-1.2.6/obj-arm-linux-gnueabihf /build/libedlib-1.2.6/obj-arm-linux-gnueabihf /build/libedlib-1.2.6/obj-arm-linux-gnueabihf/CMakeFiles/edlib-aligner.dir/DependInfo.cmake --color= [ 50%] Built target edlib make -f CMakeFiles/runTests.dir/build.make CMakeFiles/runTests.dir/depend make[4]: Entering directory '/build/libedlib-1.2.6/obj-arm-linux-gnueabihf' cd /build/libedlib-1.2.6/obj-arm-linux-gnueabihf && /usr/bin/cmake -E cmake_depends "Unix Makefiles" /build/libedlib-1.2.6 /build/libedlib-1.2.6 /build/libedlib-1.2.6/obj-arm-linux-gnueabihf /build/libedlib-1.2.6/obj-arm-linux-gnueabihf /build/libedlib-1.2.6/obj-arm-linux-gnueabihf/CMakeFiles/runTests.dir/DependInfo.cmake --color= Dependee "/build/libedlib-1.2.6/obj-arm-linux-gnueabihf/CMakeFiles/edlib-aligner.dir/DependInfo.cmake" is newer than depender "/build/libedlib-1.2.6/obj-arm-linux-gnueabihf/CMakeFiles/edlib-aligner.dir/depend.internal". Dependee "/build/libedlib-1.2.6/obj-arm-linux-gnueabihf/CMakeFiles/CMakeDirectoryInformation.cmake" is newer than depender "/build/libedlib-1.2.6/obj-arm-linux-gnueabihf/CMakeFiles/edlib-aligner.dir/depend.internal". Scanning dependencies of target edlib-aligner make[4]: Leaving directory '/build/libedlib-1.2.6/obj-arm-linux-gnueabihf' make -f CMakeFiles/edlib-aligner.dir/build.make CMakeFiles/edlib-aligner.dir/build make[4]: Entering directory '/build/libedlib-1.2.6/obj-arm-linux-gnueabihf' Dependee "/build/libedlib-1.2.6/obj-arm-linux-gnueabihf/CMakeFiles/runTests.dir/DependInfo.cmake" is newer than depender "/build/libedlib-1.2.6/obj-arm-linux-gnueabihf/CMakeFiles/runTests.dir/depend.internal". Dependee "/build/libedlib-1.2.6/obj-arm-linux-gnueabihf/CMakeFiles/CMakeDirectoryInformation.cmake" is newer than depender "/build/libedlib-1.2.6/obj-arm-linux-gnueabihf/CMakeFiles/runTests.dir/depend.internal". Scanning dependencies of target runTests [ 62%] Building CXX object CMakeFiles/edlib-aligner.dir/apps/aligner/aligner.cpp.o make[4]: Leaving directory '/build/libedlib-1.2.6/obj-arm-linux-gnueabihf' make -f CMakeFiles/runTests.dir/build.make CMakeFiles/runTests.dir/build /usr/bin/c++ -I/build/libedlib-1.2.6/edlib/include -g -O2 -fdebug-prefix-map=/build/libedlib-1.2.6=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -Wold-style-cast -Wshadow -Wall -Wextra -pedantic -O3 -DNDEBUG -std=c++11 -o CMakeFiles/edlib-aligner.dir/apps/aligner/aligner.cpp.o -c /build/libedlib-1.2.6/apps/aligner/aligner.cpp make[4]: Entering directory '/build/libedlib-1.2.6/obj-arm-linux-gnueabihf' [ 75%] Building CXX object CMakeFiles/runTests.dir/test/runTests.cpp.o /usr/bin/c++ -I/build/libedlib-1.2.6/edlib/include -g -O2 -fdebug-prefix-map=/build/libedlib-1.2.6=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -Wold-style-cast -Wshadow -Wall -Wextra -pedantic -O3 -DNDEBUG -std=c++11 -o CMakeFiles/runTests.dir/test/runTests.cpp.o -c /build/libedlib-1.2.6/test/runTests.cpp [ 87%] Linking CXX executable bin/edlib-aligner /usr/bin/cmake -E cmake_link_script CMakeFiles/edlib-aligner.dir/link.txt --verbose=1 /usr/bin/c++ -g -O2 -fdebug-prefix-map=/build/libedlib-1.2.6=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -Wold-style-cast -Wshadow -Wall -Wextra -pedantic -O3 -DNDEBUG -Wl,-z,relro -Wl,-z,now -rdynamic CMakeFiles/edlib-aligner.dir/apps/aligner/aligner.cpp.o -o bin/edlib-aligner lib/libedlib_static.a [100%] Linking CXX executable bin/runTests /usr/bin/cmake -E cmake_link_script CMakeFiles/runTests.dir/link.txt --verbose=1 /usr/bin/c++ -g -O2 -fdebug-prefix-map=/build/libedlib-1.2.6=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -Wold-style-cast -Wshadow -Wall -Wextra -pedantic -O3 -DNDEBUG -Wl,-z,relro -Wl,-z,now -rdynamic CMakeFiles/runTests.dir/test/runTests.cpp.o -o bin/runTests -Wl,-rpath,/build/libedlib-1.2.6/obj-arm-linux-gnueabihf/lib lib/libedlib.so.1.2.5 make[4]: Leaving directory '/build/libedlib-1.2.6/obj-arm-linux-gnueabihf' [100%] Built target edlib-aligner make[4]: Leaving directory '/build/libedlib-1.2.6/obj-arm-linux-gnueabihf' [100%] Built target runTests make[3]: Leaving directory '/build/libedlib-1.2.6/obj-arm-linux-gnueabihf' /usr/bin/cmake -E cmake_progress_start /build/libedlib-1.2.6/obj-arm-linux-gnueabihf/CMakeFiles 0 make[2]: Leaving directory '/build/libedlib-1.2.6/obj-arm-linux-gnueabihf' # /usr/bin/make --directory=bindings/python /usr/bin/make --directory=bindings/python edlib pyedlib.bycython.cpp make[2]: Entering directory '/build/libedlib-1.2.6/bindings/python' cp -R ../../edlib . cython3 --cplus edlib.pyx -o edlib.bycython.cpp /usr/lib/python3/dist-packages/Cython/Compiler/Main.py:369: FutureWarning: Cython directive 'language_level' not set, using 2 for now (Py2). This will change in a later release! File: /build/libedlib-1.2.6/bindings/python/edlib.pyx tree = Parsing.p_module(s, pxd, full_module_name) make[2]: Leaving directory '/build/libedlib-1.2.6/bindings/python' dh_auto_build --buildsystem=pybuild -- --dir bindings/python I: pybuild base:232: /usr/bin/python3 setup.py build running build running build_ext building 'edlib' extension creating build creating build/temp.linux-armhf-3.9 creating build/temp.linux-armhf-3.9/edlib creating build/temp.linux-armhf-3.9/edlib/src arm-linux-gnueabihf-gcc -pthread -Wno-unused-result -Wsign-compare -DNDEBUG -g -fwrapv -O2 -Wall -g -ffile-prefix-map=/build/python3.9-jS0VHk/python3.9-3.9.2=. -fstack-protector-strong -Wformat -Werror=format-security -g -fwrapv -O2 -g -O2 -fdebug-prefix-map=/build/libedlib-1.2.6=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -fPIC -Iedlib/include -I/usr/include/python3.9 -c edlib.bycython.cpp -o build/temp.linux-armhf-3.9/edlib.bycython.o -O3 -std=c++11 arm-linux-gnueabihf-gcc -pthread -Wno-unused-result -Wsign-compare -DNDEBUG -g -fwrapv -O2 -Wall -g -ffile-prefix-map=/build/python3.9-jS0VHk/python3.9-3.9.2=. -fstack-protector-strong -Wformat -Werror=format-security -g -fwrapv -O2 -g -O2 -fdebug-prefix-map=/build/libedlib-1.2.6=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -fPIC -Iedlib/include -I/usr/include/python3.9 -c edlib/src/edlib.cpp -o build/temp.linux-armhf-3.9/edlib/src/edlib.o -O3 -std=c++11 arm-linux-gnueabihf-g++ -pthread -shared -Wl,-O1 -Wl,-Bsymbolic-functions -Wl,-z,relro -g -fwrapv -O2 -Wl,-z,relro -Wl,-z,now -g -O2 -fdebug-prefix-map=/build/libedlib-1.2.6=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 build/temp.linux-armhf-3.9/edlib.bycython.o build/temp.linux-armhf-3.9/edlib/src/edlib.o -o /build/libedlib-1.2.6/.pybuild/cpython3_3.9_edlib/build/edlib.cpython-39-arm-linux-gnueabihf.so make[1]: Leaving directory '/build/libedlib-1.2.6' debian/rules override_dh_auto_test make[1]: Entering directory '/build/libedlib-1.2.6' `find . -name edlib-aligner -type f -executable` -p apps/aligner/test_data/query.fasta apps/aligner/test_data/target.fasta Using NW alignment mode. Reading queries... Read 1 queries, 110 residues total. Reading target fasta file... Read target, 109 residues. Comparing queries to target... Query #0 (110 residues): score = 17 T: MMEEERFAASADEIFHVTQEVC-RTASELTESESRNVIVDELFCVGVTEM (0 - 48) ||||||| | |||||||||| ||||||||||||||||||||||||||| Q: MMEEERFKA---EIFHVTQEVCNRTASELTESESRNVIVDELFCVGVTEM (0 - 46) T: VAEQIRVLAKDIEA---HA-RKTVQPQDVLDDLCCRRNEGL-EIINNF-K (49 - 92) | |||||||||||| || |||||||||| ||||||||| |||||| | Q: VWEQIRVLAKDIEAFAEHAGRKTVQPQDVL--LCCRRNEGLYEIINNFHK (47 - 94) T: AESIKSKKKKKE-STTB (93 - 108) ||||||||||| ||| Q: -ESIKSKKKKKENSTT- (94 - 109) Cpu time of searching: 0.000176 `find . -name runTests` Testing HW with alignment... HW: 100/100 random tests passed! Time Edlib: 0.099856 Time Simple: 0.522726 Times faster: 5.23 Testing HW... HW: 100/100 random tests passed! Time Edlib: 0.081165 Time Simple: 0.526964 Times faster: 6.49 Testing NW with alignment... NW: 100/100 random tests passed! Time Edlib: 0.236394 Time Simple: 0.556830 Times faster: 2.36 Testing NW... NW: 100/100 random tests passed! Time Edlib: 0.046904 Time Simple: 0.477501 Times faster: 10.18 Testing SHW with alignment... SHW: 100/100 random tests passed! Time Edlib: 0.014169 Time Simple: 0.544843 Times faster: 38.45 Testing SHW... SHW: 100/100 random tests passed! Time Edlib: 0.009087 Time Simple: 0.538643 Times faster: 59.28 Specific tests: Test #0: HW:  OK  NW:  OK  SHW:  OK  Test #1: HW:  OK  NW:  OK  SHW:  OK  Test #2: HW:  OK  NW:  OK  SHW:  OK  Test #3: HW:  OK  NW:  OK  SHW:  OK  Test #4: HW:  OK  NW:  OK  SHW:  OK  Test #5: HW:  OK  NW:  OK  SHW:  OK  Test #6: HW:  OK  NW:  OK  SHW:  OK  Test #7: HW:  OK  NW:  OK  SHW:  OK  Test #8: HW:  OK  NW:  OK  SHW:  OK  Test #9: HW:  OK  NW:  OK  SHW:  OK  Test #10: HW:  OK  NW:  OK  SHW:  OK  Test #11: OK Test #12: OK Test #13: OK Test #14: OK Test #15: OK Test #16: Cigar extended: OK Cigar standard: OK Test #17: Degenerate nucleotides (HW): OK Test #18: Empty query or target: NW:  OK  NW:  OK  SHW:  OK  SHW:  OK  HW:  OK  HW:  OK  All specific tests passed! make[1]: Leaving directory '/build/libedlib-1.2.6' create-stamp debian/debhelper-build-stamp dh_testroot dh_prep debian/rules override_dh_auto_install make[1]: Entering directory '/build/libedlib-1.2.6' dh_auto_install --buildsystem=cmake cd obj-arm-linux-gnueabihf && make -j3 install DESTDIR=/build/libedlib-1.2.6/debian/tmp AM_UPDATE_INFO_DIR=no "INSTALL=install --strip-program=true" make[2]: Entering directory '/build/libedlib-1.2.6/obj-arm-linux-gnueabihf' /usr/bin/cmake -S/build/libedlib-1.2.6 -B/build/libedlib-1.2.6/obj-arm-linux-gnueabihf --check-build-system CMakeFiles/Makefile.cmake 0 /usr/bin/cmake -E cmake_progress_start /build/libedlib-1.2.6/obj-arm-linux-gnueabihf/CMakeFiles /build/libedlib-1.2.6/obj-arm-linux-gnueabihf//CMakeFiles/progress.marks make -f CMakeFiles/Makefile2 all make[3]: Entering directory '/build/libedlib-1.2.6/obj-arm-linux-gnueabihf' make -f CMakeFiles/edlib_static.dir/build.make CMakeFiles/edlib_static.dir/depend make -f CMakeFiles/edlib.dir/build.make CMakeFiles/edlib.dir/depend make[4]: Entering directory '/build/libedlib-1.2.6/obj-arm-linux-gnueabihf' cd /build/libedlib-1.2.6/obj-arm-linux-gnueabihf && /usr/bin/cmake -E cmake_depends "Unix Makefiles" /build/libedlib-1.2.6 /build/libedlib-1.2.6 /build/libedlib-1.2.6/obj-arm-linux-gnueabihf /build/libedlib-1.2.6/obj-arm-linux-gnueabihf /build/libedlib-1.2.6/obj-arm-linux-gnueabihf/CMakeFiles/edlib_static.dir/DependInfo.cmake --color= make[4]: Entering directory '/build/libedlib-1.2.6/obj-arm-linux-gnueabihf' cd /build/libedlib-1.2.6/obj-arm-linux-gnueabihf && /usr/bin/cmake -E cmake_depends "Unix Makefiles" /build/libedlib-1.2.6 /build/libedlib-1.2.6 /build/libedlib-1.2.6/obj-arm-linux-gnueabihf /build/libedlib-1.2.6/obj-arm-linux-gnueabihf /build/libedlib-1.2.6/obj-arm-linux-gnueabihf/CMakeFiles/edlib.dir/DependInfo.cmake --color= make[4]: Leaving directory '/build/libedlib-1.2.6/obj-arm-linux-gnueabihf' make -f CMakeFiles/edlib.dir/build.make CMakeFiles/edlib.dir/build make[4]: Entering directory '/build/libedlib-1.2.6/obj-arm-linux-gnueabihf' make[4]: Nothing to be done for 'CMakeFiles/edlib.dir/build'. make[4]: Leaving directory '/build/libedlib-1.2.6/obj-arm-linux-gnueabihf' make[4]: Leaving directory '/build/libedlib-1.2.6/obj-arm-linux-gnueabihf' make -f CMakeFiles/edlib_static.dir/build.make CMakeFiles/edlib_static.dir/build make[4]: Entering directory '/build/libedlib-1.2.6/obj-arm-linux-gnueabihf' make[4]: Nothing to be done for 'CMakeFiles/edlib_static.dir/build'. make[4]: Leaving directory '/build/libedlib-1.2.6/obj-arm-linux-gnueabihf' [ 25%] Built target edlib make -f CMakeFiles/runTests.dir/build.make CMakeFiles/runTests.dir/depend make[4]: Entering directory '/build/libedlib-1.2.6/obj-arm-linux-gnueabihf' cd /build/libedlib-1.2.6/obj-arm-linux-gnueabihf && /usr/bin/cmake -E cmake_depends "Unix Makefiles" /build/libedlib-1.2.6 /build/libedlib-1.2.6 /build/libedlib-1.2.6/obj-arm-linux-gnueabihf /build/libedlib-1.2.6/obj-arm-linux-gnueabihf /build/libedlib-1.2.6/obj-arm-linux-gnueabihf/CMakeFiles/runTests.dir/DependInfo.cmake --color= [ 50%] Built target edlib_static make -f CMakeFiles/edlib-aligner.dir/build.make CMakeFiles/edlib-aligner.dir/depend make[4]: Entering directory '/build/libedlib-1.2.6/obj-arm-linux-gnueabihf' cd /build/libedlib-1.2.6/obj-arm-linux-gnueabihf && /usr/bin/cmake -E cmake_depends "Unix Makefiles" /build/libedlib-1.2.6 /build/libedlib-1.2.6 /build/libedlib-1.2.6/obj-arm-linux-gnueabihf /build/libedlib-1.2.6/obj-arm-linux-gnueabihf /build/libedlib-1.2.6/obj-arm-linux-gnueabihf/CMakeFiles/edlib-aligner.dir/DependInfo.cmake --color= make[4]: Leaving directory '/build/libedlib-1.2.6/obj-arm-linux-gnueabihf' make -f CMakeFiles/runTests.dir/build.make CMakeFiles/runTests.dir/build make[4]: Entering directory '/build/libedlib-1.2.6/obj-arm-linux-gnueabihf' make[4]: Nothing to be done for 'CMakeFiles/runTests.dir/build'. make[4]: Leaving directory '/build/libedlib-1.2.6/obj-arm-linux-gnueabihf' make[4]: Leaving directory '/build/libedlib-1.2.6/obj-arm-linux-gnueabihf' make -f CMakeFiles/edlib-aligner.dir/build.make CMakeFiles/edlib-aligner.dir/build make[4]: Entering directory '/build/libedlib-1.2.6/obj-arm-linux-gnueabihf' make[4]: Nothing to be done for 'CMakeFiles/edlib-aligner.dir/build'. make[4]: Leaving directory '/build/libedlib-1.2.6/obj-arm-linux-gnueabihf' [ 75%] Built target runTests [100%] Built target edlib-aligner make[3]: Leaving directory '/build/libedlib-1.2.6/obj-arm-linux-gnueabihf' /usr/bin/cmake -E cmake_progress_start /build/libedlib-1.2.6/obj-arm-linux-gnueabihf/CMakeFiles 0 make -f CMakeFiles/Makefile2 preinstall make[3]: Entering directory '/build/libedlib-1.2.6/obj-arm-linux-gnueabihf' make[3]: Nothing to be done for 'preinstall'. make[3]: Leaving directory '/build/libedlib-1.2.6/obj-arm-linux-gnueabihf' Install the project... /usr/bin/cmake -P cmake_install.cmake -- Install configuration: "Release" -- Installing: /build/libedlib-1.2.6/debian/tmp/usr/lib/arm-linux-gnueabihf/libedlib.so.1.2.5 -- Installing: /build/libedlib-1.2.6/debian/tmp/usr/lib/arm-linux-gnueabihf/libedlib.so.0 -- Installing: /build/libedlib-1.2.6/debian/tmp/usr/lib/arm-linux-gnueabihf/libedlib.so -- Installing: /build/libedlib-1.2.6/debian/tmp/usr/lib/arm-linux-gnueabihf/libedlib_static.a -- Installing: /build/libedlib-1.2.6/debian/tmp/usr/include/edlib.h -- Installing: /build/libedlib-1.2.6/debian/tmp/usr/lib/arm-linux-gnueabihf/pkgconfig/edlib-1.pc make[2]: Leaving directory '/build/libedlib-1.2.6/obj-arm-linux-gnueabihf' dh_auto_install --buildsystem=pybuild -- --dir bindings/python I: pybuild base:232: /usr/bin/python3 setup.py install --root /build/libedlib-1.2.6/debian/python3-edlib running install running build running build_ext running install_lib creating /build/libedlib-1.2.6/debian/python3-edlib creating /build/libedlib-1.2.6/debian/python3-edlib/usr creating /build/libedlib-1.2.6/debian/python3-edlib/usr/lib creating /build/libedlib-1.2.6/debian/python3-edlib/usr/lib/python3.9 creating /build/libedlib-1.2.6/debian/python3-edlib/usr/lib/python3.9/dist-packages copying /build/libedlib-1.2.6/.pybuild/cpython3_3.9_edlib/build/edlib.cpython-39-arm-linux-gnueabihf.so -> /build/libedlib-1.2.6/debian/python3-edlib/usr/lib/python3.9/dist-packages running install_egg_info running egg_info creating edlib.egg-info writing edlib.egg-info/PKG-INFO writing dependency_links to edlib.egg-info/dependency_links.txt writing top-level names to edlib.egg-info/top_level.txt writing manifest file 'edlib.egg-info/SOURCES.txt' reading manifest file 'edlib.egg-info/SOURCES.txt' reading manifest template 'MANIFEST.in' writing manifest file 'edlib.egg-info/SOURCES.txt' Copying edlib.egg-info to /build/libedlib-1.2.6/debian/python3-edlib/usr/lib/python3.9/dist-packages/edlib-1.3.6.egg-info Skipping SOURCES.txt running install_scripts make[1]: Leaving directory '/build/libedlib-1.2.6' debian/rules override_dh_install make[1]: Entering directory '/build/libedlib-1.2.6' dh_install file-rename 's/_static\.a/.a/' `find debian -name libedlib_static.a` d-shlibmove --commit \ --multiarch \ --devunversioned \ --exclude-la \ --movedev debian/tmp/usr/include/* usr/include \ --movedev debian/tmp/usr/lib/*/pkgconfig usr/lib/arm-linux-gnueabihf \ debian/tmp/usr/lib/*/*.so Library package automatic movement utility set -e install -d -m 755 debian/libedlib-dev/usr/lib/arm-linux-gnueabihf install -d -m 755 debian/libedlib0/usr/lib/arm-linux-gnueabihf mv debian/tmp/usr/lib/arm-linux-gnueabihf/libedlib.a debian/libedlib-dev/usr/lib/arm-linux-gnueabihf mv debian/tmp/usr/lib/arm-linux-gnueabihf/libedlib.so debian/libedlib-dev/usr/lib/arm-linux-gnueabihf mv /build/libedlib-1.2.6/debian/tmp/usr/lib/arm-linux-gnueabihf/libedlib.so.0 debian/libedlib0/usr/lib/arm-linux-gnueabihf mv /build/libedlib-1.2.6/debian/tmp/usr/lib/arm-linux-gnueabihf/libedlib.so.1.2.5 debian/libedlib0/usr/lib/arm-linux-gnueabihf PKGDEV=libedlib-dev PKGSHL=libedlib0 install -d -m 755 debian/libedlib-dev/usr/include mv debian/tmp/usr/include/edlib.h debian/libedlib-dev/usr/include install -d -m 755 debian/libedlib-dev/usr/lib/arm-linux-gnueabihf mv debian/tmp/usr/lib/arm-linux-gnueabihf/pkgconfig debian/libedlib-dev/usr/lib/arm-linux-gnueabihf make[1]: Leaving directory '/build/libedlib-1.2.6' dh_installdocs dh_installchangelogs dh_installexamples dh_installman dh_python3 dh_perl dh_link dh_strip_nondeterminism dh_compress dh_fixperms dh_missing dh_dwz dh_strip dh_makeshlibs dh_shlibdeps dpkg-shlibdeps: warning: package could avoid a useless dependency if debian/python3-edlib/usr/lib/python3/dist-packages/edlib.cpython-39-arm-linux-gnueabihf.so was not linked against libpthread.so.0 (it uses none of the library's symbols) dh_installdeb dh_gencontrol dpkg-gencontrol: warning: package python3-edlib: substitution variable ${python3:Provides} unused, but is defined dpkg-gencontrol: warning: package python3-edlib: substitution variable ${python3:Versions} unused, but is defined dpkg-gencontrol: warning: Depends field of package libedlib-dev: substitution variable ${shlibs:Depends} used, but is not defined dpkg-gencontrol: warning: package python3-edlib: substitution variable ${python3:Provides} unused, but is defined dpkg-gencontrol: warning: package python3-edlib: substitution variable ${python3:Versions} unused, but is defined dh_md5sums dh_builddeb dpkg-deb: building package 'python3-edlib-dbgsym' in '../python3-edlib-dbgsym_1.2.6-1_armhf.deb'. dpkg-deb: building package 'edlib-aligner' in '../edlib-aligner_1.2.6-1_armhf.deb'. dpkg-deb: building package 'libedlib0' in '../libedlib0_1.2.6-1_armhf.deb'. dpkg-deb: building package 'edlib-aligner-dbgsym' in '../edlib-aligner-dbgsym_1.2.6-1_armhf.deb'. dpkg-deb: building package 'libedlib0-dbgsym' in '../libedlib0-dbgsym_1.2.6-1_armhf.deb'. dpkg-deb: building package 'libedlib-dev' in '../libedlib-dev_1.2.6-1_armhf.deb'. dpkg-deb: building package 'python3-edlib' in '../python3-edlib_1.2.6-1_armhf.deb'. dpkg-genbuildinfo --build=binary dpkg-genchanges --build=binary >../libedlib_1.2.6-1_armhf.changes dpkg-genchanges: info: binary-only upload (no source code included) dpkg-source --after-build . dpkg-buildpackage: info: binary-only upload (no source included) dpkg-genchanges: info: including full source code in upload I: copying local configuration I: unmounting dev/ptmx filesystem I: unmounting dev/pts filesystem I: unmounting dev/shm filesystem I: unmounting proc filesystem I: unmounting sys filesystem I: cleaning the build env I: removing directory /srv/workspace/pbuilder/18695 and its subdirectories I: Current time: Sat Jul 17 19:23:38 -12 2021 I: pbuilder-time-stamp: 1626593018 Sun Jul 18 07:23:51 UTC 2021 I: 1st build successful. Starting 2nd build on remote node cbxi4a-armhf-rb.debian.net. Sun Jul 18 07:23:51 UTC 2021 I: Preparing to do remote build '2' on cbxi4a-armhf-rb.debian.net. Sun Jul 18 07:37:29 UTC 2021 I: Deleting $TMPDIR on cbxi4a-armhf-rb.debian.net. Sun Jul 18 07:37:31 UTC 2021 I: libedlib_1.2.6-1_armhf.changes: Format: 1.8 Date: Tue, 12 Jan 2021 16:33:05 +0100 Source: libedlib Binary: edlib-aligner edlib-aligner-dbgsym libedlib-dev libedlib0 libedlib0-dbgsym python3-edlib python3-edlib-dbgsym Architecture: armhf Version: 1.2.6-1 Distribution: unstable Urgency: medium Maintainer: Debian Med Packaging Team Changed-By: Andreas Tille Description: edlib-aligner - edlib sequence alignment tool using edit distance libedlib-dev - library for sequence alignment using edit distance (devel) libedlib0 - library for sequence alignment using edit distance python3-edlib - library for sequence alignment using edit distance (Python3 modul Changes: libedlib (1.2.6-1) unstable; urgency=medium . [ Andreas Tille ] * New upstream version * Standards-Version: 4.5.1 (routine-update) . [ Steffen Moeller ] * Added refs to conda and omictools . [ Nilesh Patra ] * Refresh patch * Enable building both shared and static lib * Modify d-shlibs for pkgconfig and gnuinstalldirs * Rename lib package as per package version Checksums-Sha1: 509069c261d510fe9421573969a04cbffa32468a 118440 edlib-aligner-dbgsym_1.2.6-1_armhf.deb 0b81d10b3a32856f28f68556993d58005bf19136 19476 edlib-aligner_1.2.6-1_armhf.deb 10f1b5dddc90a7a415835f38fe2b6f208e41e580 15936 libedlib-dev_1.2.6-1_armhf.deb 6f4c04496fe548f0d0998e3395ce7bc928b649ee 75612 libedlib0-dbgsym_1.2.6-1_armhf.deb eadc990b4b1620c0449d4b38bd5afbac3cf9a88f 13536 libedlib0_1.2.6-1_armhf.deb dd17f8e1944c5d6da2af5573b5d3adcd89bbcb50 8159 libedlib_1.2.6-1_armhf.buildinfo d18099ec0203a62189cc22256e6b94ce638d4e14 272920 python3-edlib-dbgsym_1.2.6-1_armhf.deb d628c6621639dc085f91f134058542bc141d5433 52064 python3-edlib_1.2.6-1_armhf.deb Checksums-Sha256: af2bccf07a88335e6f2d8796f47582f43258c17401f38a1079dd66443f64584c 118440 edlib-aligner-dbgsym_1.2.6-1_armhf.deb cd382c839567992602fa8d69f771a287890121b2f7110c45db10d15764dbc49f 19476 edlib-aligner_1.2.6-1_armhf.deb 84f27c6e1b3c3311bb465f84bb73b9cbdc93e41292f359783360a364adbf17b1 15936 libedlib-dev_1.2.6-1_armhf.deb 804f7f9d0b9e675799f5b5294d7d00901dd9dfe6b33e3279d5be7c2f13d71bb1 75612 libedlib0-dbgsym_1.2.6-1_armhf.deb 70ccd9cc2e684915e1adc95b3dc42e7183d824890a1525f0b2747814be37ebb5 13536 libedlib0_1.2.6-1_armhf.deb 339c1f3745ab7c91b0098dec2cfbf79269afcf0bff0e414f4df088505735a149 8159 libedlib_1.2.6-1_armhf.buildinfo 8597f5135f16793690e5e2ddfad46e35563dce84818d814880aaba4c0a765650 272920 python3-edlib-dbgsym_1.2.6-1_armhf.deb 2f1b9efcf1a3cc9a6a971fc04a56933f3e412fc4aa2c86ab1a3e8a3f45adea4f 52064 python3-edlib_1.2.6-1_armhf.deb Files: 359c61d825d00e8cd63ba0903925b674 118440 debug optional edlib-aligner-dbgsym_1.2.6-1_armhf.deb f2f9275cca6c95948c834a811ba7d936 19476 science optional edlib-aligner_1.2.6-1_armhf.deb dbad7f32567e113734110855858b84be 15936 libdevel optional libedlib-dev_1.2.6-1_armhf.deb b3f99484066c22d3113c2bcb7e30f211 75612 debug optional libedlib0-dbgsym_1.2.6-1_armhf.deb db13f157acd9c963420d0be95d0069a3 13536 libs optional libedlib0_1.2.6-1_armhf.deb ffe5a174553bab7dcb4f3fc5c8e62a15 8159 science optional libedlib_1.2.6-1_armhf.buildinfo 776707d69ef70e7d8307e7fc8c4ff940 272920 debug optional python3-edlib-dbgsym_1.2.6-1_armhf.deb c58750fbcd3630e7ca9e02516d257cbc 52064 python optional python3-edlib_1.2.6-1_armhf.deb Sun Jul 18 07:37:32 UTC 2021 I: diffoscope 177 will be used to compare the two builds: # Profiling output for: /usr/bin/diffoscope --html /srv/reproducible-results/rbuild-debian/tmp.Fs1QT5B6eF/libedlib_1.2.6-1.diffoscope.html --text /srv/reproducible-results/rbuild-debian/tmp.Fs1QT5B6eF/libedlib_1.2.6-1.diffoscope.txt --json /srv/reproducible-results/rbuild-debian/tmp.Fs1QT5B6eF/libedlib_1.2.6-1.diffoscope.json --profile=- /srv/reproducible-results/rbuild-debian/tmp.Fs1QT5B6eF/b1/libedlib_1.2.6-1_armhf.changes /srv/reproducible-results/rbuild-debian/tmp.Fs1QT5B6eF/b2/libedlib_1.2.6-1_armhf.changes ## command (total time: 0.000s) 0.000s 1 call cmp (internal) ## has_same_content_as (total time: 0.000s) 0.000s 1 call abc.DotChangesFile ## main (total time: 0.241s) 0.241s 2 calls outputs 0.000s 1 call cleanup ## recognizes (total time: 0.025s) 0.024s 10 calls diffoscope.comparators.binary.FilesystemFile 0.000s 8 calls abc.DotChangesFile Sun Jul 18 07:37:34 UTC 2021 I: diffoscope 177 found no differences in the changes files, and a .buildinfo file also exists. Sun Jul 18 07:37:34 UTC 2021 I: libedlib from bullseye built successfully and reproducibly on armhf. Sun Jul 18 07:37:35 UTC 2021 I: Submitting .buildinfo files to external archives: Sun Jul 18 07:37:35 UTC 2021 I: Submitting 12K b1/libedlib_1.2.6-1_armhf.buildinfo.asc Sun Jul 18 07:37:37 UTC 2021 I: Submitting 12K b2/libedlib_1.2.6-1_armhf.buildinfo.asc Sun Jul 18 07:37:38 UTC 2021 I: Done submitting .buildinfo files to http://buildinfo.debian.net/api/submit. Sun Jul 18 07:37:38 UTC 2021 I: Done submitting .buildinfo files. Sun Jul 18 07:37:38 UTC 2021 I: Removing signed libedlib_1.2.6-1_armhf.buildinfo.asc files: removed './b1/libedlib_1.2.6-1_armhf.buildinfo.asc' removed './b2/libedlib_1.2.6-1_armhf.buildinfo.asc'